data_1ZG2 # _entry.id 1ZG2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ZG2 pdb_00001zg2 10.2210/pdb1zg2/pdb RCSB RCSB032677 ? ? WWPDB D_1000032677 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-06-21 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZG2 _pdbx_database_status.recvd_initial_deposition_date 2005-04-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id BhR2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Aramini, J.M.' 1 'Swapna, G.V.T.' 2 'Xiao, R.' 3 'Ma, L.' 4 'Shastry, R.' 5 'Ciano, M.' 6 'Acton, T.B.' 7 'Liu, J.' 8 'Rost, B.' 9 'Cort, J.R.' 10 'Kennedy, M.A.' 11 'Montelione, G.T.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title 'Solution NMR structure of the UPF0213 protein BH0048 from Bacillus halodurans. Northeast Structural Genomics target BhR2.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Aramini, J.M.' 1 ? primary 'Swapna, G.V.T.' 2 ? primary 'Xiao, R.' 3 ? primary 'Ma, L.' 4 ? primary 'Shastry, R.' 5 ? primary 'Ciano, M.' 6 ? primary 'Acton, T.B.' 7 ? primary 'Liu, J.' 8 ? primary 'Rost, B.' 9 ? primary 'Cort, J.R.' 10 ? primary 'Kennedy, M.A.' 11 ? primary 'Montelione, G.T.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical UPF0213 protein BH0048' _entity.formula_weight 12556.251 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAGDPMNHYVYILECKDGSWYTGYTTDVDRRIKKHASGKGAKYTRGRGPFRLVATWAFPSKEEAMRWEYEVKHLSRRKKE QLVSLKGGPYENTTKLSTTLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAGDPMNHYVYILECKDGSWYTGYTTDVDRRIKKHASGKGAKYTRGRGPFRLVATWAFPSKEEAMRWEYEVKHLSRRKKE QLVSLKGGPYENTTKLSTTLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier BhR2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLY n 1 4 ASP n 1 5 PRO n 1 6 MET n 1 7 ASN n 1 8 HIS n 1 9 TYR n 1 10 VAL n 1 11 TYR n 1 12 ILE n 1 13 LEU n 1 14 GLU n 1 15 CYS n 1 16 LYS n 1 17 ASP n 1 18 GLY n 1 19 SER n 1 20 TRP n 1 21 TYR n 1 22 THR n 1 23 GLY n 1 24 TYR n 1 25 THR n 1 26 THR n 1 27 ASP n 1 28 VAL n 1 29 ASP n 1 30 ARG n 1 31 ARG n 1 32 ILE n 1 33 LYS n 1 34 LYS n 1 35 HIS n 1 36 ALA n 1 37 SER n 1 38 GLY n 1 39 LYS n 1 40 GLY n 1 41 ALA n 1 42 LYS n 1 43 TYR n 1 44 THR n 1 45 ARG n 1 46 GLY n 1 47 ARG n 1 48 GLY n 1 49 PRO n 1 50 PHE n 1 51 ARG n 1 52 LEU n 1 53 VAL n 1 54 ALA n 1 55 THR n 1 56 TRP n 1 57 ALA n 1 58 PHE n 1 59 PRO n 1 60 SER n 1 61 LYS n 1 62 GLU n 1 63 GLU n 1 64 ALA n 1 65 MET n 1 66 ARG n 1 67 TRP n 1 68 GLU n 1 69 TYR n 1 70 GLU n 1 71 VAL n 1 72 LYS n 1 73 HIS n 1 74 LEU n 1 75 SER n 1 76 ARG n 1 77 ARG n 1 78 LYS n 1 79 LYS n 1 80 GLU n 1 81 GLN n 1 82 LEU n 1 83 VAL n 1 84 SER n 1 85 LEU n 1 86 LYS n 1 87 GLY n 1 88 GLY n 1 89 PRO n 1 90 TYR n 1 91 GLU n 1 92 ASN n 1 93 THR n 1 94 THR n 1 95 LYS n 1 96 LEU n 1 97 SER n 1 98 THR n 1 99 THR n 1 100 LEU n 1 101 GLU n 1 102 HIS n 1 103 HIS n 1 104 HIS n 1 105 HIS n 1 106 HIS n 1 107 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus halodurans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 86665 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21MGK _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PET21 _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BhR2-21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 PRO 5 5 ? ? ? A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 THR 94 94 94 THR THR A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 LEU 100 100 ? ? ? A . n A 1 101 GLU 101 101 ? ? ? A . n A 1 102 HIS 102 102 ? ? ? A . n A 1 103 HIS 103 103 ? ? ? A . n A 1 104 HIS 104 104 ? ? ? A . n A 1 105 HIS 105 105 ? ? ? A . n A 1 106 HIS 106 106 ? ? ? A . n A 1 107 HIS 107 107 ? ? ? A . n # _exptl.entry_id 1ZG2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1ZG2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1ZG2 _struct.title 'Solution NMR structure of the UPF0213 protein BH0048 from Bacillus halodurans. Northeast Structural Genomics target BhR2.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZG2 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;BhR2, Autostructure, Northeast Structural Genomics Consortium, PSI, Protein Structure Initiative, NESG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y048_BACHD _struct_ref.pdbx_db_accession Q9KGL3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNHYVYILECKDGSWYTGYTTDVDRRIKKHASGKGAKYTRGRGPFRLVATWAFPSKEEAMRWEYEVKHLSRRKKEQLVSL KGGPYENTTKLSTT ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ZG2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 99 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9KGL3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 94 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 99 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1ZG2 MET A 1 ? UNP Q9KGL3 ? ? 'cloning artifact' 1 1 1 1ZG2 ALA A 2 ? UNP Q9KGL3 ? ? 'cloning artifact' 2 2 1 1ZG2 GLY A 3 ? UNP Q9KGL3 ? ? 'cloning artifact' 3 3 1 1ZG2 ASP A 4 ? UNP Q9KGL3 ? ? 'cloning artifact' 4 4 1 1ZG2 PRO A 5 ? UNP Q9KGL3 ? ? 'cloning artifact' 5 5 1 1ZG2 LEU A 100 ? UNP Q9KGL3 ? ? 'cloning artifact' 100 6 1 1ZG2 GLU A 101 ? UNP Q9KGL3 ? ? 'cloning artifact' 101 7 1 1ZG2 HIS A 102 ? UNP Q9KGL3 ? ? 'cloning artifact' 102 8 1 1ZG2 HIS A 103 ? UNP Q9KGL3 ? ? 'cloning artifact' 103 9 1 1ZG2 HIS A 104 ? UNP Q9KGL3 ? ? 'cloning artifact' 104 10 1 1ZG2 HIS A 105 ? UNP Q9KGL3 ? ? 'cloning artifact' 105 11 1 1ZG2 HIS A 106 ? UNP Q9KGL3 ? ? 'cloning artifact' 106 12 1 1ZG2 HIS A 107 ? UNP Q9KGL3 ? ? 'cloning artifact' 107 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 27 ? LYS A 39 ? ASP A 27 LYS A 39 1 ? 13 HELX_P HELX_P2 2 SER A 60 ? LEU A 74 ? SER A 60 LEU A 74 1 ? 15 HELX_P HELX_P3 3 SER A 75 ? LYS A 86 ? SER A 75 LYS A 86 1 ? 12 HELX_P HELX_P4 4 GLY A 88 ? THR A 93 ? GLY A 88 THR A 93 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 48 A . ? GLY 48 A PRO 49 A ? PRO 49 A 1 -2.96 2 GLY 48 A . ? GLY 48 A PRO 49 A ? PRO 49 A 2 -0.90 3 GLY 48 A . ? GLY 48 A PRO 49 A ? PRO 49 A 3 -1.67 4 GLY 48 A . ? GLY 48 A PRO 49 A ? PRO 49 A 4 -0.69 5 GLY 48 A . ? GLY 48 A PRO 49 A ? PRO 49 A 5 -2.96 6 GLY 48 A . ? GLY 48 A PRO 49 A ? PRO 49 A 6 -2.04 7 GLY 48 A . ? GLY 48 A PRO 49 A ? PRO 49 A 7 -4.02 8 GLY 48 A . ? GLY 48 A PRO 49 A ? PRO 49 A 8 -4.21 9 GLY 48 A . ? GLY 48 A PRO 49 A ? PRO 49 A 9 -6.89 10 GLY 48 A . ? GLY 48 A PRO 49 A ? PRO 49 A 10 -1.79 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 20 ? THR A 25 ? TRP A 20 THR A 25 A 2 HIS A 8 ? GLU A 14 ? HIS A 8 GLU A 14 A 3 ARG A 51 ? PHE A 58 ? ARG A 51 PHE A 58 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 21 ? O TYR A 21 N LEU A 13 ? N LEU A 13 A 2 3 N VAL A 10 ? N VAL A 10 O TRP A 56 ? O TRP A 56 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HH21 A ARG 30 ? ? OE2 A GLU 91 ? ? 1.56 2 3 HA A THR 44 ? ? HB3 A ASN 92 ? ? 1.33 3 3 O A GLY 38 ? ? HZ1 A LYS 95 ? ? 1.60 4 3 HZ3 A LYS 61 ? ? OE2 A GLU 62 ? ? 1.60 5 5 HG21 A VAL 10 ? ? HE1 A TRP 67 ? ? 1.28 6 7 O A VAL 71 ? ? HZ2 A LYS 78 ? ? 1.59 7 8 HB2 A ASN 7 ? ? HB3 A ASP 27 ? ? 1.20 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 26 ? ? -152.05 74.76 2 1 LYS A 39 ? ? -66.60 92.00 3 1 ARG A 45 ? ? -161.00 118.11 4 1 ARG A 47 ? ? -158.61 -47.94 5 1 LYS A 86 ? ? -163.16 119.64 6 1 LYS A 95 ? ? -170.73 -66.03 7 1 LEU A 96 ? ? 61.79 -86.76 8 1 SER A 97 ? ? -157.53 12.52 9 2 ALA A 41 ? ? 73.73 -40.30 10 2 THR A 44 ? ? -53.06 -75.69 11 2 ARG A 45 ? ? 44.13 -129.39 12 2 ARG A 47 ? ? 67.66 102.61 13 2 GLU A 91 ? ? -82.59 -114.27 14 2 LYS A 95 ? ? -170.28 28.20 15 2 LEU A 96 ? ? 63.75 -79.95 16 2 SER A 97 ? ? -174.15 25.57 17 2 THR A 98 ? ? 64.79 -80.02 18 3 LYS A 39 ? ? 47.89 -97.25 19 3 THR A 44 ? ? -163.41 -163.04 20 3 ARG A 45 ? ? 71.52 171.15 21 3 GLU A 91 ? ? 56.55 -153.64 22 3 ASN A 92 ? ? 71.77 31.32 23 3 THR A 93 ? ? -83.60 34.77 24 3 THR A 94 ? ? -65.82 90.70 25 3 LYS A 95 ? ? -170.74 -44.84 26 3 LEU A 96 ? ? 56.13 76.52 27 4 ALA A 41 ? ? 66.18 129.86 28 4 TYR A 43 ? ? 70.11 -74.71 29 4 THR A 44 ? ? 50.80 -170.60 30 4 TYR A 90 ? ? -163.18 104.77 31 4 GLU A 91 ? ? 74.27 142.74 32 4 THR A 94 ? ? -103.05 -96.40 33 4 LYS A 95 ? ? 58.36 14.80 34 5 ALA A 41 ? ? -149.45 -78.54 35 5 LYS A 42 ? ? 52.93 71.68 36 5 VAL A 53 ? ? -91.88 -61.10 37 5 TYR A 90 ? ? 168.33 -32.13 38 5 THR A 93 ? ? 56.21 81.85 39 5 LEU A 96 ? ? 73.57 -4.43 40 6 ASP A 17 ? ? -74.49 -70.52 41 6 ARG A 45 ? ? 69.50 171.99 42 6 GLU A 91 ? ? -167.06 73.14 43 6 ASN A 92 ? ? 67.14 -61.03 44 6 THR A 93 ? ? 61.13 -12.59 45 6 THR A 94 ? ? 73.98 134.12 46 6 LYS A 95 ? ? 74.32 87.99 47 6 SER A 97 ? ? 76.22 167.22 48 7 THR A 26 ? ? -154.09 57.89 49 7 LYS A 39 ? ? 73.34 77.48 50 7 ALA A 41 ? ? 61.20 -91.92 51 7 THR A 44 ? ? -158.44 15.03 52 7 ARG A 45 ? ? 42.18 -156.25 53 7 ARG A 76 ? ? -29.39 -47.09 54 7 LYS A 86 ? ? -161.95 97.65 55 7 ASN A 92 ? ? -87.53 34.72 56 7 LEU A 96 ? ? 69.77 -80.63 57 7 SER A 97 ? ? -159.71 -73.98 58 8 LYS A 39 ? ? 69.81 -65.94 59 8 ALA A 41 ? ? 53.07 89.45 60 8 ARG A 47 ? ? -107.12 -71.98 61 8 TYR A 90 ? ? -160.61 21.47 62 8 GLU A 91 ? ? 62.25 -80.22 63 8 ASN A 92 ? ? -169.85 -44.27 64 8 LEU A 96 ? ? 69.81 -64.45 65 9 ASP A 27 ? ? -69.02 -176.28 66 9 LYS A 39 ? ? 46.93 83.27 67 9 TYR A 43 ? ? 69.64 114.82 68 9 THR A 44 ? ? -77.62 38.59 69 9 ARG A 45 ? ? 70.94 -59.28 70 9 ARG A 47 ? ? 55.81 74.39 71 9 ASN A 92 ? ? 76.53 -38.45 72 9 LEU A 96 ? ? -47.47 90.46 73 9 SER A 97 ? ? -158.90 87.10 74 9 THR A 98 ? ? -151.60 -36.76 75 10 LYS A 39 ? ? 69.61 -64.68 76 10 LYS A 42 ? ? -108.54 -168.37 77 10 TYR A 43 ? ? -76.14 40.84 78 10 THR A 44 ? ? -69.46 94.47 79 10 ARG A 45 ? ? 64.90 90.84 80 10 ARG A 47 ? ? -100.57 -61.92 81 10 ASN A 92 ? ? 72.04 -50.98 82 10 LYS A 95 ? ? -163.32 19.31 83 10 SER A 97 ? ? -91.77 -72.34 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.entry_id 1ZG2 _pdbx_nmr_ensemble.conformers_calculated_total_number 56 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1ZG2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.67 mM U-13C,15N BhR2, 20mM MES, 100mM NaCl, 5mM CaCl2, 10mM DTT, 0.02% NaN3, pH 6.5' '5% D2O/95% H2O' 2 '0.67 mM U-13C,15N BhR2, 20mM MES, 100mM NaCl, 5mM CaCl2, 10mM DTT, 0.02% NaN3, pH 6.5' '100% D2O' 3 '0.56 mM U-15N,5% 13C BhR2, 20mM MES, 100mM NaCl, 5mM CaCl2, 10mM DTT, 0.02% NaN3, pH 6.5' '5% D2O/95% H2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 3 1 3D_13C-separated_NOESY 2 4 1 HNHA 1 5 1 'high resolution CH-HSQC' 3 6 1 'backbone TR expts, TOCSYs, HCCH COSY' 1 # _pdbx_nmr_details.entry_id 1ZG2 _pdbx_nmr_details.text ;The structure was determined using triple resonance NMR spectroscopy. Partial automated backbone assignments were made using AUTOASSIGN, and the assignments were completed manually. Automatic NOESY assignments as well as distance and hydrogen bond constraints were determined using AUTOSTRUCTURE. Dihedral angle constraints were determined using HYPER and Talos. Completeness of NMR assignments (excluding N- and C-tags): backbone, 98%; side chain, 86%, aromatics, 100%; stereospecific methyl, 100%. Final structure quality factors (excluding the tags), where ordered residues [S(PHI) + S(PSI) > 1.8] comprise 7-16,19-25,27-38,51-85: (A) RMSD (6-30,48-86): BB 1.0; heavy atom, 1.6. FindCore RMSD: BB, 0.63; heavy atom, 0.86. (B) Ramachandran statistics for ordered residues: most favored, 96.7%, additionally allowed, 3.3%, generously allowed, 0.0%, disallowed, 0.0%. (C) Procheck scores for ordered residues (Raw/Z-): Phi-Psi, 0.02/0.39; All, -0.10/-0.59. (D) MolProbity clash score (Raw/Z-): 24.24/-2.63. (E) RPF scores for goodness of fit to NOESY data: F-measure, 0.916; Recall, 0.922; Precision, 0.910; DP-score, 0.663. ; # _pdbx_nmr_refine.entry_id 1ZG2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structures are based on a total of 835 conformationally-restricting NOE-derived distance constraints, 250 dihedral angle constraints, and 52 hydrogen bond constraints (12.2 constraints per residue excluding tags; 2.9 long range constraints per residue). Structure determination was performed iteratively using AUTOSTRUCTURE (Xplor). The 10 lowest energy structures were further refined by restrained molecular dyanmics/energy minimization in explicit water (CNS). The unstructured N- (MAGDP) and C- (LEHHHHHH) terminal tags were included in all calculations but have been omitted from this deposition. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5pl6 Bruker 1 collection VNMR 6.1C Varian 2 processing NMRPipe 2.3 'Delaglio et al.' 3 'data analysis' Sparky 3.91 'Goddard & Kneller' 4 'data analysis' AutoAssign 1.15 'Zimmerman, Moseley, Montelione' 5 refinement AutoStructure 2.1.0 'Huang, Montelione' 6 refinement XPLOR-NIH 2.0.6 'Clore et al.' 7 refinement CNS 1.1 'Brunger et al.' 8 'data analysis' PdbStat 3.25 'Tejero & Montelione' 9 'data analysis' PSVS 1.0 'Bhattacharya & Montelione' 10 'data analysis' FindCore 1.0 'Snyder & Montelione' 11 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A PRO 5 ? A PRO 5 6 1 Y 1 A LEU 100 ? A LEU 100 7 1 Y 1 A GLU 101 ? A GLU 101 8 1 Y 1 A HIS 102 ? A HIS 102 9 1 Y 1 A HIS 103 ? A HIS 103 10 1 Y 1 A HIS 104 ? A HIS 104 11 1 Y 1 A HIS 105 ? A HIS 105 12 1 Y 1 A HIS 106 ? A HIS 106 13 1 Y 1 A HIS 107 ? A HIS 107 14 2 Y 1 A MET 1 ? A MET 1 15 2 Y 1 A ALA 2 ? A ALA 2 16 2 Y 1 A GLY 3 ? A GLY 3 17 2 Y 1 A ASP 4 ? A ASP 4 18 2 Y 1 A PRO 5 ? A PRO 5 19 2 Y 1 A LEU 100 ? A LEU 100 20 2 Y 1 A GLU 101 ? A GLU 101 21 2 Y 1 A HIS 102 ? A HIS 102 22 2 Y 1 A HIS 103 ? A HIS 103 23 2 Y 1 A HIS 104 ? A HIS 104 24 2 Y 1 A HIS 105 ? A HIS 105 25 2 Y 1 A HIS 106 ? A HIS 106 26 2 Y 1 A HIS 107 ? A HIS 107 27 3 Y 1 A MET 1 ? A MET 1 28 3 Y 1 A ALA 2 ? A ALA 2 29 3 Y 1 A GLY 3 ? A GLY 3 30 3 Y 1 A ASP 4 ? A ASP 4 31 3 Y 1 A PRO 5 ? A PRO 5 32 3 Y 1 A LEU 100 ? A LEU 100 33 3 Y 1 A GLU 101 ? A GLU 101 34 3 Y 1 A HIS 102 ? A HIS 102 35 3 Y 1 A HIS 103 ? A HIS 103 36 3 Y 1 A HIS 104 ? A HIS 104 37 3 Y 1 A HIS 105 ? A HIS 105 38 3 Y 1 A HIS 106 ? A HIS 106 39 3 Y 1 A HIS 107 ? A HIS 107 40 4 Y 1 A MET 1 ? A MET 1 41 4 Y 1 A ALA 2 ? A ALA 2 42 4 Y 1 A GLY 3 ? A GLY 3 43 4 Y 1 A ASP 4 ? A ASP 4 44 4 Y 1 A PRO 5 ? A PRO 5 45 4 Y 1 A LEU 100 ? A LEU 100 46 4 Y 1 A GLU 101 ? A GLU 101 47 4 Y 1 A HIS 102 ? A HIS 102 48 4 Y 1 A HIS 103 ? A HIS 103 49 4 Y 1 A HIS 104 ? A HIS 104 50 4 Y 1 A HIS 105 ? A HIS 105 51 4 Y 1 A HIS 106 ? A HIS 106 52 4 Y 1 A HIS 107 ? A HIS 107 53 5 Y 1 A MET 1 ? A MET 1 54 5 Y 1 A ALA 2 ? A ALA 2 55 5 Y 1 A GLY 3 ? A GLY 3 56 5 Y 1 A ASP 4 ? A ASP 4 57 5 Y 1 A PRO 5 ? A PRO 5 58 5 Y 1 A LEU 100 ? A LEU 100 59 5 Y 1 A GLU 101 ? A GLU 101 60 5 Y 1 A HIS 102 ? A HIS 102 61 5 Y 1 A HIS 103 ? A HIS 103 62 5 Y 1 A HIS 104 ? A HIS 104 63 5 Y 1 A HIS 105 ? A HIS 105 64 5 Y 1 A HIS 106 ? A HIS 106 65 5 Y 1 A HIS 107 ? A HIS 107 66 6 Y 1 A MET 1 ? A MET 1 67 6 Y 1 A ALA 2 ? A ALA 2 68 6 Y 1 A GLY 3 ? A GLY 3 69 6 Y 1 A ASP 4 ? A ASP 4 70 6 Y 1 A PRO 5 ? A PRO 5 71 6 Y 1 A LEU 100 ? A LEU 100 72 6 Y 1 A GLU 101 ? A GLU 101 73 6 Y 1 A HIS 102 ? A HIS 102 74 6 Y 1 A HIS 103 ? A HIS 103 75 6 Y 1 A HIS 104 ? A HIS 104 76 6 Y 1 A HIS 105 ? A HIS 105 77 6 Y 1 A HIS 106 ? A HIS 106 78 6 Y 1 A HIS 107 ? A HIS 107 79 7 Y 1 A MET 1 ? A MET 1 80 7 Y 1 A ALA 2 ? A ALA 2 81 7 Y 1 A GLY 3 ? A GLY 3 82 7 Y 1 A ASP 4 ? A ASP 4 83 7 Y 1 A PRO 5 ? A PRO 5 84 7 Y 1 A LEU 100 ? A LEU 100 85 7 Y 1 A GLU 101 ? A GLU 101 86 7 Y 1 A HIS 102 ? A HIS 102 87 7 Y 1 A HIS 103 ? A HIS 103 88 7 Y 1 A HIS 104 ? A HIS 104 89 7 Y 1 A HIS 105 ? A HIS 105 90 7 Y 1 A HIS 106 ? A HIS 106 91 7 Y 1 A HIS 107 ? A HIS 107 92 8 Y 1 A MET 1 ? A MET 1 93 8 Y 1 A ALA 2 ? A ALA 2 94 8 Y 1 A GLY 3 ? A GLY 3 95 8 Y 1 A ASP 4 ? A ASP 4 96 8 Y 1 A PRO 5 ? A PRO 5 97 8 Y 1 A LEU 100 ? A LEU 100 98 8 Y 1 A GLU 101 ? A GLU 101 99 8 Y 1 A HIS 102 ? A HIS 102 100 8 Y 1 A HIS 103 ? A HIS 103 101 8 Y 1 A HIS 104 ? A HIS 104 102 8 Y 1 A HIS 105 ? A HIS 105 103 8 Y 1 A HIS 106 ? A HIS 106 104 8 Y 1 A HIS 107 ? A HIS 107 105 9 Y 1 A MET 1 ? A MET 1 106 9 Y 1 A ALA 2 ? A ALA 2 107 9 Y 1 A GLY 3 ? A GLY 3 108 9 Y 1 A ASP 4 ? A ASP 4 109 9 Y 1 A PRO 5 ? A PRO 5 110 9 Y 1 A LEU 100 ? A LEU 100 111 9 Y 1 A GLU 101 ? A GLU 101 112 9 Y 1 A HIS 102 ? A HIS 102 113 9 Y 1 A HIS 103 ? A HIS 103 114 9 Y 1 A HIS 104 ? A HIS 104 115 9 Y 1 A HIS 105 ? A HIS 105 116 9 Y 1 A HIS 106 ? A HIS 106 117 9 Y 1 A HIS 107 ? A HIS 107 118 10 Y 1 A MET 1 ? A MET 1 119 10 Y 1 A ALA 2 ? A ALA 2 120 10 Y 1 A GLY 3 ? A GLY 3 121 10 Y 1 A ASP 4 ? A ASP 4 122 10 Y 1 A PRO 5 ? A PRO 5 123 10 Y 1 A LEU 100 ? A LEU 100 124 10 Y 1 A GLU 101 ? A GLU 101 125 10 Y 1 A HIS 102 ? A HIS 102 126 10 Y 1 A HIS 103 ? A HIS 103 127 10 Y 1 A HIS 104 ? A HIS 104 128 10 Y 1 A HIS 105 ? A HIS 105 129 10 Y 1 A HIS 106 ? A HIS 106 130 10 Y 1 A HIS 107 ? A HIS 107 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 500 ? 2 INOVA Varian 500 ? 3 INOVA Varian 600 ? 4 INOVA Varian 750 ? # _atom_sites.entry_id 1ZG2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_