data_1ZIM # _entry.id 1ZIM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ZIM pdb_00001zim 10.2210/pdb1zim/pdb WWPDB D_1000177486 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZIM _pdbx_database_status.recvd_initial_deposition_date 1996-10-30 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gonzalez Junior, L.' 1 'Woolfson, D.N.' 2 'Alber, T.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Buried polar residues and structural specificity in the GCN4 leucine zipper.' Nat.Struct.Biol. 3 1011 1018 1996 NSBIEW US 1072-8368 2024 ? 8946854 10.1038/nsb1296-1011 1 'An Engineered Allosteric Switch in Leucine-Zipper Oligomerization' Nat.Struct.Biol. 3 510 ? 1996 NSBIEW US 1072-8368 2024 ? ? ? 2 'Crystal Structure of an Isoleucine-Zipper Trimer' Nature 371 80 ? 1994 NATUAS UK 0028-0836 0006 ? ? ? 3 'A Switch between Two-, Three-, and Four-Stranded Coiled Coils in GCN4 Leucine Zipper Mutants' Science 262 1401 ? 1993 SCIEAS US 0036-8075 0038 ? ? ? 4 'X-Ray Structure of the GCN4 Leucine Zipper, a Two-Stranded, Parallel Coiled Coil' Science 254 539 ? 1991 SCIEAS US 0036-8075 0038 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gonzalez Jr., L.' 1 ? primary 'Woolfson, D.N.' 2 ? primary 'Alber, T.' 3 ? 1 'Gonzalez Junior, L.' 4 ? 1 'Plecs, J.J.' 5 ? 1 'Alber, T.' 6 ? 2 'Harbury, P.B.' 7 ? 2 'Kim, P.S.' 8 ? 2 'Alber, T.' 9 ? 3 'Harbury, P.B.' 10 ? 3 'Zhang, T.' 11 ? 3 'Kim, P.S.' 12 ? 3 'Alber, T.' 13 ? 4 ;O'Shea, E.K. ; 14 ? 4 'Klemm, J.D.' 15 ? 4 'Kim, P.S.' 16 ? 4 'Alber, T.' 17 ? # _cell.entry_id 1ZIM _cell.length_a 36.240 _cell.length_b 46.610 _cell.length_c 50.830 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ZIM _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GENERAL CONTROL PROTEIN GCN4' 4045.727 3 ? N16Q ? 'THIS STRUCTURE IS IN THE TRIMERIC STATE' 2 water nat water 18.015 42 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name GCN4 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(ACE)RMKQLEDKVEELLSKQYHLENEVARLKKLVGER' _entity_poly.pdbx_seq_one_letter_code_can XRMKQLEDKVEELLSKQYHLENEVARLKKLVGER _entity_poly.pdbx_strand_id A,B,C _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 ARG n 1 3 MET n 1 4 LYS n 1 5 GLN n 1 6 LEU n 1 7 GLU n 1 8 ASP n 1 9 LYS n 1 10 VAL n 1 11 GLU n 1 12 GLU n 1 13 LEU n 1 14 LEU n 1 15 SER n 1 16 LYS n 1 17 GLN n 1 18 TYR n 1 19 HIS n 1 20 LEU n 1 21 GLU n 1 22 ASN n 1 23 GLU n 1 24 VAL n 1 25 ALA n 1 26 ARG n 1 27 LEU n 1 28 LYS n 1 29 LYS n 1 30 LEU n 1 31 VAL n 1 32 GLY n 1 33 GLU n 1 34 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GCN4_YEAST _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P03069 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSEYQPSLFALNPMGFSPLDGSKSTNENVSASTSTAKPMVGQLIFDKFIKTEEDPIIKQDTPSNLDFDFALPQTATAPDA KTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTT SFLPTPVLEDAKLTQTRKVKKPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAAR RSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1ZIM A 2 ? 34 ? P03069 249 ? 281 ? 1 33 2 1 1ZIM B 2 ? 34 ? P03069 249 ? 281 ? 1 33 3 1 1ZIM C 2 ? 34 ? P03069 249 ? 281 ? 1 33 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1ZIM GLN A 17 ? UNP P03069 ASN 264 'engineered mutation' 16 1 2 1ZIM GLN B 17 ? UNP P03069 ASN 264 'engineered mutation' 16 2 3 1ZIM GLN C 17 ? UNP P03069 ASN 264 'engineered mutation' 16 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1ZIM _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.77 _exptl_crystal.density_percent_sol 31. _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS' _diffrn_detector.pdbx_collection_date 1994-05 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'SEALED TUBE' _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1ZIM _reflns.observed_criterion_sigma_I 2. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high ? _reflns.number_obs 5493 _reflns.number_all ? _reflns.percent_possible_obs 87. _reflns.pdbx_Rmerge_I_obs 0.0770000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.2 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1ZIM _refine.ls_number_reflns_obs 5493 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6. _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1780000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 816 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 858 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 6. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.013 ? ? ? 'X-RAY DIFFRACTION' ? t_angle_deg 2.3 ? ? ? 'X-RAY DIFFRACTION' ? t_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? t_incorr_chiral_ct ? ? ? ? 'X-RAY DIFFRACTION' ? t_pseud_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_trig_c_planes ? ? ? ? 'X-RAY DIFFRACTION' ? t_gen_planes ? ? ? ? 'X-RAY DIFFRACTION' ? t_it ? ? ? ? 'X-RAY DIFFRACTION' ? t_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1ZIM _struct.title 'GCN4-LEUCINE ZIPPER CORE MUTANT ASN16GLN IN THE TRIMERIC STATE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZIM _struct_keywords.pdbx_keywords 'LEUCINE ZIPPER' _struct_keywords.text 'LEUCINE ZIPPER, AMINO-ACID BIOSYNTHESIS, TRANSCRIPTION REGULATION, ACTIVATOR, DNA-BINDING, NUCLEAR PROTEIN, COILED COIL' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 2 ? F N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 2 ? VAL A 31 ? ARG A 1 VAL A 30 1 ? 30 HELX_P HELX_P2 2 ARG B 2 ? VAL B 31 ? ARG B 1 VAL B 30 1 ? 30 HELX_P HELX_P3 3 ARG C 2 ? VAL C 31 ? ARG C 1 VAL C 30 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A ARG 2 N ? ? A ACE 0 A ARG 1 1_555 ? ? ? ? ? ? ? 1.354 ? ? covale2 covale both ? B ACE 1 C ? ? ? 1_555 B ARG 2 N ? ? B ACE 0 B ARG 1 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale3 covale both ? C ACE 1 C ? ? ? 1_555 C ARG 2 N ? ? C ACE 0 C ARG 1 1_555 ? ? ? ? ? ? ? 1.320 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1ZIM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ZIM _atom_sites.fract_transf_matrix[1][1] 0.027594 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021455 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019673 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 0 0 ACE ACE A . n A 1 2 ARG 2 1 1 ARG ARG A . n A 1 3 MET 3 2 2 MET MET A . n A 1 4 LYS 4 3 3 LYS LYS A . n A 1 5 GLN 5 4 4 GLN GLN A . n A 1 6 LEU 6 5 5 LEU LEU A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 ASP 8 7 7 ASP ASP