data_1ZP6 # _entry.id 1ZP6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1ZP6 RCSB RCSB032979 WWPDB D_1000032979 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id AtR62 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZP6 _pdbx_database_status.recvd_initial_deposition_date 2005-05-16 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Abashidze, M.' 2 'Vorobiev, S.M.' 3 'Kuzin, A.' 4 'Conover, K.' 5 'Acton, T.B.' 6 'Montelione, G.T.' 7 'Hunt, J.F.' 8 'Tong, L.' 9 'Northeast Structural Genomics Consortium (NESG)' 10 # _citation.id primary _citation.title ;Crystal Structure of Atu3015, a Putative Cytidylate Kinase from Agrobacterium tumefaciens, Northeast Structural Genomics Target AtR62 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Forouhar, F.' 1 primary 'Abashidze, M.' 2 primary 'Vorobiev, S.M.' 3 primary 'Kuzin, A.' 4 primary 'Conover, K.' 5 primary 'Acton, T.B.' 6 primary 'Montelione, G.T.' 7 primary 'Hunt, J.F.' 8 primary 'Tong, L.' 9 # _cell.entry_id 1ZP6 _cell.length_a 91.960 _cell.length_b 91.960 _cell.length_c 173.603 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ZP6 _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'hypothetical protein Atu3015' 21117.531 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 5 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MNMTDDLGGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIKHGRIDPWLPQSHQQNR(MSE)I(MSE)QIA ADVAGRYAKEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAAEAIERCLDRGGDSLSDPLVVADLHSQFADLGAFEH HVLPVSGKDTDQALQSAINALQSGRFRIDASLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNMTDDLGGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIKHGRIDPWLPQSHQQNRMIMQIAADVAGRYA KEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAAEAIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGK DTDQALQSAINALQSGRFRIDASLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier AtR62 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 MET n 1 4 THR n 1 5 ASP n 1 6 ASP n 1 7 LEU n 1 8 GLY n 1 9 GLY n 1 10 ASN n 1 11 ILE n 1 12 LEU n 1 13 LEU n 1 14 LEU n 1 15 SER n 1 16 GLY n 1 17 HIS n 1 18 PRO n 1 19 GLY n 1 20 SER n 1 21 GLY n 1 22 LYS n 1 23 SER n 1 24 THR n 1 25 ILE n 1 26 ALA n 1 27 GLU n 1 28 ALA n 1 29 LEU n 1 30 ALA n 1 31 ASN n 1 32 LEU n 1 33 PRO n 1 34 GLY n 1 35 VAL n 1 36 PRO n 1 37 LYS n 1 38 VAL n 1 39 HIS n 1 40 PHE n 1 41 HIS n 1 42 SER n 1 43 ASP n 1 44 ASP n 1 45 LEU n 1 46 TRP n 1 47 GLY n 1 48 TYR n 1 49 ILE n 1 50 LYS n 1 51 HIS n 1 52 GLY n 1 53 ARG n 1 54 ILE n 1 55 ASP n 1 56 PRO n 1 57 TRP n 1 58 LEU n 1 59 PRO n 1 60 GLN n 1 61 SER n 1 62 HIS n 1 63 GLN n 1 64 GLN n 1 65 ASN n 1 66 ARG n 1 67 MSE n 1 68 ILE n 1 69 MSE n 1 70 GLN n 1 71 ILE n 1 72 ALA n 1 73 ALA n 1 74 ASP n 1 75 VAL n 1 76 ALA n 1 77 GLY n 1 78 ARG n 1 79 TYR n 1 80 ALA n 1 81 LYS n 1 82 GLU n 1 83 GLY n 1 84 TYR n 1 85 PHE n 1 86 VAL n 1 87 ILE n 1 88 LEU n 1 89 ASP n 1 90 GLY n 1 91 VAL n 1 92 VAL n 1 93 ARG n 1 94 PRO n 1 95 ASP n 1 96 TRP n 1 97 LEU n 1 98 PRO n 1 99 ALA n 1 100 PHE n 1 101 THR n 1 102 ALA n 1 103 LEU n 1 104 ALA n 1 105 ARG n 1 106 PRO n 1 107 LEU n 1 108 HIS n 1 109 TYR n 1 110 ILE n 1 111 VAL n 1 112 LEU n 1 113 ARG n 1 114 THR n 1 115 THR n 1 116 ALA n 1 117 ALA n 1 118 GLU n 1 119 ALA n 1 120 ILE n 1 121 GLU n 1 122 ARG n 1 123 CYS n 1 124 LEU n 1 125 ASP n 1 126 ARG n 1 127 GLY n 1 128 GLY n 1 129 ASP n 1 130 SER n 1 131 LEU n 1 132 SER n 1 133 ASP n 1 134 PRO n 1 135 LEU n 1 136 VAL n 1 137 VAL n 1 138 ALA n 1 139 ASP n 1 140 LEU n 1 141 HIS n 1 142 SER n 1 143 GLN n 1 144 PHE n 1 145 ALA n 1 146 ASP n 1 147 LEU n 1 148 GLY n 1 149 ALA n 1 150 PHE n 1 151 GLU n 1 152 HIS n 1 153 HIS n 1 154 VAL n 1 155 LEU n 1 156 PRO n 1 157 VAL n 1 158 SER n 1 159 GLY n 1 160 LYS n 1 161 ASP n 1 162 THR n 1 163 ASP n 1 164 GLN n 1 165 ALA n 1 166 LEU n 1 167 GLN n 1 168 SER n 1 169 ALA n 1 170 ILE n 1 171 ASN n 1 172 ALA n 1 173 LEU n 1 174 GLN n 1 175 SER n 1 176 GLY n 1 177 ARG n 1 178 PHE n 1 179 ARG n 1 180 ILE n 1 181 ASP n 1 182 ALA n 1 183 SER n 1 184 LEU n 1 185 GLU n 1 186 HIS n 1 187 HIS n 1 188 HIS n 1 189 HIS n 1 190 HIS n 1 191 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Agrobacterium _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Agrobacterium tumefaciens' _entity_src_gen.gene_src_strain 'C58 / ATCC 33970' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Agrobacterium tumefaciens str. C58' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 176299 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET21(BL21)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8UBK1_AGRT5 _struct_ref.pdbx_db_accession Q8UBK1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNMTDDLGGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIKHGRIDPWLPQSHQQNRMIMQIAADVAGRYA KEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAAEAIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGK DTDQALQSAINALQSGRFRIDAS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ZP6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8UBK1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1ZP6 MSE A 67 ? UNP Q8UBK1 MET 67 'MODIFIED RESIDUE' 67 1 1 1ZP6 MSE A 69 ? UNP Q8UBK1 MET 69 'MODIFIED RESIDUE' 69 2 1 1ZP6 LEU A 184 ? UNP Q8UBK1 ? ? 'CLONING ARTIFACT' 184 3 1 1ZP6 GLU A 185 ? UNP Q8UBK1 ? ? 'CLONING ARTIFACT' 185 4 1 1ZP6 HIS A 186 ? UNP Q8UBK1 ? ? 'CLONING ARTIFACT' 186 5 1 1ZP6 HIS A 187 ? UNP Q8UBK1 ? ? 'CLONING ARTIFACT' 187 6 1 1ZP6 HIS A 188 ? UNP Q8UBK1 ? ? 'CLONING ARTIFACT' 188 7 1 1ZP6 HIS A 189 ? UNP Q8UBK1 ? ? 'CLONING ARTIFACT' 189 8 1 1ZP6 HIS A 190 ? UNP Q8UBK1 ? ? 'CLONING ARTIFACT' 190 9 1 1ZP6 HIS A 191 ? UNP Q8UBK1 ? ? 'CLONING ARTIFACT' 191 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1ZP6 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.6 _exptl_crystal.density_percent_sol 72.7 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.15 _exptl_crystal_grow.pdbx_details '50 mM MES, 1140 mM ammonium sulfate, and 5 mM DTT., pH 6.15, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2005-03-01 _diffrn_detector.details mirrors. # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.979756 1.0 2 0.97930 1.0 3 0.96817 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.979756, 0.97930, 0.96817' # _reflns.entry_id 1ZP6 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 30.0 _reflns.d_resolution_high 3.2 _reflns.number_obs 11773 _reflns.number_all 11738 _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs 0.098 _reflns.pdbx_Rsym_value 0.067 _reflns.pdbx_netI_over_sigmaI 24.24 _reflns.B_iso_Wilson_estimate 65.4 _reflns.pdbx_redundancy 13.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 3.2 _reflns_shell.d_res_low 3.31 _reflns_shell.percent_possible_all 99.2 _reflns_shell.Rmerge_I_obs 0.461 _reflns_shell.pdbx_Rsym_value 0.357 _reflns_shell.meanI_over_sigI_obs 4.25 _reflns_shell.pdbx_redundancy 10.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1ZP6 _refine.ls_number_reflns_obs 10367 _refine.ls_number_reflns_all 11738 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 229100.00 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 29.08 _refine.ls_d_res_high 3.20 _refine.ls_percent_reflns_obs 88.4 _refine.ls_R_factor_obs 0.253 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.253 _refine.ls_R_factor_R_free 0.322 _refine.ls_R_factor_R_free_error 0.010 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.9 _refine.ls_number_reflns_R_free 1025 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 70.6 _refine.aniso_B[1][1] 16.09 _refine.aniso_B[2][2] 16.09 _refine.aniso_B[3][3] -32.19 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.246345 _refine.solvent_model_param_bsol 10.5365 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model OVERALL _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1ZP6 _refine_analyze.Luzzati_coordinate_error_obs 0.41 _refine_analyze.Luzzati_sigma_a_obs 0.39 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.56 _refine_analyze.Luzzati_sigma_a_free 0.31 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1355 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 1365 _refine_hist.d_res_high 3.20 _refine_hist.d_res_low 29.08 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.5 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.88 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 3.20 _refine_ls_shell.d_res_low 3.40 _refine_ls_shell.number_reflns_R_work 1176 _refine_ls_shell.R_factor_R_work 0.299 _refine_ls_shell.percent_reflns_obs 66.6 _refine_ls_shell.R_factor_R_free 0.379 _refine_ls_shell.R_factor_R_free_error 0.034 _refine_ls_shell.percent_reflns_R_free 9.6 _refine_ls_shell.number_reflns_R_free 125 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1ZP6 _struct.title ;Crystal Structure of Atu3015, a Putative Cytidylate Kinase from Agrobacterium tumefaciens, Northeast Structural Genomics Target AtR62 ; _struct.pdbx_descriptor 'hypothetical protein Atu3015' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZP6 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;alpha-beta protein., Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 21 ? ASN A 31 ? GLY A 21 ASN A 31 1 ? 11 HELX_P HELX_P2 2 ASP A 43 ? TYR A 48 ? ASP A 43 TYR A 48 1 ? 6 HELX_P HELX_P3 3 GLN A 60 ? GLU A 82 ? GLN A 60 GLU A 82 1 ? 23 HELX_P HELX_P4 4 LEU A 97 ? ALA A 102 ? LEU A 97 ALA A 102 1 ? 6 HELX_P HELX_P5 5 THR A 115 ? ASP A 125 ? THR A 115 ASP A 125 1 ? 11 HELX_P HELX_P6 6 ASP A 133 ? PHE A 144 ? ASP A 133 PHE A 144 1 ? 12 HELX_P HELX_P7 7 ALA A 145 ? ASP A 146 ? ALA A 145 ASP A 146 5 ? 2 HELX_P HELX_P8 8 LEU A 147 ? HIS A 152 ? LEU A 147 HIS A 152 5 ? 6 HELX_P HELX_P9 9 ALA A 169 ? GLY A 176 ? ALA A 169 GLY A 176 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ARG 66 C ? ? ? 1_555 A MSE 67 N ? ? A ARG 66 A MSE 67 1_555 ? ? ? ? ? ? ? 1.327 ? covale2 covale ? ? A MSE 67 C ? ? ? 1_555 A ILE 68 N ? ? A MSE 67 A ILE 68 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A ILE 68 C ? ? ? 1_555 A MSE 69 N ? ? A ILE 68 A MSE 69 1_555 ? ? ? ? ? ? ? 1.322 ? covale4 covale ? ? A MSE 69 C ? ? ? 1_555 A GLN 70 N ? ? A MSE 69 A GLN 70 1_555 ? ? ? ? ? ? ? 1.328 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 58 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 58 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 59 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 59 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.38 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 37 ? PHE A 40 ? LYS A 37 PHE A 40 A 2 PHE A 85 ? LEU A 88 ? PHE A 85 LEU A 88 A 3 ASN A 10 ? GLY A 16 ? ASN A 10 GLY A 16 A 4 LEU A 107 ? ARG A 113 ? LEU A 107 ARG A 113 A 5 VAL A 154 ? PRO A 156 ? VAL A 154 PRO A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 40 ? N PHE A 40 O ILE A 87 ? O ILE A 87 A 2 3 O LEU A 88 ? O LEU A 88 N LEU A 12 ? N LEU A 12 A 3 4 N SER A 15 ? N SER A 15 O LEU A 112 ? O LEU A 112 A 4 5 N VAL A 111 ? N VAL A 111 O LEU A 155 ? O LEU A 155 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 HIS A 17 ? HIS A 17 . ? 1_555 ? 2 AC1 8 PRO A 18 ? PRO A 18 . ? 1_555 ? 3 AC1 8 GLY A 19 ? GLY A 19 . ? 1_555 ? 4 AC1 8 SER A 20 ? SER A 20 . ? 1_555 ? 5 AC1 8 GLY A 21 ? GLY A 21 . ? 1_555 ? 6 AC1 8 LYS A 22 ? LYS A 22 . ? 1_555 ? 7 AC1 8 SER A 23 ? SER A 23 . ? 1_555 ? 8 AC1 8 ARG A 126 ? ARG A 126 . ? 1_555 ? # _database_PDB_matrix.entry_id 1ZP6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ZP6 _atom_sites.fract_transf_matrix[1][1] 0.010874 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010874 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005760 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 MET 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 ASP 5 5 ? ? ? A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 MSE 67 67 67 MSE MSE A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 MSE 69 69 69 MSE MSE A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 CYS 123 123 123 CYS CYS A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 HIS 152 152 152 HIS HIS A . n A 1 153 HIS 153 153 153 HIS HIS A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 SER 175 175 175 SER SER A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 ARG 177 177 177 ARG ARG A . n A 1 178 PHE 178 178 178 PHE PHE A . n A 1 179 ARG 179 179 179 ARG ARG A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 ALA 182 182 ? ? ? A . n A 1 183 SER 183 183 ? ? ? A . n A 1 184 LEU 184 184 ? ? ? A . n A 1 185 GLU 185 185 ? ? ? A . n A 1 186 HIS 186 186 ? ? ? A . n A 1 187 HIS 187 187 ? ? ? A . n A 1 188 HIS 188 188 ? ? ? A . n A 1 189 HIS 189 189 ? ? ? A . n A 1 190 HIS 190 190 ? ? ? A . n A 1 191 HIS 191 191 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 201 SO4 SO4 A . C 3 HOH 1 202 1 HOH HOH A . C 3 HOH 2 203 2 HOH HOH A . C 3 HOH 3 204 3 HOH HOH A . C 3 HOH 4 205 4 HOH HOH A . C 3 HOH 5 206 5 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 67 A MSE 67 ? MET SELENOMETHIONINE 2 A MSE 69 A MSE 69 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 -x+1/2,y,-z+3/4 -1.0000000000 0.0000000000 0.0000000000 45.9800000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 130.2022500000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 205 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-05-24 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2011-11-16 5 'Structure model' 1 4 2017-10-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Atomic model' 4 5 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 5 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 5 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_software.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 DENZO 'data reduction' . ? 2 SDMS 'data scaling' . ? 3 SnB phasing . ? 4 SOLVE phasing . ? 5 RESOLVE phasing . ? 6 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OD1 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ASP _pdbx_validate_symm_contact.auth_seq_id_1 74 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OD1 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ASP _pdbx_validate_symm_contact.auth_seq_id_2 74 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 5_555 _pdbx_validate_symm_contact.dist 2.00 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 51 ? ? 72.99 95.63 2 1 ILE A 54 ? ? 62.63 99.83 3 1 PRO A 56 ? ? -68.87 2.79 4 1 LEU A 58 ? ? 164.03 162.17 5 1 GLN A 60 ? ? -61.93 6.56 6 1 SER A 61 ? ? -78.17 25.25 7 1 HIS A 62 ? ? -66.47 -76.13 8 1 GLU A 82 ? ? -89.35 44.26 9 1 ALA A 102 ? ? -56.16 -7.74 10 1 ALA A 104 ? ? 36.02 36.46 11 1 ASP A 129 ? ? -144.71 -0.70 12 1 SER A 130 ? ? -82.44 -156.05 13 1 PHE A 144 ? ? -64.50 12.28 14 1 HIS A 152 ? ? -61.33 3.01 15 1 ALA A 165 ? ? -93.82 44.24 16 1 LEU A 166 ? ? -147.95 -73.16 17 1 ALA A 169 ? ? -120.16 -126.30 18 1 ARG A 179 ? ? 178.24 87.25 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A MET 3 ? A MET 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A ASP 5 ? A ASP 5 6 1 Y 1 A ALA 182 ? A ALA 182 7 1 Y 1 A SER 183 ? A SER 183 8 1 Y 1 A LEU 184 ? A LEU 184 9 1 Y 1 A GLU 185 ? A GLU 185 10 1 Y 1 A HIS 186 ? A HIS 186 11 1 Y 1 A HIS 187 ? A HIS 187 12 1 Y 1 A HIS 188 ? A HIS 188 13 1 Y 1 A HIS 189 ? A HIS 189 14 1 Y 1 A HIS 190 ? A HIS 190 15 1 Y 1 A HIS 191 ? A HIS 191 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #