data_1ZIJ # _entry.id 1ZIJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1ZIJ WWPDB D_1000177483 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZIJ _pdbx_database_status.recvd_initial_deposition_date 1996-10-30 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gonzalez Junior, L.' 1 'Brown, R.A.' 2 'Richardson, D.' 3 'Alber, T.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal structures of a single coiled-coil peptide in two oligomeric states reveal the basis for structural polymorphism' Nat.Struct.Biol. 3 1002 1010 1996 NSBIEW US 1072-8368 2024 ? 8946853 10.1038/nsb1296-1002 1 'An Engineered Allosteric Switch in Leucine-Zipper Oligomerization' Nat.Struct.Biol. 3 510 ? 1996 NSBIEW US 1072-8368 2024 ? ? ? 2 'Crystal Structure of an Isoleucine-Zipper Trimer' Nature 371 80 ? 1994 NATUAS UK 0028-0836 0006 ? ? ? 3 'A Switch between Two-, Three-, and Four-Stranded Coiled Coils in GCN4 Leucine Zipper Mutants' Science 262 1401 ? 1993 SCIEAS US 0036-8075 0038 ? ? ? 4 'X-Ray Structure of the GCN4 Leucine Zipper, a Two-Stranded, Parallel Coiled Coil' Science 254 539 ? 1991 SCIEAS US 0036-8075 0038 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Gonzalez Junior, L.' 1 primary 'Brown, R.A.' 2 primary 'Richardson, D.' 3 primary 'Alber, T.' 4 1 'Gonzalez Junior, L.' 5 1 'Plecs, J.J.' 6 1 'Alber, T.' 7 2 'Harbury, P.B.' 8 2 'Kim, P.S.' 9 2 'Alber, T.' 10 3 'Harbury, P.B.' 11 3 'Zhang, T.' 12 3 'Kim, P.S.' 13 3 'Alber, T.' 14 4 ;O'Shea, E.K. ; 15 4 'Klemm, J.D.' 16 4 'Kim, P.S.' 17 4 'Alber, T.' 18 # _cell.entry_id 1ZIJ _cell.length_a 37.190 _cell.length_b 46.590 _cell.length_c 51.530 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ZIJ _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GENERAL CONTROL PROTEIN GCN4' 4002.703 3 ? 'ASN 16 REPLACED WITH AMINOBUTYRIC ACID (ABA)' ? 'THIS STRUCTURE IS IN THE TRIMERIC STATE' 2 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name GCN4 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ACE)RMKQLEDKVEELLSK(ABA)YHLENEVARLKKLVGER' _entity_poly.pdbx_seq_one_letter_code_can XRMKQLEDKVEELLSKAYHLENEVARLKKLVGER _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 ARG n 1 3 MET n 1 4 LYS n 1 5 GLN n 1 6 LEU n 1 7 GLU n 1 8 ASP n 1 9 LYS n 1 10 VAL n 1 11 GLU n 1 12 GLU n 1 13 LEU n 1 14 LEU n 1 15 SER n 1 16 LYS n 1 17 ABA n 1 18 TYR n 1 19 HIS n 1 20 LEU n 1 21 GLU n 1 22 ASN n 1 23 GLU n 1 24 VAL n 1 25 ALA n 1 26 ARG n 1 27 LEU n 1 28 LYS n 1 29 LYS n 1 30 LEU n 1 31 VAL n 1 32 GLY n 1 33 GLU n 1 34 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GCN4_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P03069 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSEYQPSLFALNPMGFSPLDGSKSTNENVSASTSTAKPMVGQLIFDKFIKTEEDPIIKQDTPSNLDFDFALPQTATAPDA KTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTT SFLPTPVLEDAKLTQTRKVKKPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAAR RSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1ZIJ A 2 ? 34 ? P03069 249 ? 281 ? 1 33 2 1 1ZIJ B 2 ? 34 ? P03069 249 ? 281 ? 1 33 3 1 1ZIJ C 2 ? 34 ? P03069 249 ? 281 ? 1 33 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1ZIJ ABA A 17 ? UNP P03069 ASN 264 'MODIFIED RESIDUE' 16 1 2 1ZIJ ABA B 17 ? UNP P03069 ASN 264 'MODIFIED RESIDUE' 16 2 3 1ZIJ ABA C 17 ? UNP P03069 ASN 264 'MODIFIED RESIDUE' 16 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ABA 'L-peptide linking' n 'ALPHA-AMINOBUTYRIC ACID' ? 'C4 H9 N O2' 103.120 ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1ZIJ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.86 _exptl_crystal.density_percent_sol 34. _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS' _diffrn_detector.pdbx_collection_date 1994-08 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'SEALED TUBE' _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1ZIJ _reflns.observed_criterion_sigma_I 2. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high ? _reflns.number_obs 5954 _reflns.number_all ? _reflns.percent_possible_obs 85. _reflns.pdbx_Rmerge_I_obs 0.0460000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1ZIJ _refine.ls_number_reflns_obs 5954 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6. _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1840000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 835 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 869 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 6. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? t_angle_deg 1.9 ? ? ? 'X-RAY DIFFRACTION' ? t_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? t_incorr_chiral_ct ? ? ? ? 'X-RAY DIFFRACTION' ? t_pseud_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_trig_c_planes ? ? ? ? 'X-RAY DIFFRACTION' ? t_gen_planes ? ? ? ? 'X-RAY DIFFRACTION' ? t_it ? ? ? ? 'X-RAY DIFFRACTION' ? t_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1ZIJ _struct.title 'GCN4-LEUCINE ZIPPER CORE MUTANT ASN16ABA IN THE TRIMERIC STATE' _struct.pdbx_descriptor 'GENERAL CONTROL PROTEIN GCN4' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZIJ _struct_keywords.pdbx_keywords 'LEUCINE ZIPPER' _struct_keywords.text 'LEUCINE ZIPPER, AMINO-ACID BIOSYNTHESIS, TRANSCRIPTION REGULATION, ACTIVATOR, DNA-BINDING, NUCLEAR PROTEIN, COILED COIL' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 2 ? F N N 2 ? # _struct_biol.id 1 _struct_biol.details ;THERE ARE THREE PEPTIDE CHAINS DENOTED *A*, *B* AND *C* IN THE ASYMMETRIC UNIT. ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 2 ? VAL A 31 ? ARG A 1 VAL A 30 1 ? 30 HELX_P HELX_P2 2 ARG B 2 ? VAL B 31 ? ARG B 1 VAL B 30 1 ? 30 HELX_P HELX_P3 3 ARG C 2 ? VAL C 31 ? ARG C 1 VAL C 30 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ACE 1 C ? ? ? 1_555 A ARG 2 N ? ? A ACE 0 A ARG 1 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale ? ? A ABA 17 N ? ? ? 1_555 A LYS 16 C ? ? A ABA 16 A LYS 15 1_555 ? ? ? ? ? ? ? 1.334 ? covale3 covale ? ? A ABA 17 C ? ? ? 1_555 A TYR 18 N ? ? A ABA 16 A TYR 17 1_555 ? ? ? ? ? ? ? 1.359 ? covale4 covale ? ? B ACE 1 C ? ? ? 1_555 B ARG 2 N ? ? B ACE 0 B ARG 1 1_555 ? ? ? ? ? ? ? 1.335 ? covale5 covale ? ? B ABA 17 N ? ? ? 1_555 B LYS 16 C ? ? B ABA 16 B LYS 15 1_555 ? ? ? ? ? ? ? 1.332 ? covale6 covale ? ? B ABA 17 C ? ? ? 1_555 B TYR 18 N ? ? B ABA 16 B TYR 17 1_555 ? ? ? ? ? ? ? 1.326 ? covale7 covale ? ? C ACE 1 C ? ? ? 1_555 C ARG 2 N ? ? C ACE 0 C ARG 1 1_555 ? ? ? ? ? ? ? 1.330 ? covale8 covale ? ? C ABA 17 N ? ? ? 1_555 C LYS 16 C ? ? C ABA 16 C LYS 15 1_555 ? ? ? ? ? ? ? 1.327 ? covale9 covale ? ? C ABA 17 C ? ? ? 1_555 C TYR 18 N ? ? C ABA 16 C TYR 17 1_555 ? ? ? ? ? ? ? 1.327 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1ZIJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ZIJ _atom_sites.fract_transf_matrix[1][1] 0.026889 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021464 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019406 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 0 0 ACE ACE A . n A 1 2 ARG 2 1 1 ARG ARG A . n A 1 3 MET 3 2 2 MET MET A . n A 1 4 LYS 4 3 3 LYS LYS A . n A 1 5 GLN 5 4 4 GLN GLN A . n A 1 6 LEU 6 5 5 LEU LEU A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 ASP 8 7 7 ASP ASP A . n A 1 9 LYS 9 8 8 LYS LYS A . n A 1 10 VAL 10 9 9 VAL VAL A . n A 1 11 GLU 11 10 10 GLU GLU A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 LEU 14 13 13 LEU LEU A . n A 1 15 SER 15 14 14 SER SER A . n A 1 16 LYS 16 15 15 LYS LYS A . n A 1 17 ABA 17 16 16 ABA ABA A . n A 1 18 TYR 18 17 17 TYR TYR A . n A 1 19 HIS 19 18 18 HIS HIS A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 GLU 21 20 20 GLU GLU A . n A 1 22 ASN 22 21 21 ASN ASN A . n A 1 23 GLU 23 22 22 GLU GLU A . n A 1 24 VAL 24 23 23 VAL VAL A . n A 1 25 ALA 25 24 24 ALA ALA A . n A 1 26 ARG 26 25 25 ARG ARG A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 LYS 28 27 27 LYS LYS A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 LEU 30 29 29 LEU LEU A . n A 1 31 VAL 31 30 30 VAL VAL A . n A 1 32 GLY 32 31 31 GLY GLY A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 ARG 34 33 33 ARG ARG A . n B 1 1 ACE 1 0 0 ACE ACE B . n B 1 2 ARG 2 1 1 ARG ARG B . n B 1 3 MET 3 2 2 MET MET B . n B 1 4 LYS 4 3 3 LYS LYS B . n B 1 5 GLN 5 4 4 GLN GLN B . n B 1 6 LEU 6 5 5 LEU LEU B . n B 1 7 GLU 7 6 6 GLU GLU B . n B 1 8 ASP 8 7 7 ASP ASP B . n B 1 9 LYS 9 8 8 LYS LYS B . n B 1 10 VAL 10 9 9 VAL VAL B . n B 1 11 GLU 11 10 10 GLU GLU B . n B 1 12 GLU 12 11 11 GLU GLU B . n B 1 13 LEU 13 12 12 LEU LEU B . n B 1 14 LEU 14 13 13 LEU LEU B . n B 1 15 SER 15 14 14 SER SER B . n B 1 16 LYS 16 15 15 LYS LYS B . n B 1 17 ABA 17 16 16 ABA ABA B . n B 1 18 TYR 18 17 17 TYR TYR B . n B 1 19 HIS 19 18 18 HIS HIS B . n B 1 20 LEU 20 19 19 LEU LEU B . n B 1 21 GLU 21 20 20 GLU GLU B . n B 1 22 ASN 22 21 21 ASN ASN B . n B 1 23 GLU 23 22 22 GLU GLU B . n B 1 24 VAL 24 23 23 VAL VAL B . n B 1 25 ALA 25 24 24 ALA ALA B . n B 1 26 ARG 26 25 25 ARG ARG B . n B 1 27 LEU 27 26 26 LEU LEU B . n B 1 28 LYS 28 27 27 LYS LYS B . n B 1 29 LYS 29 28 28 LYS LYS B . n B 1 30 LEU 30 29 29 LEU LEU B . n B 1 31 VAL 31 30 30 VAL VAL B . n B 1 32 GLY 32 31 31 GLY GLY B . n B 1 33 GLU 33 32 32 GLU GLU B . n B 1 34 ARG 34 33 33 ARG ARG B . n C 1 1 ACE 1 0 0 ACE ACE C . n C 1 2 ARG 2 1 1 ARG ARG C . n C 1 3 MET 3 2 2 MET MET C . n C 1 4 LYS 4 3 3 LYS LYS C . n C 1 5 GLN 5 4 4 GLN GLN C . n C 1 6 LEU 6 5 5 LEU LEU C . n C 1 7 GLU 7 6 6 GLU GLU C . n C 1 8 ASP 8 7 7 ASP ASP C . n C 1 9 LYS 9 8 8 LYS LYS C . n C 1 10 VAL 10 9 9 VAL VAL C . n C 1 11 GLU 11 10 10 GLU GLU C . n C 1 12 GLU 12 11 11 GLU GLU C . n C 1 13 LEU 13 12 12 LEU LEU C . n C 1 14 LEU 14 13 13 LEU LEU C . n C 1 15 SER 15 14 14 SER SER C . n C 1 16 LYS 16 15 15 LYS LYS C . n C 1 17 ABA 17 16 16 ABA ABA C . n C 1 18 TYR 18 17 17 TYR TYR C . n C 1 19 HIS 19 18 18 HIS HIS C . n C 1 20 LEU 20 19 19 LEU LEU C . n C 1 21 GLU 21 20 20 GLU GLU C . n C 1 22 ASN 22 21 21 ASN ASN C . n C 1 23 GLU 23 22 22 GLU GLU C . n C 1 24 VAL 24 23 23 VAL VAL C . n C 1 25 ALA 25 24 24 ALA ALA C . n C 1 26 ARG 26 25 25 ARG ARG C . n C 1 27 LEU 27 26 26 LEU LEU C . n C 1 28 LYS 28 27 27 LYS LYS C . n C 1 29 LYS 29 28 28 LYS LYS C . n C 1 30 LEU 30 29 29 LEU LEU C . n C 1 31 VAL 31 30 30 VAL VAL C . n C 1 32 GLY 32 31 31 GLY GLY C . n C 1 33 GLU 33 32 32 GLU GLU C . n C 1 34 ARG 34 33 33 ARG ARG C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 HOH 1 58 58 HOH HOH A . D 2 HOH 2 59 59 HOH HOH A . D 2 HOH 3 61 61 HOH HOH A . D 2 HOH 4 62 62 HOH HOH A . D 2 HOH 5 66 66 HOH HOH A . D 2 HOH 6 67 67 HOH HOH A . D 2 HOH 7 73 73 HOH HOH A . D 2 HOH 8 75 75 HOH HOH A . D 2 HOH 9 78 78 HOH HOH A . D 2 HOH 10 79 79 HOH HOH A . D 2 HOH 11 82 82 HOH HOH A . D 2 HOH 12 83 83 HOH HOH A . E 2 HOH 1 52 52 HOH HOH B . E 2 HOH 2 64 64 HOH HOH B . E 2 HOH 3 68 68 HOH HOH B . E 2 HOH 4 69 69 HOH HOH B . E 2 HOH 5 74 74 HOH HOH B . E 2 HOH 6 76 76 HOH HOH B . E 2 HOH 7 77 77 HOH HOH B . E 2 HOH 8 81 81 HOH HOH B . F 2 HOH 1 50 50 HOH HOH C . F 2 HOH 2 51 51 HOH HOH C . F 2 HOH 3 53 53 HOH HOH C . F 2 HOH 4 54 54 HOH HOH C . F 2 HOH 5 55 55 HOH HOH C . F 2 HOH 6 56 56 HOH HOH C . F 2 HOH 7 57 57 HOH HOH C . F 2 HOH 8 60 60 HOH HOH C . F 2 HOH 9 63 63 HOH HOH C . F 2 HOH 10 65 65 HOH HOH C . F 2 HOH 11 70 70 HOH HOH C . F 2 HOH 12 71 71 HOH HOH C . F 2 HOH 13 72 72 HOH HOH C . F 2 HOH 14 80 80 HOH HOH C . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A ABA 17 A ABA 16 ? ALA 'ALPHA-AMINOBUTYRIC ACID' 2 B ABA 17 B ABA 16 ? ALA 'ALPHA-AMINOBUTYRIC ACID' 3 C ABA 17 C ABA 16 ? ALA 'ALPHA-AMINOBUTYRIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4540 ? 1 MORE -39 ? 1 'SSA (A^2)' 6860 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-07-07 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal TNT refinement . ? 1 R-AXIS 'data reduction' . ? 2 R-AXIS 'data scaling' . ? 3 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 6 ? ? OE2 A GLU 6 ? ? 1.325 1.252 0.073 0.011 N 2 1 CD B GLU 11 ? ? OE1 B GLU 11 ? ? 1.318 1.252 0.066 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 7 ? ? CG A ASP 7 ? ? OD1 A ASP 7 ? ? 124.04 118.30 5.74 0.90 N 2 1 CB A ASP 7 ? ? CG A ASP 7 ? ? OD2 A ASP 7 ? ? 112.51 118.30 -5.79 0.90 N 3 1 CB B ASP 7 ? ? CG B ASP 7 ? ? OD1 B ASP 7 ? ? 123.84 118.30 5.54 0.90 N 4 1 CB B ASP 7 ? ? CG B ASP 7 ? ? OD2 B ASP 7 ? ? 112.65 118.30 -5.65 0.90 N 5 1 NE B ARG 33 ? ? CZ B ARG 33 ? ? NH2 B ARG 33 ? ? 117.25 120.30 -3.05 0.50 N 6 1 CB C ASP 7 ? ? CG C ASP 7 ? ? OD1 C ASP 7 ? ? 112.25 118.30 -6.05 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU B 29 ? ? -67.46 25.51 2 1 VAL B 30 ? ? -141.07 -107.58 3 1 GLU B 32 ? ? -38.48 100.86 4 1 GLN C 4 ? ? -69.94 -73.63 5 1 VAL C 30 ? ? -49.94 -83.60 6 1 GLU C 32 ? ? 169.88 -136.79 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 C GLU 32 ? CB ? C GLU 33 CB 2 1 Y 1 C GLU 32 ? CG ? C GLU 33 CG 3 1 Y 1 C GLU 32 ? CD ? C GLU 33 CD 4 1 Y 1 C GLU 32 ? OE1 ? C GLU 33 OE1 5 1 Y 1 C GLU 32 ? OE2 ? C GLU 33 OE2 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #