data_1ZP5 # _entry.id 1ZP5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1ZP5 RCSB RCSB032978 WWPDB D_1000032978 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZP5 _pdbx_database_status.recvd_initial_deposition_date 2005-05-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Campestre, C.' 1 'Agamennone, M.' 2 'Tortorella, P.' 3 'Preziuso, S.' 4 'Biasone, A.' 5 'Gavuzzo, E.' 6 'Pochetti, G.' 7 'Mazza, F.' 8 'Tschesche, H.' 9 'Gallina, C.' 10 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'N-Hydroxyurea as zinc binding group in matrix metalloproteinase inhibition: Mode of binding in a complex with MMP-8.' Bioorg.Med.Chem.Lett. 16 20 24 2006 BMCLE8 UK 0960-894X 1127 ? 16242329 10.1016/j.bmcl.2005.09.057 1 'Hydroxamic acids as pharmacological agents.' Curr.Med.Chem. 9 1631 1653 2002 ? NE 0929-8673 ? ? 12171558 ? 2 'Structure determination and analysis of human neutrophil collagenase complexed with a hydroxamate inhibitor.' Biochemistry 34 14012 14020 1995 BICHAW US 0006-2960 0033 ? 7577999 10.1021/bi00043a007 3 'Discovery of potent non peptide inhibitors of stromelysin using SAR by NMR.' J.Am.Chem.Soc. 119 5818 5827 1997 JACSAT US 0002-7863 0004 ? ? 10.1021/ja9702778 4 'Biaryl ether retrohydroxamates as potent, long-lived, orally bioavailable MMP inhibitors.' Bioorg.Med.Chem.Lett. 11 1553 1556 2001 BMCLE8 UK 0960-894X 1127 ? 11412979 '10.1016/S0960-894X(01)00031-2' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Campestre, C.' 1 primary 'Agamennone, M.' 2 primary 'Tortorella, P.' 3 primary 'Preziuso, S.' 4 primary 'Biasone, A.' 5 primary 'Gavuzzo, E.' 6 primary 'Pochetti, G.' 7 primary 'Mazza, F.' 8 primary 'Hiller, O.' 9 primary 'Tschesche, H.' 10 primary 'Consalvi, V.' 11 primary 'Gallina, C.' 12 1 'Muri, E.M.' 13 1 'Nieto, M.J.' 14 1 'Sindelar, R.D.' 15 1 'Williamson, J.S.' 16 2 'Grams, F.' 17 2 'Crimmin, M.' 18 2 'Hinnes, L.' 19 2 'Huxley, P.' 20 2 'Pieper, M.' 21 2 'Tschesche, H.' 22 2 'Bode, W.' 23 3 'Hajduck, P.J.' 24 3 'Sheppard, G.' 25 3 'Nettesheim, D.G.' 26 3 'Olejniczak, E.T.' 27 3 'Shuker, S.B.' 28 3 'Meadows, R.P.' 29 3 'Steinman, D.H.' 30 3 'Carrera, G.M.' 31 3 'Marcotte, P.A.' 32 3 'Severin, J.' 33 3 'Walter, K.' 34 3 'Smith, H.' 35 3 'Gubbins, E.' 36 3 'Simmer, R.' 37 3 'Holzman, T.F.' 38 3 'Morgan, D.W.' 39 3 'Davidsen, S.K.' 40 3 'Summers, J.B.' 41 3 'Fesik, S.W.' 42 4 'Michaelides, M.R.' 43 4 'Dellaria, J.F.' 44 4 'Gong, J.' 45 4 'Holms, J.H.' 46 4 'Bouska, J.J.' 47 4 'Stacey, J.' 48 4 'Wada, C.K.' 49 4 'Heyman, H.R.' 50 4 'Curtin, M.L.' 51 4 'Guo, Y.' 52 4 'Goodfellow, C.L.' 53 4 'Elmore, I.B.' 54 4 'Albert, D.H.' 55 4 'Magoc, T.J.' 56 4 'Marcotte, P.A.' 57 4 'Morgan, D.W.' 58 4 'Davidsen, S.K.' 59 # _cell.entry_id 1ZP5 _cell.length_a 32.387 _cell.length_b 52.675 _cell.length_c 67.331 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ZP5 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Neutrophil collagenase' 18111.744 1 3.4.24.34 ? 'Catalytic domain (80-242)' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 4 non-polymer syn "N-{2-[(4'-CYANO-1,1'-BIPHENYL-4-YL)OXY]ETHYL}-N'-HYDROXY-N-METHYLUREA" 311.335 1 ? ? ? ? 5 water nat water 18.015 125 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Matrix metalloproteinase-8, MMP-8, PMNL collagenase, PMNL-CL' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGI LAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQA IYG ; _entity_poly.pdbx_seq_one_letter_code_can ;MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGI LAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQA IYG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 THR n 1 4 PRO n 1 5 GLY n 1 6 ASN n 1 7 PRO n 1 8 LYS n 1 9 TRP n 1 10 GLU n 1 11 ARG n 1 12 THR n 1 13 ASN n 1 14 LEU n 1 15 THR n 1 16 TYR n 1 17 ARG n 1 18 ILE n 1 19 ARG n 1 20 ASN n 1 21 TYR n 1 22 THR n 1 23 PRO n 1 24 GLN n 1 25 LEU n 1 26 SER n 1 27 GLU n 1 28 ALA n 1 29 GLU n 1 30 VAL n 1 31 GLU n 1 32 ARG n 1 33 ALA n 1 34 ILE n 1 35 LYS n 1 36 ASP n 1 37 ALA n 1 38 PHE n 1 39 GLU n 1 40 LEU n 1 41 TRP n 1 42 SER n 1 43 VAL n 1 44 ALA n 1 45 SER n 1 46 PRO n 1 47 LEU n 1 48 ILE n 1 49 PHE n 1 50 THR n 1 51 ARG n 1 52 ILE n 1 53 SER n 1 54 GLN n 1 55 GLY n 1 56 GLU n 1 57 ALA n 1 58 ASP n 1 59 ILE n 1 60 ASN n 1 61 ILE n 1 62 ALA n 1 63 PHE n 1 64 TYR n 1 65 GLN n 1 66 ARG n 1 67 ASP n 1 68 HIS n 1 69 GLY n 1 70 ASP n 1 71 ASN n 1 72 SER n 1 73 PRO n 1 74 PHE n 1 75 ASP n 1 76 GLY n 1 77 PRO n 1 78 ASN n 1 79 GLY n 1 80 ILE n 1 81 LEU n 1 82 ALA n 1 83 HIS n 1 84 ALA n 1 85 PHE n 1 86 GLN n 1 87 PRO n 1 88 GLY n 1 89 GLN n 1 90 GLY n 1 91 ILE n 1 92 GLY n 1 93 GLY n 1 94 ASP n 1 95 ALA n 1 96 HIS n 1 97 PHE n 1 98 ASP n 1 99 ALA n 1 100 GLU n 1 101 GLU n 1 102 THR n 1 103 TRP n 1 104 THR n 1 105 ASN n 1 106 THR n 1 107 SER n 1 108 ALA n 1 109 ASN n 1 110 TYR n 1 111 ASN n 1 112 LEU n 1 113 PHE n 1 114 LEU n 1 115 VAL n 1 116 ALA n 1 117 ALA n 1 118 HIS n 1 119 GLU n 1 120 PHE n 1 121 GLY n 1 122 HIS n 1 123 SER n 1 124 LEU n 1 125 GLY n 1 126 LEU n 1 127 ALA n 1 128 HIS n 1 129 SER n 1 130 SER n 1 131 ASP n 1 132 PRO n 1 133 GLY n 1 134 ALA n 1 135 LEU n 1 136 MET n 1 137 TYR n 1 138 PRO n 1 139 ASN n 1 140 TYR n 1 141 ALA n 1 142 PHE n 1 143 ARG n 1 144 GLU n 1 145 THR n 1 146 SER n 1 147 ASN n 1 148 TYR n 1 149 SER n 1 150 LEU n 1 151 PRO n 1 152 GLN n 1 153 ASP n 1 154 ASP n 1 155 ILE n 1 156 ASP n 1 157 GLY n 1 158 ILE n 1 159 GLN n 1 160 ALA n 1 161 ILE n 1 162 TYR n 1 163 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'MMP8, CLG1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pSVB30 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MMP8_HUMAN _struct_ref.pdbx_db_accession P22894 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGI LAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQA IYG ; _struct_ref.pdbx_align_begin 100 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ZP5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 163 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P22894 _struct_ref_seq.db_align_beg 100 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 262 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 80 _struct_ref_seq.pdbx_auth_seq_align_end 242 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2NI non-polymer . "N-{2-[(4'-CYANO-1,1'-BIPHENYL-4-YL)OXY]ETHYL}-N'-HYDROXY-N-METHYLUREA" ? 'C17 H17 N3 O3' 311.335 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 1ZP5 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.57 _exptl_crystal.density_percent_sol 20.83 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_details 'PEG6000, MES/NAOH, Na Phosphate, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2004-05-18 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator graphite _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ELETTRA BEAMLINE 5.2R' _diffrn_source.pdbx_synchrotron_site ELETTRA _diffrn_source.pdbx_synchrotron_beamline 5.2R _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.00 # _reflns.entry_id 1ZP5 _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I 0.0 _reflns.d_resolution_high 1.80 _reflns.d_resolution_low 30.00 _reflns.number_all 10932 _reflns.number_obs 10932 _reflns.percent_possible_obs 97.8 _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 19.8 _reflns.B_iso_Wilson_estimate 18.2 _reflns.pdbx_redundancy 6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.86 _reflns_shell.percent_possible_all 95.6 _reflns_shell.Rmerge_I_obs 0.372 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.48 _reflns_shell.pdbx_redundancy 5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1ZP5 _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 10.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 9738 _refine.ls_number_reflns_obs 9738 _refine.ls_number_reflns_R_free 974 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_all 0.219 _refine.ls_R_factor_obs 0.219 _refine.ls_R_factor_R_work 0.216 _refine.ls_R_factor_R_free 0.251 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB ENTRY 1I76' _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1283 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 125 _refine_hist.number_atoms_total 1435 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 10.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1ZP5 _struct.title 'Crystal structure of the complex between MMP-8 and a N-hydroxyurea inhibitor' _struct.pdbx_descriptor 'Neutrophil collagenase (E.C.3.4.24.34)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZP5 _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text hydrolase # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 26 ? VAL A 43 ? SER A 105 VAL A 122 1 ? 18 HELX_P HELX_P2 2 ASN A 111 ? LEU A 124 ? ASN A 190 LEU A 203 1 ? 14 HELX_P HELX_P3 3 PRO A 151 ? GLY A 163 ? PRO A 230 GLY A 242 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 58 O ? ? A CA 996 A ASP 137 1_555 ? ? ? ? ? ? ? 2.532 ? metalc2 metalc ? ? B CA . CA ? ? ? 1_555 A GLY 92 O ? ? A CA 996 A GLY 171 1_555 ? ? ? ? ? ? ? 2.537 ? metalc3 metalc ? ? B CA . CA ? ? ? 1_555 A GLY 90 O ? ? A CA 996 A GLY 169 1_555 ? ? ? ? ? ? ? 2.652 ? metalc4 metalc ? ? B CA . CA ? ? ? 1_555 A ASP 94 OD1 ? ? A CA 996 A ASP 173 1_555 ? ? ? ? ? ? ? 2.548 ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 996 A HOH 1093 1_555 ? ? ? ? ? ? ? 3.205 ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 996 A HOH 1098 1_555 ? ? ? ? ? ? ? 2.668 ? metalc7 metalc ? ? C CA . CA ? ? ? 1_555 A ILE 80 O ? ? A CA 997 A ILE 159 1_555 ? ? ? ? ? ? ? 2.448 ? metalc8 metalc ? ? C CA . CA ? ? ? 1_555 A ASP 75 OD1 ? ? A CA 997 A ASP 154 1_555 ? ? ? ? ? ? ? 2.469 ? metalc9 metalc ? ? C CA . CA ? ? ? 1_555 A GLY 76 O ? ? A CA 997 A GLY 155 1_555 ? ? ? ? ? ? ? 2.430 ? metalc10 metalc ? ? C CA . CA ? ? ? 1_555 A ASN 78 O ? ? A CA 997 A ASN 157 1_555 ? ? ? ? ? ? ? 2.403 ? metalc11 metalc ? ? C CA . CA ? ? ? 1_555 A ASP 98 OD2 ? ? A CA 997 A ASP 177 1_555 ? ? ? ? ? ? ? 2.427 ? metalc12 metalc ? ? C CA . CA ? ? ? 1_555 A GLU 101 OE2 ? ? A CA 997 A GLU 180 1_555 ? ? ? ? ? ? ? 2.432 ? metalc13 metalc ? ? D ZN . ZN ? ? ? 1_555 A HIS 83 NE2 ? ? A ZN 998 A HIS 162 1_555 ? ? ? ? ? ? ? 2.048 ? metalc14 metalc ? ? D ZN . ZN ? ? ? 1_555 A ASP 70 OD2 ? ? A ZN 998 A ASP 149 1_555 ? ? ? ? ? ? ? 1.983 ? metalc15 metalc ? ? D ZN . ZN ? ? ? 1_555 A HIS 96 ND1 ? ? A ZN 998 A HIS 175 1_555 ? ? ? ? ? ? ? 2.070 ? metalc16 metalc ? ? D ZN . ZN ? ? ? 1_555 A HIS 68 NE2 ? ? A ZN 998 A HIS 147 1_555 ? ? ? ? ? ? ? 2.081 ? metalc17 metalc ? ? E ZN . ZN ? ? ? 1_555 A HIS 118 NE2 ? ? A ZN 999 A HIS 197 1_555 ? ? ? ? ? ? ? 2.081 ? metalc18 metalc ? ? E ZN . ZN ? ? ? 1_555 F 2NI . O3 ? ? A ZN 999 A 2NI 1000 1_555 ? ? ? ? ? ? ? 2.263 ? metalc19 metalc ? ? E ZN . ZN ? ? ? 1_555 A HIS 122 NE2 ? ? A ZN 999 A HIS 201 1_555 ? ? ? ? ? ? ? 2.060 ? metalc20 metalc ? ? E ZN . ZN ? ? ? 1_555 A HIS 128 NE2 ? ? A ZN 999 A HIS 207 1_555 ? ? ? ? ? ? ? 2.106 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 109 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 188 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 TYR _struct_mon_prot_cis.pdbx_label_seq_id_2 110 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 TYR _struct_mon_prot_cis.pdbx_auth_seq_id_2 189 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.35 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 48 ? ARG A 51 ? ILE A 127 ARG A 130 A 2 ASN A 13 ? ILE A 18 ? ASN A 92 ILE A 97 A 3 ILE A 59 ? TYR A 64 ? ILE A 138 TYR A 143 A 4 ALA A 95 ? ASP A 98 ? ALA A 174 ASP A 177 A 5 ALA A 82 ? ALA A 84 ? ALA A 161 ALA A 163 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 50 ? O THR A 129 N LEU A 14 ? N LEU A 93 A 2 3 N ARG A 17 ? N ARG A 96 O ILE A 61 ? O ILE A 140 A 3 4 N ALA A 62 ? N ALA A 141 O PHE A 97 ? O PHE A 176 A 4 5 O HIS A 96 ? O HIS A 175 N HIS A 83 ? N HIS A 162 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 996' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 997' AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 998' AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 999' AC5 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE 2NI A 1000' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 58 ? ASP A 137 . ? 1_555 ? 2 AC1 5 GLY A 90 ? GLY A 169 . ? 1_555 ? 3 AC1 5 GLY A 92 ? GLY A 171 . ? 1_555 ? 4 AC1 5 ASP A 94 ? ASP A 173 . ? 1_555 ? 5 AC1 5 HOH G . ? HOH A 1098 . ? 1_555 ? 6 AC2 6 ASP A 75 ? ASP A 154 . ? 1_555 ? 7 AC2 6 GLY A 76 ? GLY A 155 . ? 1_555 ? 8 AC2 6 ASN A 78 ? ASN A 157 . ? 1_555 ? 9 AC2 6 ILE A 80 ? ILE A 159 . ? 1_555 ? 10 AC2 6 ASP A 98 ? ASP A 177 . ? 1_555 ? 11 AC2 6 GLU A 101 ? GLU A 180 . ? 1_555 ? 12 AC3 4 HIS A 68 ? HIS A 147 . ? 1_555 ? 13 AC3 4 ASP A 70 ? ASP A 149 . ? 1_555 ? 14 AC3 4 HIS A 83 ? HIS A 162 . ? 1_555 ? 15 AC3 4 HIS A 96 ? HIS A 175 . ? 1_555 ? 16 AC4 4 HIS A 118 ? HIS A 197 . ? 1_555 ? 17 AC4 4 HIS A 122 ? HIS A 201 . ? 1_555 ? 18 AC4 4 HIS A 128 ? HIS A 207 . ? 1_555 ? 19 AC4 4 2NI F . ? 2NI A 1000 . ? 1_555 ? 20 AC5 16 ILE A 80 ? ILE A 159 . ? 1_555 ? 21 AC5 16 LEU A 81 ? LEU A 160 . ? 1_555 ? 22 AC5 16 ALA A 82 ? ALA A 161 . ? 1_555 ? 23 AC5 16 LEU A 114 ? LEU A 193 . ? 1_555 ? 24 AC5 16 HIS A 118 ? HIS A 197 . ? 1_555 ? 25 AC5 16 GLU A 119 ? GLU A 198 . ? 1_555 ? 26 AC5 16 HIS A 128 ? HIS A 207 . ? 1_555 ? 27 AC5 16 LEU A 135 ? LEU A 214 . ? 1_555 ? 28 AC5 16 TYR A 137 ? TYR A 216 . ? 1_555 ? 29 AC5 16 PRO A 138 ? PRO A 217 . ? 1_555 ? 30 AC5 16 ASN A 139 ? ASN A 218 . ? 1_555 ? 31 AC5 16 TYR A 140 ? TYR A 219 . ? 1_555 ? 32 AC5 16 ALA A 141 ? ALA A 220 . ? 1_555 ? 33 AC5 16 ZN E . ? ZN A 999 . ? 1_555 ? 34 AC5 16 HOH G . ? HOH A 1069 . ? 1_555 ? 35 AC5 16 HOH G . ? HOH A 1105 . ? 1_555 ? # _database_PDB_matrix.entry_id 1ZP5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ZP5 _atom_sites.fract_transf_matrix[1][1] 0.030877 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018984 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014852 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 80 80 MET MET A . n A 1 2 LEU 2 81 81 LEU LEU A . n A 1 3 THR 3 82 82 THR THR A . n A 1 4 PRO 4 83 83 PRO PRO A . n A 1 5 GLY 5 84 84 GLY GLY A . n A 1 6 ASN 6 85 85 ASN ASN A . n A 1 7 PRO 7 86 86 PRO PRO A . n A 1 8 LYS 8 87 87 LYS LYS A . n A 1 9 TRP 9 88 88 TRP TRP A . n A 1 10 GLU 10 89 89 GLU GLU A . n A 1 11 ARG 11 90 90 ARG ARG A . n A 1 12 THR 12 91 91 THR THR A . n A 1 13 ASN 13 92 92 ASN ASN A . n A 1 14 LEU 14 93 93 LEU LEU A . n A 1 15 THR 15 94 94 THR THR A . n A 1 16 TYR 16 95 95 TYR TYR A . n A 1 17 ARG 17 96 96 ARG ARG A . n A 1 18 ILE 18 97 97 ILE ILE A . n A 1 19 ARG 19 98 98 ARG ARG A . n A 1 20 ASN 20 99 99 ASN ASN A . n A 1 21 TYR 21 100 100 TYR TYR A . n A 1 22 THR 22 101 101 THR THR A . n A 1 23 PRO 23 102 102 PRO PRO A . n A 1 24 GLN 24 103 103 GLN GLN A . n A 1 25 LEU 25 104 104 LEU LEU A . n A 1 26 SER 26 105 105 SER SER A . n A 1 27 GLU 27 106 106 GLU GLU A . n A 1 28 ALA 28 107 107 ALA ALA A . n A 1 29 GLU 29 108 108 GLU GLU A . n A 1 30 VAL 30 109 109 VAL VAL A . n A 1 31 GLU 31 110 110 GLU GLU A . n A 1 32 ARG 32 111 111 ARG ARG A . n A 1 33 ALA 33 112 112 ALA ALA A . n A 1 34 ILE 34 113 113 ILE ILE A . n A 1 35 LYS 35 114 114 LYS LYS A . n A 1 36 ASP 36 115 115 ASP ASP A . n A 1 37 ALA 37 116 116 ALA ALA A . n A 1 38 PHE 38 117 117 PHE PHE A . n A 1 39 GLU 39 118 118 GLU GLU A . n A 1 40 LEU 40 119 119 LEU LEU A . n A 1 41 TRP 41 120 120 TRP TRP A . n A 1 42 SER 42 121 121 SER SER A . n A 1 43 VAL 43 122 122 VAL VAL A . n A 1 44 ALA 44 123 123 ALA ALA A . n A 1 45 SER 45 124 124 SER SER A . n A 1 46 PRO 46 125 125 PRO PRO A . n A 1 47 LEU 47 126 126 LEU LEU A . n A 1 48 ILE 48 127 127 ILE ILE A . n A 1 49 PHE 49 128 128 PHE PHE A . n A 1 50 THR 50 129 129 THR THR A . n A 1 51 ARG 51 130 130 ARG ARG A . n A 1 52 ILE 52 131 131 ILE ILE A . n A 1 53 SER 53 132 132 SER SER A . n A 1 54 GLN 54 133 133 GLN GLN A . n A 1 55 GLY 55 134 134 GLY GLY A . n A 1 56 GLU 56 135 135 GLU GLU A . n A 1 57 ALA 57 136 136 ALA ALA A . n A 1 58 ASP 58 137 137 ASP ASP A . n A 1 59 ILE 59 138 138 ILE ILE A . n A 1 60 ASN 60 139 139 ASN ASN A . n A 1 61 ILE 61 140 140 ILE ILE A . n A 1 62 ALA 62 141 141 ALA ALA A . n A 1 63 PHE 63 142 142 PHE PHE A . n A 1 64 TYR 64 143 143 TYR TYR A . n A 1 65 GLN 65 144 144 GLN GLN A . n A 1 66 ARG 66 145 145 ARG ARG A . n A 1 67 ASP 67 146 146 ASP ASP A . n A 1 68 HIS 68 147 147 HIS HIS A . n A 1 69 GLY 69 148 148 GLY GLY A . n A 1 70 ASP 70 149 149 ASP ASP A . n A 1 71 ASN 71 150 150 ASN ASN A . n A 1 72 SER 72 151 151 SER SER A . n A 1 73 PRO 73 152 152 PRO PRO A . n A 1 74 PHE 74 153 153 PHE PHE A . n A 1 75 ASP 75 154 154 ASP ASP A . n A 1 76 GLY 76 155 155 GLY GLY A . n A 1 77 PRO 77 156 156 PRO PRO A . n A 1 78 ASN 78 157 157 ASN ASN A . n A 1 79 GLY 79 158 158 GLY GLY A . n A 1 80 ILE 80 159 159 ILE ILE A . n A 1 81 LEU 81 160 160 LEU LEU A . n A 1 82 ALA 82 161 161 ALA ALA A . n A 1 83 HIS 83 162 162 HIS HIS A . n A 1 84 ALA 84 163 163 ALA ALA A . n A 1 85 PHE 85 164 164 PHE PHE A . n A 1 86 GLN 86 165 165 GLN GLN A . n A 1 87 PRO 87 166 166 PRO PRO A . n A 1 88 GLY 88 167 167 GLY GLY A . n A 1 89 GLN 89 168 168 GLN GLN A . n A 1 90 GLY 90 169 169 GLY GLY A . n A 1 91 ILE 91 170 170 ILE ILE A . n A 1 92 GLY 92 171 171 GLY GLY A . n A 1 93 GLY 93 172 172 GLY GLY A . n A 1 94 ASP 94 173 173 ASP ASP A . n A 1 95 ALA 95 174 174 ALA ALA A . n A 1 96 HIS 96 175 175 HIS HIS A . n A 1 97 PHE 97 176 176 PHE PHE A . n A 1 98 ASP 98 177 177 ASP ASP A . n A 1 99 ALA 99 178 178 ALA ALA A . n A 1 100 GLU 100 179 179 GLU GLU A . n A 1 101 GLU 101 180 180 GLU GLU A . n A 1 102 THR 102 181 181 THR THR A . n A 1 103 TRP 103 182 182 TRP TRP A . n A 1 104 THR 104 183 183 THR THR A . n A 1 105 ASN 105 184 184 ASN ASN A . n A 1 106 THR 106 185 185 THR THR A . n A 1 107 SER 107 186 186 SER SER A . n A 1 108 ALA 108 187 187 ALA ALA A . n A 1 109 ASN 109 188 188 ASN ASN A . n A 1 110 TYR 110 189 189 TYR TYR A . n A 1 111 ASN 111 190 190 ASN ASN A . n A 1 112 LEU 112 191 191 LEU LEU A . n A 1 113 PHE 113 192 192 PHE PHE A . n A 1 114 LEU 114 193 193 LEU LEU A . n A 1 115 VAL 115 194 194 VAL VAL A . n A 1 116 ALA 116 195 195 ALA ALA A . n A 1 117 ALA 117 196 196 ALA ALA A . n A 1 118 HIS 118 197 197 HIS HIS A . n A 1 119 GLU 119 198 198 GLU GLU A . n A 1 120 PHE 120 199 199 PHE PHE A . n A 1 121 GLY 121 200 200 GLY GLY A . n A 1 122 HIS 122 201 201 HIS HIS A . n A 1 123 SER 123 202 202 SER SER A . n A 1 124 LEU 124 203 203 LEU LEU A . n A 1 125 GLY 125 204 204 GLY GLY A . n A 1 126 LEU 126 205 205 LEU LEU A . n A 1 127 ALA 127 206 206 ALA ALA A . n A 1 128 HIS 128 207 207 HIS HIS A . n A 1 129 SER 129 208 208 SER SER A . n A 1 130 SER 130 209 209 SER SER A . n A 1 131 ASP 131 210 210 ASP ASP A . n A 1 132 PRO 132 211 211 PRO PRO A . n A 1 133 GLY 133 212 212 GLY GLY A . n A 1 134 ALA 134 213 213 ALA ALA A . n A 1 135 LEU 135 214 214 LEU LEU A . n A 1 136 MET 136 215 215 MET MET A . n A 1 137 TYR 137 216 216 TYR TYR A . n A 1 138 PRO 138 217 217 PRO PRO A . n A 1 139 ASN 139 218 218 ASN ASN A . n A 1 140 TYR 140 219 219 TYR TYR A . n A 1 141 ALA 141 220 220 ALA ALA A . n A 1 142 PHE 142 221 221 PHE PHE A . n A 1 143 ARG 143 222 222 ARG ARG A . n A 1 144 GLU 144 223 223 GLU GLU A . n A 1 145 THR 145 224 224 THR THR A . n A 1 146 SER 146 225 225 SER SER A . n A 1 147 ASN 147 226 226 ASN ASN A . n A 1 148 TYR 148 227 227 TYR TYR A . n A 1 149 SER 149 228 228 SER SER A . n A 1 150 LEU 150 229 229 LEU LEU A . n A 1 151 PRO 151 230 230 PRO PRO A . n A 1 152 GLN 152 231 231 GLN GLN A . n A 1 153 ASP 153 232 232 ASP ASP A . n A 1 154 ASP 154 233 233 ASP ASP A . n A 1 155 ILE 155 234 234 ILE ILE A . n A 1 156 ASP 156 235 235 ASP ASP A . n A 1 157 GLY 157 236 236 GLY GLY A . n A 1 158 ILE 158 237 237 ILE ILE A . n A 1 159 GLN 159 238 238 GLN GLN A . n A 1 160 ALA 160 239 239 ALA ALA A . n A 1 161 ILE 161 240 240 ILE ILE A . n A 1 162 TYR 162 241 241 TYR TYR A . n A 1 163 GLY 163 242 242 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 996 996 CA CA A . C 2 CA 1 997 997 CA CA A . D 3 ZN 1 998 998 ZN ZN A . E 3 ZN 1 999 999 ZN ZN A . F 4 2NI 1 1000 128 2NI 2NI A . G 5 HOH 1 1001 1 HOH HOH A . G 5 HOH 2 1002 2 HOH HOH A . G 5 HOH 3 1003 3 HOH HOH A . G 5 HOH 4 1004 4 HOH HOH A . G 5 HOH 5 1005 5 HOH HOH A . G 5 HOH 6 1006 6 HOH HOH A . G 5 HOH 7 1007 7 HOH HOH A . G 5 HOH 8 1008 8 HOH HOH A . G 5 HOH 9 1009 9 HOH HOH A . G 5 HOH 10 1010 10 HOH HOH A . G 5 HOH 11 1011 11 HOH HOH A . G 5 HOH 12 1012 12 HOH HOH A . G 5 HOH 13 1013 13 HOH HOH A . G 5 HOH 14 1014 14 HOH HOH A . G 5 HOH 15 1015 15 HOH HOH A . G 5 HOH 16 1016 16 HOH HOH A . G 5 HOH 17 1017 17 HOH HOH A . G 5 HOH 18 1018 18 HOH HOH A . G 5 HOH 19 1019 19 HOH HOH A . G 5 HOH 20 1020 20 HOH HOH A . G 5 HOH 21 1021 21 HOH HOH A . G 5 HOH 22 1022 22 HOH HOH A . G 5 HOH 23 1023 23 HOH HOH A . G 5 HOH 24 1024 24 HOH HOH A . G 5 HOH 25 1025 25 HOH HOH A . G 5 HOH 26 1026 26 HOH HOH A . G 5 HOH 27 1027 27 HOH HOH A . G 5 HOH 28 1028 28 HOH HOH A . G 5 HOH 29 1029 29 HOH HOH A . G 5 HOH 30 1030 30 HOH HOH A . G 5 HOH 31 1031 31 HOH HOH A . G 5 HOH 32 1032 32 HOH HOH A . G 5 HOH 33 1033 33 HOH HOH A . G 5 HOH 34 1034 34 HOH HOH A . G 5 HOH 35 1035 35 HOH HOH A . G 5 HOH 36 1036 36 HOH HOH A . G 5 HOH 37 1037 37 HOH HOH A . G 5 HOH 38 1038 38 HOH HOH A . G 5 HOH 39 1039 39 HOH HOH A . G 5 HOH 40 1040 40 HOH HOH A . G 5 HOH 41 1041 41 HOH HOH A . G 5 HOH 42 1042 42 HOH HOH A . G 5 HOH 43 1043 43 HOH HOH A . G 5 HOH 44 1044 44 HOH HOH A . G 5 HOH 45 1045 45 HOH HOH A . G 5 HOH 46 1046 46 HOH HOH A . G 5 HOH 47 1047 47 HOH HOH A . G 5 HOH 48 1048 48 HOH HOH A . G 5 HOH 49 1049 49 HOH HOH A . G 5 HOH 50 1050 50 HOH HOH A . G 5 HOH 51 1051 51 HOH HOH A . G 5 HOH 52 1052 52 HOH HOH A . G 5 HOH 53 1053 53 HOH HOH A . G 5 HOH 54 1054 54 HOH HOH A . G 5 HOH 55 1055 55 HOH HOH A . G 5 HOH 56 1056 56 HOH HOH A . G 5 HOH 57 1057 57 HOH HOH A . G 5 HOH 58 1058 58 HOH HOH A . G 5 HOH 59 1059 59 HOH HOH A . G 5 HOH 60 1060 60 HOH HOH A . G 5 HOH 61 1061 61 HOH HOH A . G 5 HOH 62 1062 62 HOH HOH A . G 5 HOH 63 1063 63 HOH HOH A . G 5 HOH 64 1064 64 HOH HOH A . G 5 HOH 65 1065 65 HOH HOH A . G 5 HOH 66 1066 66 HOH HOH A . G 5 HOH 67 1067 67 HOH HOH A . G 5 HOH 68 1068 68 HOH HOH A . G 5 HOH 69 1069 69 HOH HOH A . G 5 HOH 70 1070 70 HOH HOH A . G 5 HOH 71 1071 71 HOH HOH A . G 5 HOH 72 1072 72 HOH HOH A . G 5 HOH 73 1073 73 HOH HOH A . G 5 HOH 74 1074 74 HOH HOH A . G 5 HOH 75 1075 75 HOH HOH A . G 5 HOH 76 1076 76 HOH HOH A . G 5 HOH 77 1077 77 HOH HOH A . G 5 HOH 78 1078 78 HOH HOH A . G 5 HOH 79 1079 79 HOH HOH A . G 5 HOH 80 1080 80 HOH HOH A . G 5 HOH 81 1081 81 HOH HOH A . G 5 HOH 82 1082 82 HOH HOH A . G 5 HOH 83 1083 83 HOH HOH A . G 5 HOH 84 1084 84 HOH HOH A . G 5 HOH 85 1085 85 HOH HOH A . G 5 HOH 86 1086 86 HOH HOH A . G 5 HOH 87 1087 87 HOH HOH A . G 5 HOH 88 1088 88 HOH HOH A . G 5 HOH 89 1089 89 HOH HOH A . G 5 HOH 90 1090 107 HOH HOH A . G 5 HOH 91 1091 91 HOH HOH A . G 5 HOH 92 1092 92 HOH HOH A . G 5 HOH 93 1093 93 HOH HOH A . G 5 HOH 94 1094 94 HOH HOH A . G 5 HOH 95 1095 95 HOH HOH A . G 5 HOH 96 1096 96 HOH HOH A . G 5 HOH 97 1097 97 HOH HOH A . G 5 HOH 98 1098 98 HOH HOH A . G 5 HOH 99 1099 99 HOH HOH A . G 5 HOH 100 1100 100 HOH HOH A . G 5 HOH 101 1101 101 HOH HOH A . G 5 HOH 102 1102 102 HOH HOH A . G 5 HOH 103 1103 103 HOH HOH A . G 5 HOH 104 1104 104 HOH HOH A . G 5 HOH 105 1105 105 HOH HOH A . G 5 HOH 106 1106 106 HOH HOH A . G 5 HOH 107 1107 108 HOH HOH A . G 5 HOH 108 1108 109 HOH HOH A . G 5 HOH 109 1109 110 HOH HOH A . G 5 HOH 110 1110 111 HOH HOH A . G 5 HOH 111 1111 112 HOH HOH A . G 5 HOH 112 1112 113 HOH HOH A . G 5 HOH 113 1113 114 HOH HOH A . G 5 HOH 114 1114 115 HOH HOH A . G 5 HOH 115 1115 116 HOH HOH A . G 5 HOH 116 1116 117 HOH HOH A . G 5 HOH 117 1117 118 HOH HOH A . G 5 HOH 118 1118 119 HOH HOH A . G 5 HOH 119 1119 120 HOH HOH A . G 5 HOH 120 1120 121 HOH HOH A . G 5 HOH 121 1121 122 HOH HOH A . G 5 HOH 122 1122 123 HOH HOH A . G 5 HOH 123 1123 124 HOH HOH A . G 5 HOH 124 1124 125 HOH HOH A . G 5 HOH 125 1125 126 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ASP 58 ? A ASP 137 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 O ? A GLY 92 ? A GLY 171 ? 1_555 92.8 ? 2 O ? A ASP 58 ? A ASP 137 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 O ? A GLY 90 ? A GLY 169 ? 1_555 160.9 ? 3 O ? A GLY 92 ? A GLY 171 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 O ? A GLY 90 ? A GLY 169 ? 1_555 105.5 ? 4 O ? A ASP 58 ? A ASP 137 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 OD1 ? A ASP 94 ? A ASP 173 ? 1_555 89.2 ? 5 O ? A GLY 92 ? A GLY 171 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 OD1 ? A ASP 94 ? A ASP 173 ? 1_555 103.5 ? 6 O ? A GLY 90 ? A GLY 169 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 OD1 ? A ASP 94 ? A ASP 173 ? 1_555 91.6 ? 7 O ? A ASP 58 ? A ASP 137 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 O ? G HOH . ? A HOH 1093 ? 1_555 117.2 ? 8 O ? A GLY 92 ? A GLY 171 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 O ? G HOH . ? A HOH 1093 ? 1_555 149.8 ? 9 O ? A GLY 90 ? A GLY 169 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 O ? G HOH . ? A HOH 1093 ? 1_555 44.3 ? 10 OD1 ? A ASP 94 ? A ASP 173 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 O ? G HOH . ? A HOH 1093 ? 1_555 81.5 ? 11 O ? A ASP 58 ? A ASP 137 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 O ? G HOH . ? A HOH 1098 ? 1_555 81.7 ? 12 O ? A GLY 92 ? A GLY 171 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 O ? G HOH . ? A HOH 1098 ? 1_555 150.4 ? 13 O ? A GLY 90 ? A GLY 169 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 O ? G HOH . ? A HOH 1098 ? 1_555 79.7 ? 14 OD1 ? A ASP 94 ? A ASP 173 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 O ? G HOH . ? A HOH 1098 ? 1_555 105.5 ? 15 O ? G HOH . ? A HOH 1093 ? 1_555 CA ? B CA . ? A CA 996 ? 1_555 O ? G HOH . ? A HOH 1098 ? 1_555 43.4 ? 16 O ? A ILE 80 ? A ILE 159 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 OD1 ? A ASP 75 ? A ASP 154 ? 1_555 88.4 ? 17 O ? A ILE 80 ? A ILE 159 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 O ? A GLY 76 ? A GLY 155 ? 1_555 175.8 ? 18 OD1 ? A ASP 75 ? A ASP 154 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 O ? A GLY 76 ? A GLY 155 ? 1_555 89.6 ? 19 O ? A ILE 80 ? A ILE 159 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 O ? A ASN 78 ? A ASN 157 ? 1_555 102.0 ? 20 OD1 ? A ASP 75 ? A ASP 154 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 O ? A ASN 78 ? A ASN 157 ? 1_555 88.0 ? 21 O ? A GLY 76 ? A GLY 155 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 O ? A ASN 78 ? A ASN 157 ? 1_555 81.7 ? 22 O ? A ILE 80 ? A ILE 159 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 OD2 ? A ASP 98 ? A ASP 177 ? 1_555 88.2 ? 23 OD1 ? A ASP 75 ? A ASP 154 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 OD2 ? A ASP 98 ? A ASP 177 ? 1_555 90.7 ? 24 O ? A GLY 76 ? A GLY 155 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 OD2 ? A ASP 98 ? A ASP 177 ? 1_555 88.0 ? 25 O ? A ASN 78 ? A ASN 157 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 OD2 ? A ASP 98 ? A ASP 177 ? 1_555 169.6 ? 26 O ? A ILE 80 ? A ILE 159 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 OE2 ? A GLU 101 ? A GLU 180 ? 1_555 82.5 ? 27 OD1 ? A ASP 75 ? A ASP 154 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 OE2 ? A GLU 101 ? A GLU 180 ? 1_555 169.9 ? 28 O ? A GLY 76 ? A GLY 155 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 OE2 ? A GLU 101 ? A GLU 180 ? 1_555 99.7 ? 29 O ? A ASN 78 ? A ASN 157 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 OE2 ? A GLU 101 ? A GLU 180 ? 1_555 89.7 ? 30 OD2 ? A ASP 98 ? A ASP 177 ? 1_555 CA ? C CA . ? A CA 997 ? 1_555 OE2 ? A GLU 101 ? A GLU 180 ? 1_555 93.4 ? 31 NE2 ? A HIS 83 ? A HIS 162 ? 1_555 ZN ? D ZN . ? A ZN 998 ? 1_555 OD2 ? A ASP 70 ? A ASP 149 ? 1_555 112.6 ? 32 NE2 ? A HIS 83 ? A HIS 162 ? 1_555 ZN ? D ZN . ? A ZN 998 ? 1_555 ND1 ? A HIS 96 ? A HIS 175 ? 1_555 114.8 ? 33 OD2 ? A ASP 70 ? A ASP 149 ? 1_555 ZN ? D ZN . ? A ZN 998 ? 1_555 ND1 ? A HIS 96 ? A HIS 175 ? 1_555 91.2 ? 34 NE2 ? A HIS 83 ? A HIS 162 ? 1_555 ZN ? D ZN . ? A ZN 998 ? 1_555 NE2 ? A HIS 68 ? A HIS 147 ? 1_555 110.6 ? 35 OD2 ? A ASP 70 ? A ASP 149 ? 1_555 ZN ? D ZN . ? A ZN 998 ? 1_555 NE2 ? A HIS 68 ? A HIS 147 ? 1_555 115.4 ? 36 ND1 ? A HIS 96 ? A HIS 175 ? 1_555 ZN ? D ZN . ? A ZN 998 ? 1_555 NE2 ? A HIS 68 ? A HIS 147 ? 1_555 111.2 ? 37 NE2 ? A HIS 118 ? A HIS 197 ? 1_555 ZN ? E ZN . ? A ZN 999 ? 1_555 O3 ? F 2NI . ? A 2NI 1000 ? 1_555 110.0 ? 38 NE2 ? A HIS 118 ? A HIS 197 ? 1_555 ZN ? E ZN . ? A ZN 999 ? 1_555 NE2 ? A HIS 122 ? A HIS 201 ? 1_555 105.3 ? 39 O3 ? F 2NI . ? A 2NI 1000 ? 1_555 ZN ? E ZN . ? A ZN 999 ? 1_555 NE2 ? A HIS 122 ? A HIS 201 ? 1_555 119.6 ? 40 NE2 ? A HIS 118 ? A HIS 197 ? 1_555 ZN ? E ZN . ? A ZN 999 ? 1_555 NE2 ? A HIS 128 ? A HIS 207 ? 1_555 104.1 ? 41 O3 ? F 2NI . ? A 2NI 1000 ? 1_555 ZN ? E ZN . ? A ZN 999 ? 1_555 NE2 ? A HIS 128 ? A HIS 207 ? 1_555 114.5 ? 42 NE2 ? A HIS 122 ? A HIS 201 ? 1_555 ZN ? E ZN . ? A ZN 999 ? 1_555 NE2 ? A HIS 128 ? A HIS 207 ? 1_555 101.9 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-12-06 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-11 5 'Structure model' 1 4 2018-01-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' 4 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' citation_author # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 5 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_citation_author.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MAR345 'data collection' . ? 1 SCALEPACK 'data scaling' . ? 2 AMoRE phasing . ? 3 CNS refinement 1.0 ? 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OD1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASN _pdbx_validate_symm_contact.auth_seq_id_1 150 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OG1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 THR _pdbx_validate_symm_contact.auth_seq_id_2 185 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_555 _pdbx_validate_symm_contact.dist 2.12 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 SER _pdbx_validate_rmsd_angle.auth_seq_id_1 151 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 SER _pdbx_validate_rmsd_angle.auth_seq_id_2 151 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 SER _pdbx_validate_rmsd_angle.auth_seq_id_3 151 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 92.23 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation -18.77 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 145 ? ? 40.32 -131.11 2 1 HIS A 147 ? ? -143.19 41.35 3 1 ASN A 157 ? ? 59.62 -167.43 4 1 THR A 185 ? ? -108.20 -161.72 5 1 GLU A 223 ? ? -42.80 94.42 6 1 SER A 225 ? ? -50.89 -81.62 7 1 TYR A 227 ? ? -51.63 109.00 8 1 LEU A 229 ? ? -34.32 125.89 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'ZINC ION' ZN 4 "N-{2-[(4'-CYANO-1,1'-BIPHENYL-4-YL)OXY]ETHYL}-N'-HYDROXY-N-METHYLUREA" 2NI 5 water HOH #