data_1ZRJ # _entry.id 1ZRJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ZRJ pdb_00001zrj 10.2210/pdb1zrj/pdb RCSB RCSB033036 ? ? WWPDB D_1000033036 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-11-19 2 'Structure model' 1 1 2008-01-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZRJ _pdbx_database_status.recvd_initial_deposition_date 2005-05-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002005508.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Suzuki, S.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Terada, T.' 5 'Shirouzu, M.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the SAP domain of human E1B-55kDa-associated protein 5 isoform c' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Suzuki, S.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Terada, T.' 5 ? primary 'Shirouzu, M.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'E1B-55kDa-associated protein 5 isoform c' _entity.formula_weight 5348.990 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SAP domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGMDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGMDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002005508.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 ASP n 1 10 VAL n 1 11 ARG n 1 12 ARG n 1 13 LEU n 1 14 LYS n 1 15 VAL n 1 16 ASN n 1 17 GLU n 1 18 LEU n 1 19 ARG n 1 20 GLU n 1 21 GLU n 1 22 LEU n 1 23 GLN n 1 24 ARG n 1 25 ARG n 1 26 GLY n 1 27 LEU n 1 28 ASP n 1 29 THR n 1 30 ARG n 1 31 GLY n 1 32 LEU n 1 33 LYS n 1 34 ALA n 1 35 GLU n 1 36 LEU n 1 37 ALA n 1 38 GLU n 1 39 ARG n 1 40 LEU n 1 41 GLN n 1 42 ALA n 1 43 ALA n 1 44 LEU n 1 45 SER n 1 46 GLY n 1 47 PRO n 1 48 SER n 1 49 SER n 1 50 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene HNRPUL1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P041101-20 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -6 -6 GLY GLY A . n A 1 2 SER 2 -5 -5 SER SER A . n A 1 3 SER 3 -4 -4 SER SER A . n A 1 4 GLY 4 -3 -3 GLY GLY A . n A 1 5 SER 5 -2 -2 SER SER A . n A 1 6 SER 6 -1 -1 SER SER A . n A 1 7 GLY 7 0 0 GLY GLY A . n A 1 8 MET 8 1 1 MET MET A . n A 1 9 ASP 9 2 2 ASP ASP A . n A 1 10 VAL 10 3 3 VAL VAL A . n A 1 11 ARG 11 4 4 ARG ARG A . n A 1 12 ARG 12 5 5 ARG ARG A . n A 1 13 LEU 13 6 6 LEU LEU A . n A 1 14 LYS 14 7 7 LYS LYS A . n A 1 15 VAL 15 8 8 VAL VAL A . n A 1 16 ASN 16 9 9 ASN ASN A . n A 1 17 GLU 17 10 10 GLU GLU A . n A 1 18 LEU 18 11 11 LEU LEU A . n A 1 19 ARG 19 12 12 ARG ARG A . n A 1 20 GLU 20 13 13 GLU GLU A . n A 1 21 GLU 21 14 14 GLU GLU A . n A 1 22 LEU 22 15 15 LEU LEU A . n A 1 23 GLN 23 16 16 GLN GLN A . n A 1 24 ARG 24 17 17 ARG ARG A . n A 1 25 ARG 25 18 18 ARG ARG A . n A 1 26 GLY 26 19 19 GLY GLY A . n A 1 27 LEU 27 20 20 LEU LEU A . n A 1 28 ASP 28 21 21 ASP ASP A . n A 1 29 THR 29 22 22 THR THR A . n A 1 30 ARG 30 23 23 ARG ARG A . n A 1 31 GLY 31 24 24 GLY GLY A . n A 1 32 LEU 32 25 25 LEU LEU A . n A 1 33 LYS 33 26 26 LYS LYS A . n A 1 34 ALA 34 27 27 ALA ALA A . n A 1 35 GLU 35 28 28 GLU GLU A . n A 1 36 LEU 36 29 29 LEU LEU A . n A 1 37 ALA 37 30 30 ALA ALA A . n A 1 38 GLU 38 31 31 GLU GLU A . n A 1 39 ARG 39 32 32 ARG ARG A . n A 1 40 LEU 40 33 33 LEU LEU A . n A 1 41 GLN 41 34 34 GLN GLN A . n A 1 42 ALA 42 35 35 ALA ALA A . n A 1 43 ALA 43 36 36 ALA ALA A . n A 1 44 LEU 44 37 37 LEU LEU A . n A 1 45 SER 45 38 38 SER SER A . n A 1 46 GLY 46 39 39 GLY GLY A . n A 1 47 PRO 47 40 40 PRO PRO A . n A 1 48 SER 48 41 41 SER SER A . n A 1 49 SER 49 42 42 SER SER A . n A 1 50 GLY 50 43 43 GLY GLY A . n # _exptl.entry_id 1ZRJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1ZRJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1ZRJ _struct.title 'Solution structure of the SAP domain of human E1B-55kDa-associated protein 5 isoform c' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZRJ _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text ;SAP domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HNRL1_HUMAN _struct_ref.pdbx_db_accession Q9BUJ2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAAL _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ZRJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 44 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BUJ2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 37 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 37 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1ZRJ GLY A 1 ? UNP Q9BUJ2 ? ? 'expression tag' -6 1 1 1ZRJ SER A 2 ? UNP Q9BUJ2 ? ? 'expression tag' -5 2 1 1ZRJ SER A 3 ? UNP Q9BUJ2 ? ? 'expression tag' -4 3 1 1ZRJ GLY A 4 ? UNP Q9BUJ2 ? ? 'expression tag' -3 4 1 1ZRJ SER A 5 ? UNP Q9BUJ2 ? ? 'expression tag' -2 5 1 1ZRJ SER A 6 ? UNP Q9BUJ2 ? ? 'expression tag' -1 6 1 1ZRJ GLY A 7 ? UNP Q9BUJ2 ? ? 'expression tag' 0 7 1 1ZRJ SER A 45 ? UNP Q9BUJ2 ? ? 'expression tag' 38 8 1 1ZRJ GLY A 46 ? UNP Q9BUJ2 ? ? 'expression tag' 39 9 1 1ZRJ PRO A 47 ? UNP Q9BUJ2 ? ? 'expression tag' 40 10 1 1ZRJ SER A 48 ? UNP Q9BUJ2 ? ? 'expression tag' 41 11 1 1ZRJ SER A 49 ? UNP Q9BUJ2 ? ? 'expression tag' 42 12 1 1ZRJ GLY A 50 ? UNP Q9BUJ2 ? ? 'expression tag' 43 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 10 ? ARG A 12 ? VAL A 3 ARG A 5 5 ? 3 HELX_P HELX_P2 2 VAL A 15 ? ARG A 24 ? VAL A 8 ARG A 17 1 ? 10 HELX_P HELX_P3 3 LYS A 33 ? LEU A 44 ? LYS A 26 LEU A 37 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A -4 ? ? -55.85 172.99 2 1 SER A -1 ? ? -42.39 163.16 3 1 LYS A 7 ? ? -56.10 176.69 4 1 SER A 38 ? ? -53.63 98.27 5 2 ASP A 2 ? ? -92.35 43.50 6 2 VAL A 3 ? ? -39.16 -30.91 7 2 LYS A 7 ? ? -58.81 173.47 8 2 LEU A 25 ? ? -50.73 175.77 9 2 PRO A 40 ? ? -69.81 91.27 10 3 ASP A 2 ? ? -44.09 106.93 11 3 LYS A 7 ? ? -55.91 173.26 12 3 LEU A 25 ? ? -58.91 170.56 13 4 MET A 1 ? ? -161.71 119.51 14 4 LYS A 7 ? ? -49.15 169.00 15 4 LEU A 25 ? ? -56.47 174.45 16 4 SER A 42 ? ? -48.70 153.32 17 5 LYS A 7 ? ? -47.03 168.90 18 6 PRO A 40 ? ? -69.70 93.61 19 7 MET A 1 ? ? -172.28 114.12 20 9 ASP A 2 ? ? -60.97 97.74 21 10 LEU A 25 ? ? -56.37 174.45 22 10 SER A 41 ? ? -95.52 34.49 23 12 ARG A 5 ? ? -91.88 30.13 24 12 LYS A 7 ? ? -57.42 174.84 25 12 SER A 41 ? ? -160.88 114.45 26 13 LYS A 7 ? ? -50.91 170.28 27 14 LYS A 7 ? ? -54.02 171.46 28 14 SER A 41 ? ? 38.34 42.09 29 14 SER A 42 ? ? -104.59 41.93 30 15 SER A -2 ? ? -57.41 101.96 31 15 LEU A 25 ? ? -59.57 170.40 32 15 SER A 41 ? ? -48.89 104.91 33 16 ASP A 2 ? ? -100.71 78.73 34 17 LYS A 7 ? ? -50.71 172.44 35 18 SER A -5 ? ? -120.48 -57.18 36 18 SER A -2 ? ? -170.14 137.27 37 18 ARG A 5 ? ? -95.76 30.13 38 18 SER A 41 ? ? -37.45 123.79 39 19 LYS A 7 ? ? -49.21 176.30 40 19 PRO A 40 ? ? -69.75 96.19 41 20 ASP A 2 ? ? -68.25 96.01 42 20 ARG A 5 ? ? -84.73 30.17 43 20 LYS A 7 ? ? -59.10 173.64 44 20 LEU A 25 ? ? -48.29 161.98 45 20 SER A 38 ? ? -49.94 104.60 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # _pdbx_nmr_ensemble.entry_id 1ZRJ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1ZRJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0mM 13C/15N-PROTEIN; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_details.entry_id 1ZRJ _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_refine.entry_id 1ZRJ _pdbx_nmr_refine.method 'torsion angle dyanamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9295 'Kobayashi, N.' 4 'data analysis' Olivia 1.10.5 'Yokochi, M.' 5 'structure solution' CYANA 2.0.17 'Guntert, P.' 6 refinement CYANA 2.0.17 'Guntert, P.' 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 LEU N N N N 123 LEU CA C N S 124 LEU C C N N 125 LEU O O N N 126 LEU CB C N N 127 LEU CG C N N 128 LEU CD1 C N N 129 LEU CD2 C N N 130 LEU OXT O N N 131 LEU H H N N 132 LEU H2 H N N 133 LEU HA H N N 134 LEU HB2 H N N 135 LEU HB3 H N N 136 LEU HG H N N 137 LEU HD11 H N N 138 LEU HD12 H N N 139 LEU HD13 H N N 140 LEU HD21 H N N 141 LEU HD22 H N N 142 LEU HD23 H N N 143 LEU HXT H N N 144 LYS N N N N 145 LYS CA C N S 146 LYS C C N N 147 LYS O O N N 148 LYS CB C N N 149 LYS CG C N N 150 LYS CD C N N 151 LYS CE C N N 152 LYS NZ N N N 153 LYS OXT O N N 154 LYS H H N N 155 LYS H2 H N N 156 LYS HA H N N 157 LYS HB2 H N N 158 LYS HB3 H N N 159 LYS HG2 H N N 160 LYS HG3 H N N 161 LYS HD2 H N N 162 LYS HD3 H N N 163 LYS HE2 H N N 164 LYS HE3 H N N 165 LYS HZ1 H N N 166 LYS HZ2 H N N 167 LYS HZ3 H N N 168 LYS HXT H N N 169 MET N N N N 170 MET CA C N S 171 MET C C N N 172 MET O O N N 173 MET CB C N N 174 MET CG C N N 175 MET SD S N N 176 MET CE C N N 177 MET OXT O N N 178 MET H H N N 179 MET H2 H N N 180 MET HA H N N 181 MET HB2 H N N 182 MET HB3 H N N 183 MET HG2 H N N 184 MET HG3 H N N 185 MET HE1 H N N 186 MET HE2 H N N 187 MET HE3 H N N 188 MET HXT H N N 189 PRO N N N N 190 PRO CA C N S 191 PRO C C N N 192 PRO O O N N 193 PRO CB C N N 194 PRO CG C N N 195 PRO CD C N N 196 PRO OXT O N N 197 PRO H H N N 198 PRO HA H N N 199 PRO HB2 H N N 200 PRO HB3 H N N 201 PRO HG2 H N N 202 PRO HG3 H N N 203 PRO HD2 H N N 204 PRO HD3 H N N 205 PRO HXT H N N 206 SER N N N N 207 SER CA C N S 208 SER C C N N 209 SER O O N N 210 SER CB C N N 211 SER OG O N N 212 SER OXT O N N 213 SER H H N N 214 SER H2 H N N 215 SER HA H N N 216 SER HB2 H N N 217 SER HB3 H N N 218 SER HG H N N 219 SER HXT H N N 220 THR N N N N 221 THR CA C N S 222 THR C C N N 223 THR O O N N 224 THR CB C N R 225 THR OG1 O N N 226 THR CG2 C N N 227 THR OXT O N N 228 THR H H N N 229 THR H2 H N N 230 THR HA H N N 231 THR HB H N N 232 THR HG1 H N N 233 THR HG21 H N N 234 THR HG22 H N N 235 THR HG23 H N N 236 THR HXT H N N 237 VAL N N N N 238 VAL CA C N S 239 VAL C C N N 240 VAL O O N N 241 VAL CB C N N 242 VAL CG1 C N N 243 VAL CG2 C N N 244 VAL OXT O N N 245 VAL H H N N 246 VAL H2 H N N 247 VAL HA H N N 248 VAL HB H N N 249 VAL HG11 H N N 250 VAL HG12 H N N 251 VAL HG13 H N N 252 VAL HG21 H N N 253 VAL HG22 H N N 254 VAL HG23 H N N 255 VAL HXT H N N 256 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 LEU N CA sing N N 116 LEU N H sing N N 117 LEU N H2 sing N N 118 LEU CA C sing N N 119 LEU CA CB sing N N 120 LEU CA HA sing N N 121 LEU C O doub N N 122 LEU C OXT sing N N 123 LEU CB CG sing N N 124 LEU CB HB2 sing N N 125 LEU CB HB3 sing N N 126 LEU CG CD1 sing N N 127 LEU CG CD2 sing N N 128 LEU CG HG sing N N 129 LEU CD1 HD11 sing N N 130 LEU CD1 HD12 sing N N 131 LEU CD1 HD13 sing N N 132 LEU CD2 HD21 sing N N 133 LEU CD2 HD22 sing N N 134 LEU CD2 HD23 sing N N 135 LEU OXT HXT sing N N 136 LYS N CA sing N N 137 LYS N H sing N N 138 LYS N H2 sing N N 139 LYS CA C sing N N 140 LYS CA CB sing N N 141 LYS CA HA sing N N 142 LYS C O doub N N 143 LYS C OXT sing N N 144 LYS CB CG sing N N 145 LYS CB HB2 sing N N 146 LYS CB HB3 sing N N 147 LYS CG CD sing N N 148 LYS CG HG2 sing N N 149 LYS CG HG3 sing N N 150 LYS CD CE sing N N 151 LYS CD HD2 sing N N 152 LYS CD HD3 sing N N 153 LYS CE NZ sing N N 154 LYS CE HE2 sing N N 155 LYS CE HE3 sing N N 156 LYS NZ HZ1 sing N N 157 LYS NZ HZ2 sing N N 158 LYS NZ HZ3 sing N N 159 LYS OXT HXT sing N N 160 MET N CA sing N N 161 MET N H sing N N 162 MET N H2 sing N N 163 MET CA C sing N N 164 MET CA CB sing N N 165 MET CA HA sing N N 166 MET C O doub N N 167 MET C OXT sing N N 168 MET CB CG sing N N 169 MET CB HB2 sing N N 170 MET CB HB3 sing N N 171 MET CG SD sing N N 172 MET CG HG2 sing N N 173 MET CG HG3 sing N N 174 MET SD CE sing N N 175 MET CE HE1 sing N N 176 MET CE HE2 sing N N 177 MET CE HE3 sing N N 178 MET OXT HXT sing N N 179 PRO N CA sing N N 180 PRO N CD sing N N 181 PRO N H sing N N 182 PRO CA C sing N N 183 PRO CA CB sing N N 184 PRO CA HA sing N N 185 PRO C O doub N N 186 PRO C OXT sing N N 187 PRO CB CG sing N N 188 PRO CB HB2 sing N N 189 PRO CB HB3 sing N N 190 PRO CG CD sing N N 191 PRO CG HG2 sing N N 192 PRO CG HG3 sing N N 193 PRO CD HD2 sing N N 194 PRO CD HD3 sing N N 195 PRO OXT HXT sing N N 196 SER N CA sing N N 197 SER N H sing N N 198 SER N H2 sing N N 199 SER CA C sing N N 200 SER CA CB sing N N 201 SER CA HA sing N N 202 SER C O doub N N 203 SER C OXT sing N N 204 SER CB OG sing N N 205 SER CB HB2 sing N N 206 SER CB HB3 sing N N 207 SER OG HG sing N N 208 SER OXT HXT sing N N 209 THR N CA sing N N 210 THR N H sing N N 211 THR N H2 sing N N 212 THR CA C sing N N 213 THR CA CB sing N N 214 THR CA HA sing N N 215 THR C O doub N N 216 THR C OXT sing N N 217 THR CB OG1 sing N N 218 THR CB CG2 sing N N 219 THR CB HB sing N N 220 THR OG1 HG1 sing N N 221 THR CG2 HG21 sing N N 222 THR CG2 HG22 sing N N 223 THR CG2 HG23 sing N N 224 THR OXT HXT sing N N 225 VAL N CA sing N N 226 VAL N H sing N N 227 VAL N H2 sing N N 228 VAL CA C sing N N 229 VAL CA CB sing N N 230 VAL CA HA sing N N 231 VAL C O doub N N 232 VAL C OXT sing N N 233 VAL CB CG1 sing N N 234 VAL CB CG2 sing N N 235 VAL CB HB sing N N 236 VAL CG1 HG11 sing N N 237 VAL CG1 HG12 sing N N 238 VAL CG1 HG13 sing N N 239 VAL CG2 HG21 sing N N 240 VAL CG2 HG22 sing N N 241 VAL CG2 HG23 sing N N 242 VAL OXT HXT sing N N 243 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 1ZRJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_