data_1ZNT # _entry.id 1ZNT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1ZNT RCSB RCSB032933 WWPDB D_1000032933 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1MMC _pdbx_database_related.details 'NMR Structure of AcAMP2 (Amaranthus caudatus Antimicrobial Peptide 2) in the free state' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZNT _pdbx_database_status.recvd_initial_deposition_date 2005-05-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chavez, M.I.' 1 'Andreu, C.' 2 'Vidal, P.' 3 'Aboitiz, N.' 4 'Freire, F.' 5 'Groves, P.' 6 'Asensio, J.L.' 7 'Asensio, G.' 8 'Muraki, M.' 9 'Canada, F.J.' 10 'Jimenez-Barbero, J.' 11 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;On the Importance of Carbohydrate-Aromatic Interactions for the Molecular Recognition of Oligosaccharides by Proteins: NMR Studies of the Structure and Binding Affinity of AcAMP2-like Peptides with Non-Natural Naphthyl and Fluoroaromatic Residues ; Chemistry 11 7060 7074 2005 ? GE 0947-6539 ? ? 16220560 10.1002/chem.200500367 1 'H NMR study of the solution structure of Ac-AMP2, a sugar binding antimicrobial protein isolated from Amaranthus caudatus' J.Mol.Biol. 258 322 333 1996 JMOBAK UK 0022-2836 0070 ? 8627629 10.1006/jmbi.1996.0253 2 'The importance of CH/pi interactions to the function of carbohydrate binding proteins' 'Protein Pept.Lett.' 9 195 209 2002 PPELEN NE 0929-8665 2077 ? 12144516 ? 3 ;NMR and modeling studies of protein-carbohydrate interactions: synthesis, three-dimensional structure, and recognition properties of a minimum hevein domain with binding affinity for chitooligosaccharides ; Chembiochem 5 1245 1255 2004 ? GE 1439-4227 ? ? 15368576 10.1002/cbic.200400025 4 ;NMR investigations of protein-carbohydrate interactions: studies on the relevance of Trp/Tyr variations in lectin binding sites as deduced from titration microcalorimetry and NMR studies on hevein domains. Determination of the NMR structure of the complex between pseudohevein and N,N',N"-triacetylchitotriose ; Proteins 40 218 236 2000 PSFGEY US 0887-3585 0867 ? 10842338 '10.1002/(SICI)1097-0134(20000801)40:2<218::AID-PROT50>3.3.CO;2-G' 5 ;Structural basis for chitin recognition by defense proteins: GlcNAc residues are bound in a multivalent fashion by extended binding sites in hevein domains ; Chem.Biol. 7 529 543 2000 CBOLE2 UK 1074-5521 2050 ? 10903932 '10.1016/S1074-5521(00)00136-8' 6 ;Chemically prepared hevein domains: effect of C-terminal truncation and the mutagenesis of aromatic residues on the affinity for chitin ; 'Protein Eng.' 13 385 389 2000 PRENE9 UK 0269-2139 0859 ? 10877847 10.1093/protein/13.6.385 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chavez, M.I.' 1 ? primary 'Andreu, C.' 2 ? primary 'Vidal, P.' 3 ? primary 'Aboitiz, N.' 4 ? primary 'Freire, F.' 5 ? primary 'Groves, P.' 6 ? primary 'Asensio, J.L.' 7 ? primary 'Asensio, G.' 8 ? primary 'Muraki, M.' 9 ? primary 'Canada, F.J.' 10 ? primary 'Jimenez-Barbero, J.' 11 ? 1 'Martins, J.C.' 12 ? 1 'Maes, D.' 13 ? 1 'Loris, R.' 14 ? 1 'Pepermans, H.A.M.' 15 ? 1 'Wyns, L.' 16 ? 1 'Willem, R.' 17 ? 1 'Verheyden, P.' 18 ? 2 'Muraki, M.' 19 ? 3 'Aboitiz, N.' 20 ? 3 'Vila-Perello, M.' 21 ? 3 'Groves, P.' 22 ? 3 'Asensio, J.L.' 23 ? 3 'Andreu, D.' 24 ? 3 'Canada, F.J.' 25 ? 3 'Jimenez-Barbero, J.' 26 ? 4 'Asensio, J.L.' 27 ? 4 'Siebert, H.C.' 28 ? 4 'von Der Lieth, C.W.' 29 ? 4 'Laynez, J.' 30 ? 4 'Bruix, M.' 31 ? 4 'Soedjanaamadja, U.M.' 32 ? 4 'Beintema, J.J.' 33 ? 4 'Canada, F.J.' 34 ? 4 'Gabius, H.J.' 35 ? 4 'Jimenez-Barbero, J.' 36 ? 5 'Asensio, J.L.' 37 ? 5 'Canada, F.J.' 38 ? 5 'Siebert, H.C.' 39 ? 5 'Laynez, J.' 40 ? 5 'Poveda, A.' 41 ? 5 'Nieto, P.M.' 42 ? 5 'Soedjanaamadja, U.M.' 43 ? 5 'Gabius, H.J.' 44 ? 5 'Jimenez-Barbero, J.' 45 ? 6 'Muraki, M.' 46 ? 6 'Morii, H.' 47 ? 6 'Harata, K.' 48 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'AMARANTHUS CAUDATUS ANTIMICROBIAL PEPTIDE 2' 3212.771 1 ? 'Phe18PFF, Tyr20PFF' ? ? 2 branched man ;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; 627.594 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 ACMP2 2 triacetyl-beta-chitotriose # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'VGECVRGRCPSGMCCSQ(PFF)G(PFF)CGKGPKYCGR(NH2)' _entity_poly.pdbx_seq_one_letter_code_can VGECVRGRCPSGMCCSQFGFCGKGPKYCGRX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 GLY n 1 3 GLU n 1 4 CYS n 1 5 VAL n 1 6 ARG n 1 7 GLY n 1 8 ARG n 1 9 CYS n 1 10 PRO n 1 11 SER n 1 12 GLY n 1 13 MET n 1 14 CYS n 1 15 CYS n 1 16 SER n 1 17 GLN n 1 18 PFF n 1 19 GLY n 1 20 PFF n 1 21 CYS n 1 22 GLY n 1 23 LYS n 1 24 GLY n 1 25 PRO n 1 26 LYS n 1 27 TYR n 1 28 CYS n 1 29 GLY n 1 30 ARG n 1 31 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;The peptide was chemically synthesized. The sequence of the peptide is naturally found in AMARANTHUS CAUDATUS (INCA-WHEAT). SEQUENCE PREPARED BY STANDARD SOLID PHASE PEPTIDE SYNTHESIS PROTOCOLS USING FMOC CHEMISTRY. Phe18 and Tyr20 have been mutated to the non proteinogenic aminoacid 4-fluorophenyalanine. ; # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name PDB _struct_ref.db_code 1ZNT _struct_ref.pdbx_db_accession 1ZNT _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ZNT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 1ZNT _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 31 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 31 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PFF 'L-peptide linking' n 4-FLUORO-L-PHENYLALANINE ? 'C9 H10 F N O2' 183.180 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D TOCSY' 1 2 1 '2D NOESY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM AcAMP2F18Pff/Y20Pff, 12mM chitotriose, 20mM Phosphate buffer; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1ZNT _pdbx_nmr_refine.method ;The structures are based on a total 314 cross peaks, 248 NOE-derived distance restraints, and finally 208 distance constraints and 18 come from cys-cys disulfide were used in the final round of calculation ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1ZNT _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques which are NOESY at tm=300 and TOCSY at tm=50 and 70 ms' # _pdbx_nmr_ensemble.entry_id 1ZNT _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 18 _pdbx_nmr_ensemble.conformer_selection_criteria 'Fewest restraint violation, secondary lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1ZNT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.2 Bruker 1 'data analysis' XEASY 1.3.13 Wuthrich 2 'structure solution' DYANA 1.5 Guentert 3 refinement Amber 5.0 Kollman 4 # _exptl.entry_id 1ZNT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ZNT _struct.title ;18 NMR structures of AcAMP2-Like Peptide with non Natural Fluoroaromatic Residue (AcAMP2F18Pff/Y20Pff) complex with N,N,N-triacetylchitotriose ; _struct.pdbx_descriptor 'Antimicrobial peptide 2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZNT _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'alfa-helix, anti-parallel beta-sheet, ANTIMICROBIAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 24 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 29 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 24 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 29 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 15 SG ? ? A CYS 4 A CYS 15 1_555 ? ? ? ? ? ? ? 2.037 ? ? disulf2 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 9 A CYS 21 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf3 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 14 A CYS 28 1_555 ? ? ? ? ? ? ? 2.035 ? ? covale1 covale both ? A GLN 17 C ? ? ? 1_555 A PFF 18 N ? ? A GLN 17 A PFF 18 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale2 covale both ? A PFF 18 C ? ? ? 1_555 A GLY 19 N ? ? A PFF 18 A GLY 19 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale3 covale both ? A GLY 19 C ? ? ? 1_555 A PFF 20 N ? ? A GLY 19 A PFF 20 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? A PFF 20 C ? ? ? 1_555 A CYS 21 N ? ? A PFF 20 A CYS 21 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale5 covale both ? A ARG 30 C ? ? ? 1_555 A NH2 31 N ? ? A ARG 30 A NH2 31 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale6 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.394 ? ? covale7 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 2 B NAG 3 1_555 ? ? ? ? ? ? ? 1.396 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 14 ? CYS A 15 ? CYS A 14 CYS A 15 A 2 CYS A 21 ? GLY A 22 ? CYS A 21 GLY A 22 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 14 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 14 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLY _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 22 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 22 # _database_PDB_matrix.entry_id 1ZNT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ZNT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 PFF 18 18 18 PFF PFF A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 PFF 20 20 20 PFF PFF A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 NH2 31 31 31 NH2 NH2 A . n # _pdbx_molecule_features.prd_id PRD_900017 _pdbx_molecule_features.name triacetyl-beta-chitotriose _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Inhibitor _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900017 _pdbx_molecule.asym_id B # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A PFF 18 A PFF 18 ? PHE 4-FLUORO-L-PHENYLALANINE 2 A PFF 20 A PFF 20 ? PHE 4-FLUORO-L-PHENYLALANINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-12-06 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Atomic model' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp 3 4 'Structure model' entity 4 4 'Structure model' entity_name_com 5 4 'Structure model' pdbx_branch_scheme 6 4 'Structure model' pdbx_chem_comp_identifier 7 4 'Structure model' pdbx_entity_branch 8 4 'Structure model' pdbx_entity_branch_descriptor 9 4 'Structure model' pdbx_entity_branch_link 10 4 'Structure model' pdbx_entity_branch_list 11 4 'Structure model' pdbx_entity_nonpoly 12 4 'Structure model' pdbx_molecule_features 13 4 'Structure model' pdbx_nmr_software 14 4 'Structure model' pdbx_nmr_spectrometer 15 4 'Structure model' pdbx_nonpoly_scheme 16 4 'Structure model' pdbx_struct_assembly_gen 17 4 'Structure model' pdbx_validate_close_contact 18 4 'Structure model' struct_asym 19 4 'Structure model' struct_conn 20 4 'Structure model' struct_site 21 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.auth_asym_id' 2 4 'Structure model' '_atom_site.auth_seq_id' 3 4 'Structure model' '_atom_site.label_asym_id' 4 4 'Structure model' '_chem_comp.name' 5 4 'Structure model' '_chem_comp.type' 6 4 'Structure model' '_entity.formula_weight' 7 4 'Structure model' '_entity.pdbx_description' 8 4 'Structure model' '_entity.pdbx_number_of_molecules' 9 4 'Structure model' '_entity.type' 10 4 'Structure model' '_pdbx_nmr_software.name' 11 4 'Structure model' '_pdbx_nmr_spectrometer.model' 12 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 13 4 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 14 4 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 17 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 6 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 3 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HO4 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 NAG _pdbx_validate_close_contact.auth_seq_id_2 3 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.60 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 123.33 120.30 3.03 0.50 N 2 2 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 123.88 120.30 3.58 0.50 N 3 5 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.65 120.30 3.35 0.50 N 4 5 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 123.50 120.30 3.20 0.50 N 5 5 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 124.54 120.30 4.24 0.50 N 6 7 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 124.11 120.30 3.81 0.50 N 7 8 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 125.51 120.30 5.21 0.50 N 8 8 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 123.94 120.30 3.64 0.50 N 9 8 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 123.42 120.30 3.12 0.50 N 10 9 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 123.79 120.30 3.49 0.50 N 11 10 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 124.27 120.30 3.97 0.50 N 12 11 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 123.72 120.30 3.42 0.50 N 13 11 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 125.00 120.30 4.70 0.50 N 14 13 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 123.77 120.30 3.47 0.50 N 15 14 NE A ARG 6 ? ? CZ A ARG 6 ? ? NH1 A ARG 6 ? ? 123.33 120.30 3.03 0.50 N 16 15 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 123.65 120.30 3.35 0.50 N 17 17 NE A ARG 8 ? ? CZ A ARG 8 ? ? NH1 A ARG 8 ? ? 123.71 120.30 3.41 0.50 N 18 17 NE A ARG 30 ? ? CZ A ARG 30 ? ? NH1 A ARG 30 ? ? 124.13 120.30 3.83 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 10 ? ? -53.25 177.05 2 1 SER A 11 ? ? -69.69 82.44 3 1 PRO A 25 ? ? -33.13 -72.39 4 2 SER A 11 ? ? -2.66 73.46 5 3 PRO A 25 ? ? -45.95 -72.76 6 4 GLU A 3 ? ? -44.22 154.15 7 4 PRO A 10 ? ? -57.66 -175.88 8 4 SER A 11 ? ? -28.98 94.98 9 4 PRO A 25 ? ? -42.74 -78.77 10 5 SER A 11 ? ? -68.15 78.25 11 5 GLN A 17 ? ? -64.05 0.07 12 6 GLU A 3 ? ? -45.10 99.63 13 6 VAL A 5 ? ? -77.88 49.62 14 6 SER A 11 ? ? 35.86 39.50 15 7 SER A 11 ? ? 36.44 43.19 16 7 SER A 16 ? ? -67.06 -175.85 17 7 CYS A 28 ? ? -105.79 -79.15 18 8 VAL A 5 ? ? -75.79 48.83 19 8 ARG A 6 ? ? 34.69 38.14 20 8 SER A 11 ? ? -28.96 102.99 21 9 PRO A 10 ? ? -54.72 -175.79 22 9 SER A 11 ? ? -30.10 94.62 23 9 GLN A 17 ? ? -57.08 -9.78 24 9 PFF A 20 ? ? -46.32 156.87 25 10 CYS A 9 ? ? 166.82 -179.23 26 10 PRO A 10 ? ? -54.96 -179.58 27 10 SER A 11 ? ? -26.76 99.18 28 11 CYS A 9 ? ? -179.34 -174.36 29 11 PRO A 10 ? ? -52.44 -179.57 30 11 SER A 11 ? ? -37.20 106.28 31 11 GLN A 17 ? ? -59.90 -1.24 32 11 TYR A 27 ? ? -94.32 -61.15 33 12 GLU A 3 ? ? 60.73 164.81 34 12 CYS A 4 ? ? -49.18 175.42 35 12 PRO A 10 ? ? -57.22 -179.79 36 12 SER A 11 ? ? -12.73 89.29 37 13 SER A 11 ? ? 57.38 -172.59 38 13 LYS A 23 ? ? -102.58 60.18 39 14 GLU A 3 ? ? 38.86 169.64 40 14 CYS A 4 ? ? -41.54 174.13 41 14 SER A 11 ? ? 53.88 -168.46 42 14 TYR A 27 ? ? -97.94 -62.12 43 15 PRO A 10 ? ? -53.02 177.63 44 16 PRO A 10 ? ? -48.86 178.90 45 17 CYS A 4 ? ? -57.42 173.04 46 17 VAL A 5 ? ? -81.95 48.21 47 17 SER A 11 ? ? 52.10 -170.41 48 18 SER A 11 ? ? 57.74 -174.46 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 9 GLY A 2 ? ? GLU A 3 ? ? 139.38 2 9 GLY A 29 ? ? ARG A 30 ? ? -145.58 3 15 GLY A 2 ? ? GLU A 3 ? ? 139.31 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 ARG A 6 ? ? 0.121 'SIDE CHAIN' 2 2 ARG A 8 ? ? 0.121 'SIDE CHAIN' 3 2 ARG A 30 ? ? 0.097 'SIDE CHAIN' 4 3 ARG A 6 ? ? 0.158 'SIDE CHAIN' 5 3 ARG A 30 ? ? 0.128 'SIDE CHAIN' 6 4 ARG A 30 ? ? 0.186 'SIDE CHAIN' 7 6 ARG A 8 ? ? 0.114 'SIDE CHAIN' 8 6 ARG A 30 ? ? 0.115 'SIDE CHAIN' 9 8 ARG A 6 ? ? 0.138 'SIDE CHAIN' 10 9 TYR A 27 ? ? 0.072 'SIDE CHAIN' 11 9 ARG A 30 ? ? 0.086 'SIDE CHAIN' 12 10 ARG A 8 ? ? 0.110 'SIDE CHAIN' 13 10 ARG A 30 ? ? 0.121 'SIDE CHAIN' 14 11 ARG A 6 ? ? 0.137 'SIDE CHAIN' 15 11 ARG A 30 ? ? 0.090 'SIDE CHAIN' 16 12 ARG A 30 ? ? 0.114 'SIDE CHAIN' 17 13 TYR A 27 ? ? 0.078 'SIDE CHAIN' 18 16 TYR A 27 ? ? 0.075 'SIDE CHAIN' 19 17 ARG A 30 ? ? 0.123 'SIDE CHAIN' # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 B NAG 32 n B 2 NAG 2 B NAG 2 B NAG 33 n B 2 NAG 3 B NAG 3 B NAG 34 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpNAcb1-4DGlcpNAcb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,3,2/[a2122h-1b_1-5_2*NCC/3=O]/1-1-1/a4-b1_b4-c1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 2 2 3 NAG C1 O1 2 NAG O4 HO4 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n 2 NAG 3 n #