A . n A 1 9 LYS 9 8 8 LYS LYS A . n A 1 10 VAL 10 9 9 VAL VAL A . n A 1 11 GLU 11 10 10 GLU GLU A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 LEU 14 13 13 LEU LEU A . n A 1 15 SER 15 14 14 SER SER A . n A 1 16 LYS 16 15 15 LYS LYS A . n A 1 17 GLN 17 16 16 GLN GLN A . n A 1 18 TYR 18 17 17 TYR TYR A . n A 1 19 HIS 19 18 18 HIS HIS A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 GLU 21 20 20 GLU GLU A . n A 1 22 ASN 22 21 21 ASN ASN A . n A 1 23 GLU 23 22 22 GLU GLU A . n A 1 24 VAL 24 23 23 VAL VAL A . n A 1 25 ALA 25 24 24 ALA ALA A . n A 1 26 ARG 26 25 25 ARG ARG A . n A 1 27 LEU 27 26 26 LEU LEU A . n A 1 28 LYS 28 27 27 LYS LYS A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 LEU 30 29 29 LEU LEU A . n A 1 31 VAL 31 30 30 VAL VAL A . n A 1 32 GLY 32 31 31 GLY GLY A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 ARG 34 33 ? ? ? A . n B 1 1 ACE 1 0 0 ACE ACE B . n B 1 2 ARG 2 1 1 ARG ARG B . n B 1 3 MET 3 2 2 MET MET B . n B 1 4 LYS 4 3 3 LYS LYS B . n B 1 5 GLN 5 4 4 GLN GLN B . n B 1 6 LEU 6 5 5 LEU LEU B . n B 1 7 GLU 7 6 6 GLU GLU B . n B 1 8 ASP 8 7 7 ASP ASP B . n B 1 9 LYS 9 8 8 LYS LYS B . n B 1 10 VAL 10 9 9 VAL VAL B . n B 1 11 GLU 11 10 10 GLU GLU B . n B 1 12 GLU 12 11 11 GLU GLU B . n B 1 13 LEU 13 12 12 LEU LEU B . n B 1 14 LEU 14 13 13 LEU LEU B . n B 1 15 SER 15 14 14 SER SER B . n B 1 16 LYS 16 15 15 LYS LYS B . n B 1 17 GLN 17 16 16 GLN GLN B . n B 1 18 TYR 18 17 17 TYR TYR B . n B 1 19 HIS 19 18 18 HIS HIS B . n B 1 20 LEU 20 19 19 LEU LEU B . n B 1 21 GLU 21 20 20 GLU GLU B . n B 1 22 ASN 22 21 21 ASN ASN B . n B 1 23 GLU 23 22 22 GLU GLU B . n B 1 24 VAL 24 23 23 VAL VAL B . n B 1 25 ALA 25 24 24 ALA ALA B . n B 1 26 ARG 26 25 25 ARG ARG B . n B 1 27 LEU 27 26 26 LEU LEU B . n B 1 28 LYS 28 27 27 LYS LYS B . n B 1 29 LYS 29 28 28 LYS LYS B . n B 1 30 LEU 30 29 29 LEU LEU B . n B 1 31 VAL 31 30 30 VAL VAL B . n B 1 32 GLY 32 31 31 GLY GLY B . n B 1 33 GLU 33 32 32 GLU GLU B . n B 1 34 ARG 34 33 ? ? ? B . n C 1 1 ACE 1 0 0 ACE ACE C . n C 1 2 ARG 2 1 1 ARG ARG C . n C 1 3 MET 3 2 2 MET MET C . n C 1 4 LYS 4 3 3 LYS LYS C . n C 1 5 GLN 5 4 4 GLN GLN C . n C 1 6 LEU 6 5 5 LEU LEU C . n C 1 7 GLU 7 6 6 GLU GLU C . n C 1 8 ASP 8 7 7 ASP ASP C . n C 1 9 LYS 9 8 8 LYS LYS C . n C 1 10 VAL 10 9 9 VAL VAL C . n C 1 11 GLU 11 10 10 GLU GLU C . n C 1 12 GLU 12 11 11 GLU GLU C . n C 1 13 LEU 13 12 12 LEU LEU C . n C 1 14 LEU 14 13 13 LEU LEU C . n C 1 15 SER 15 14 14 SER SER C . n C 1 16 LYS 16 15 15 LYS LYS C . n C 1 17 GLN 17 16 16 GLN GLN C . n C 1 18 TYR 18 17 17 TYR TYR C . n C 1 19 HIS 19 18 18 HIS HIS C . n C 1 20 LEU 20 19 19 LEU LEU C . n C 1 21 GLU 21 20 20 GLU GLU C . n C 1 22 ASN 22 21 21 ASN ASN C . n C 1 23 GLU 23 22 22 GLU GLU C . n C 1 24 VAL 24 23 23 VAL VAL C . n C 1 25 ALA 25 24 24 ALA ALA C . n C 1 26 ARG 26 25 25 ARG ARG C . n C 1 27 LEU 27 26 26 LEU LEU C . n C 1 28 LYS 28 27 27 LYS LYS C . n C 1 29 LYS 29 28 28 LYS LYS C . n C 1 30 LEU 30 29 29 LEU LEU C . n C 1 31 VAL 31 30 30 VAL VAL C . n C 1 32 GLY 32 31 31 GLY GLY C . n C 1 33 GLU 33 32 32 GLU GLU C . n C 1 34 ARG 34 33 ? ? ? C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 2 HOH 1 55 55 HOH HOH A . D 2 HOH 2 58 58 HOH HOH A . D 2 HOH 3 61 61 HOH HOH A . D 2 HOH 4 62 62 HOH HOH A . D 2 HOH 5 64 64 HOH HOH A . D 2 HOH 6 65 65 HOH HOH A . D 2 HOH 7 66 66 HOH HOH A . D 2 HOH 8 69 69 HOH HOH A . D 2 HOH 9 70 70 HOH HOH A . D 2 HOH 10 71 71 HOH HOH A . D 2 HOH 11 73 73 HOH HOH A . D 2 HOH 12 74 74 HOH HOH A . D 2 HOH 13 75 75 HOH HOH A . D 2 HOH 14 76 76 HOH HOH A . D 2 HOH 15 82 82 HOH HOH A . D 2 HOH 16 83 83 HOH HOH A . D 2 HOH 17 88 88 HOH HOH A . D 2 HOH 18 89 89 HOH HOH A . E 2 HOH 1 53 53 HOH HOH B . E 2 HOH 2 54 54 HOH HOH B . E 2 HOH 3 57 57 HOH HOH B . E 2 HOH 4 59 59 HOH HOH B . E 2 HOH 5 63 63 HOH HOH B . E 2 HOH 6 67 67 HOH HOH B . E 2 HOH 7 68 68 HOH HOH B . E 2 HOH 8 72 72 HOH HOH B . E 2 HOH 9 77 77 HOH HOH B . E 2 HOH 10 78 78 HOH HOH B . E 2 HOH 11 80 80 HOH HOH B . E 2 HOH 12 84 84 HOH HOH B . E 2 HOH 13 91 91 HOH HOH B . F 2 HOH 1 50 50 HOH HOH C . F 2 HOH 2 51 51 HOH HOH C . F 2 HOH 3 52 52 HOH HOH C . F 2 HOH 4 56 56 HOH HOH C . F 2 HOH 5 60 60 HOH HOH C . F 2 HOH 6 79 79 HOH HOH C . F 2 HOH 7 81 81 HOH HOH C . F 2 HOH 8 85 85 HOH HOH C . F 2 HOH 9 86 86 HOH HOH C . F 2 HOH 10 87 87 HOH HOH C . F 2 HOH 11 90 90 HOH HOH C . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4420 ? 1 MORE -36 ? 1 'SSA (A^2)' 6640 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-07-07 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal TNT refinement . ? 1 R-AXIS 'data reduction' . ? 2 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NH1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 25 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 32 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_456 _pdbx_validate_symm_contact.dist 2.10 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 6 ? ? OE2 A GLU 6 ? ? 1.330 1.252 0.078 0.011 N 2 1 CD A GLU 32 ? ? OE1 A GLU 32 ? ? 1.322 1.252 0.070 0.011 N 3 1 CD B GLU 20 ? ? OE2 B GLU 20 ? ? 1.330 1.252 0.078 0.011 N 4 1 CD B GLU 32 ? ? OE2 B GLU 32 ? ? 1.323 1.252 0.071 0.011 N 5 1 CD C GLU 6 ? ? OE1 C GLU 6 ? ? 1.319 1.252 0.067 0.011 N 6 1 CD C GLU 10 ? ? OE2 C GLU 10 ? ? 1.326 1.252 0.074 0.011 N 7 1 CD C GLU 11 ? ? OE2 C GLU 11 ? ? 1.320 1.252 0.068 0.011 N 8 1 CD C GLU 32 ? ? OE2 C GLU 32 ? ? 1.318 1.252 0.066 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A ACE 0 ? ? N A ARG 1 ? ? CA A ARG 1 ? ? 154.75 121.70 33.05 2.50 Y 2 1 CB A ASP 7 ? ? CG A ASP 7 ? ? OD1 A ASP 7 ? ? 124.59 118.30 6.29 0.90 N 3 1 CB A ASP 7 ? ? CG A ASP 7 ? ? OD2 A ASP 7 ? ? 111.71 118.30 -6.59 0.90 N 4 1 NE A ARG 25 ? ? CZ A ARG 25 ? ? NH1 A ARG 25 ? ? 124.74 120.30 4.44 0.50 N 5 1 C C ACE 0 ? ? N C ARG 1 ? ? CA C ARG 1 ? ? 105.90 121.70 -15.80 2.50 Y 6 1 NE C ARG 1 ? ? CZ C ARG 1 ? ? NH1 C ARG 1 ? ? 123.74 120.30 3.44 0.50 N 7 1 CB C ASP 7 ? ? CG C ASP 7 ? ? OD1 C ASP 7 ? ? 124.11 118.30 5.81 0.90 N 8 1 CB C ASP 7 ? ? CG C ASP 7 ? ? OD2 C ASP 7 ? ? 111.43 118.30 -6.87 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU B 29 ? ? -52.51 -86.79 2 1 VAL B 30 ? ? -21.65 -73.22 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 33 ? A ARG 34 2 1 Y 1 B ARG 33 ? B ARG 34 3 1 Y 1 C ARG 33 ? C ARG 34 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #