data_1ZWO # _entry.id 1ZWO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ZWO pdb_00001zwo 10.2210/pdb1zwo/pdb RCSB RCSB033204 ? ? WWPDB D_1000033204 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1AMM . unspecified PDB 1HK0 . unspecified PDB 1A7H . unspecified PDB 1A45 . unspecified PDB 1AG4 . unspecified PDB 1A5D . unspecified PDB 1ZWM . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZWO _pdbx_database_status.recvd_initial_deposition_date 2005-06-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, Z.' 1 'Delaglio, F.' 2 'Wyatt, K.' 3 'Wistow, G.' 4 'Bax, A.' 5 # _citation.id primary _citation.title 'Solution structure of (gamma)S-crystallin by molecular fragment replacement NMR.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 14 _citation.page_first 3101 _citation.page_last 3114 _citation.year 2005 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16260758 _citation.pdbx_database_id_DOI 10.1110/ps.051635205 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, Z.' 1 ? primary 'Delaglio, F.' 2 ? primary 'Wyatt, K.' 3 ? primary 'Wistow, G.' 4 ? primary 'Bax, A.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Gamma crystallin S' _entity.formula_weight 20747.271 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Gamma crystallin S' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SKTGGKISFYEDRNFQGRRYDCDCDCADFRSYLSRCNSIRVEGGTWAVYERPNFSGHMYILPQGEYPEYQRWMGLNDRLG SCRAVHLSSGGQAKIQVFEKGDFNGQMYETTEDCPSIMEQFHLREIHSCKVVEGTWIFYELPNYRGRQYLLDKKEYRKPV DWGAASPAIQSFRRIVE ; _entity_poly.pdbx_seq_one_letter_code_can ;SKTGGKISFYEDRNFQGRRYDCDCDCADFRSYLSRCNSIRVEGGTWAVYERPNFSGHMYILPQGEYPEYQRWMGLNDRLG SCRAVHLSSGGQAKIQVFEKGDFNGQMYETTEDCPSIMEQFHLREIHSCKVVEGTWIFYELPNYRGRQYLLDKKEYRKPV DWGAASPAIQSFRRIVE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 THR n 1 4 GLY n 1 5 GLY n 1 6 LYS n 1 7 ILE n 1 8 SER n 1 9 PHE n 1 10 TYR n 1 11 GLU n 1 12 ASP n 1 13 ARG n 1 14 ASN n 1 15 PHE n 1 16 GLN n 1 17 GLY n 1 18 ARG n 1 19 ARG n 1 20 TYR n 1 21 ASP n 1 22 CYS n 1 23 ASP n 1 24 CYS n 1 25 ASP n 1 26 CYS n 1 27 ALA n 1 28 ASP n 1 29 PHE n 1 30 ARG n 1 31 SER n 1 32 TYR n 1 33 LEU n 1 34 SER n 1 35 ARG n 1 36 CYS n 1 37 ASN n 1 38 SER n 1 39 ILE n 1 40 ARG n 1 41 VAL n 1 42 GLU n 1 43 GLY n 1 44 GLY n 1 45 THR n 1 46 TRP n 1 47 ALA n 1 48 VAL n 1 49 TYR n 1 50 GLU n 1 51 ARG n 1 52 PRO n 1 53 ASN n 1 54 PHE n 1 55 SER n 1 56 GLY n 1 57 HIS n 1 58 MET n 1 59 TYR n 1 60 ILE n 1 61 LEU n 1 62 PRO n 1 63 GLN n 1 64 GLY n 1 65 GLU n 1 66 TYR n 1 67 PRO n 1 68 GLU n 1 69 TYR n 1 70 GLN n 1 71 ARG n 1 72 TRP n 1 73 MET n 1 74 GLY n 1 75 LEU n 1 76 ASN n 1 77 ASP n 1 78 ARG n 1 79 LEU n 1 80 GLY n 1 81 SER n 1 82 CYS n 1 83 ARG n 1 84 ALA n 1 85 VAL n 1 86 HIS n 1 87 LEU n 1 88 SER n 1 89 SER n 1 90 GLY n 1 91 GLY n 1 92 GLN n 1 93 ALA n 1 94 LYS n 1 95 ILE n 1 96 GLN n 1 97 VAL n 1 98 PHE n 1 99 GLU n 1 100 LYS n 1 101 GLY n 1 102 ASP n 1 103 PHE n 1 104 ASN n 1 105 GLY n 1 106 GLN n 1 107 MET n 1 108 TYR n 1 109 GLU n 1 110 THR n 1 111 THR n 1 112 GLU n 1 113 ASP n 1 114 CYS n 1 115 PRO n 1 116 SER n 1 117 ILE n 1 118 MET n 1 119 GLU n 1 120 GLN n 1 121 PHE n 1 122 HIS n 1 123 LEU n 1 124 ARG n 1 125 GLU n 1 126 ILE n 1 127 HIS n 1 128 SER n 1 129 CYS n 1 130 LYS n 1 131 VAL n 1 132 VAL n 1 133 GLU n 1 134 GLY n 1 135 THR n 1 136 TRP n 1 137 ILE n 1 138 PHE n 1 139 TYR n 1 140 GLU n 1 141 LEU n 1 142 PRO n 1 143 ASN n 1 144 TYR n 1 145 ARG n 1 146 GLY n 1 147 ARG n 1 148 GLN n 1 149 TYR n 1 150 LEU n 1 151 LEU n 1 152 ASP n 1 153 LYS n 1 154 LYS n 1 155 GLU n 1 156 TYR n 1 157 ARG n 1 158 LYS n 1 159 PRO n 1 160 VAL n 1 161 ASP n 1 162 TRP n 1 163 GLY n 1 164 ALA n 1 165 ALA n 1 166 SER n 1 167 PRO n 1 168 ALA n 1 169 ILE n 1 170 GLN n 1 171 SER n 1 172 PHE n 1 173 ARG n 1 174 ARG n 1 175 ILE n 1 176 VAL n 1 177 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene Crygs _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CRBS_MOUSE _struct_ref.pdbx_db_accession O35486 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SKTGGKISFYEDRNFQGRRYDCDCDCADFRSYLSRCNSIRVEGGTWAVYERPNFSGHMYILPQGEYPEYQRWMGLNDRLG SCRAVHLSSGGQAKIQVFEKGDFNGQMYETTEDCPSIMEQFHLREIHSCKVVEGTWIFYELPNYRGRQYLLDKKEYRKPV DWGAASPAIQSFRRIVE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ZWO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 177 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O35486 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 177 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 177 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '25 mM imidazole, 10 mM KCl, 0.04% NaN3' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;0.7-1.5 mM gS, 25 mM imidazole, pH 6.0, 10 mM KCl, 0.04% NaN3, 25C. Dipolar couplings measured in 2H/15N/13C gammaS, in stretched polyacrylamide gel, and in 3 mg/mL Pf1 (gelled), 120 mM KCl; 90% H2O, 10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'DRX600 with PFG-cryoprobe' _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1ZWO _pdbx_nmr_refine.method 'MFR followed by the simulated annealing' _pdbx_nmr_refine.details ;simulated annealing, including a H-bond potential of mean force, consensus homology-based H-bond restraints list; tight backbone torsion angle restraints are derived from a search through the RCSB for fragments that match experimental dipolar couplings. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1ZWO _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_ensemble.entry_id 1ZWO _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1ZWO _pdbx_nmr_representative.conformer_id 3 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'data analysis' NMRPipe 1.0 'Delaglio, Grzesiek, Zhu, Vuister, Pfeifer, Bax' 1 refinement DYNAMO 3.1 'Delaglio, Kuszewski' 2 refinement XPLOR-NIH 2.9.4 'Brunger, Schwieters, Kuszewski, Tjandra, Clore' 3 # _exptl.entry_id 1ZWO _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1ZWO _struct.title 'NMR structure of murine gamma-S crystallin' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZWO _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text ;alignment, deuteration, liquid crystal, Pf1, relaxation, RDC, residual dipolar coupling, molecular fragment replacement, MFR, Structural Protein ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 68 ? MET A 73 ? GLU A 68 MET A 73 5 ? 6 HELX_P HELX_P2 2 SER A 116 ? HIS A 122 ? SER A 116 HIS A 122 1 ? 7 HELX_P HELX_P3 3 LYS A 158 ? GLY A 163 ? LYS A 158 GLY A 163 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? C ? 4 ? D ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 16 ? CYS A 22 ? GLN A 16 CYS A 22 A 2 LYS A 6 ? ASP A 12 ? LYS A 6 ASP A 12 A 3 SER A 38 ? GLY A 43 ? SER A 38 GLY A 43 A 4 GLY A 64 ? TYR A 66 ? GLY A 64 TYR A 66 B 1 SER A 55 ? LEU A 61 ? SER A 55 LEU A 61 B 2 THR A 45 ? ARG A 51 ? THR A 45 ARG A 51 B 3 SER A 81 ? VAL A 85 ? SER A 81 VAL A 85 C 1 ASN A 104 ? THR A 110 ? ASN A 104 THR A 110 C 2 ILE A 95 ? LYS A 100 ? ILE A 95 LYS A 100 C 3 SER A 128 ? VAL A 131 ? SER A 128 VAL A 131 C 4 LYS A 154 ? TYR A 156 ? LYS A 154 TYR A 156 D 1 ARG A 145 ? LEU A 151 ? ARG A 145 LEU A 151 D 2 THR A 135 ? LEU A 141 ? THR A 135 LEU A 141 D 3 SER A 171 ? ILE A 175 ? SER A 171 ILE A 175 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O CYS A 22 ? O CYS A 22 N ILE A 7 ? N ILE A 7 A 2 3 N SER A 8 ? N SER A 8 O ARG A 40 ? O ARG A 40 A 3 4 N VAL A 41 ? N VAL A 41 O GLY A 64 ? O GLY A 64 B 1 2 O LEU A 61 ? O LEU A 61 N TRP A 46 ? N TRP A 46 B 2 3 N ALA A 47 ? N ALA A 47 O ARG A 83 ? O ARG A 83 C 1 2 O ASN A 104 ? O ASN A 104 N LYS A 100 ? N LYS A 100 C 2 3 N PHE A 98 ? N PHE A 98 O SER A 128 ? O SER A 128 C 3 4 N CYS A 129 ? N CYS A 129 O TYR A 156 ? O TYR A 156 D 1 2 O LEU A 151 ? O LEU A 151 N TRP A 136 ? N TRP A 136 D 2 3 N TYR A 139 ? N TYR A 139 O SER A 171 ? O SER A 171 # _database_PDB_matrix.entry_id 1ZWO _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ZWO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 TRP 72 72 72 TRP TRP A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 CYS 114 114 114 CYS CYS A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 CYS 129 129 129 CYS CYS A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 TRP 136 136 136 TRP TRP A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 TYR 144 144 144 TYR TYR A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 TYR 149 149 149 TYR TYR A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 TYR 156 156 156 TYR TYR A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 TRP 162 162 162 TRP TRP A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 PRO 167 167 167 PRO PRO A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 GLN 170 170 170 GLN GLN A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 PHE 172 172 172 PHE PHE A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 ARG 174 174 174 ARG ARG A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 GLU 177 177 177 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2005-07-05 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD21 A ASN 76 ? ? H A ARG 78 ? ? 1.34 2 2 H A GLY 134 ? ? HZ2 A LYS 153 ? ? 1.28 3 4 H A GLY 134 ? ? HZ3 A LYS 153 ? ? 1.27 4 4 HD21 A ASN 143 ? ? HE A ARG 145 ? ? 1.34 5 7 HH A TYR 69 ? ? HE21 A GLN 70 ? ? 1.34 6 13 HH12 A ARG 13 ? ? HD21 A ASN 37 ? ? 1.33 7 14 HE A ARG 18 ? ? H A ARG 19 ? ? 1.26 8 20 H A PHE 54 ? ? HG A SER 81 ? ? 1.31 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 89 ? ? -105.19 -153.78 2 1 GLU A 133 ? ? 172.65 107.22 3 1 LYS A 153 ? ? -57.85 84.21 4 1 PRO A 167 ? ? -75.83 21.03 5 2 LYS A 2 ? ? -64.91 -86.37 6 2 SER A 89 ? ? -102.85 -155.10 7 2 GLU A 133 ? ? 176.28 108.72 8 2 LYS A 153 ? ? -55.54 86.27 9 2 PRO A 167 ? ? -75.60 20.85 10 3 LYS A 2 ? ? -151.66 -35.71 11 3 GLU A 133 ? ? 173.37 108.32 12 3 PRO A 142 ? ? -54.07 170.61 13 3 LYS A 153 ? ? -53.02 88.32 14 3 PRO A 167 ? ? -75.55 22.11 15 4 SER A 89 ? ? -102.37 -154.79 16 4 GLU A 133 ? ? 176.14 108.83 17 4 LYS A 153 ? ? -57.73 83.99 18 4 PRO A 167 ? ? -75.63 21.21 19 5 THR A 3 ? ? -97.81 40.52 20 5 SER A 89 ? ? -103.02 -154.62 21 5 GLU A 133 ? ? 172.64 108.18 22 5 LYS A 153 ? ? -57.69 83.30 23 5 PRO A 167 ? ? -76.10 21.35 24 6 LYS A 2 ? ? -74.85 -134.06 25 6 GLU A 133 ? ? 173.10 108.94 26 6 LYS A 153 ? ? -55.04 85.43 27 6 PRO A 167 ? ? -76.59 21.74 28 7 GLU A 133 ? ? 172.66 109.04 29 7 LYS A 153 ? ? -57.08 85.59 30 7 PRO A 167 ? ? -75.84 21.54 31 8 LYS A 2 ? ? 54.69 103.87 32 8 SER A 89 ? ? -103.22 -154.49 33 8 GLU A 133 ? ? 172.62 108.75 34 8 LYS A 153 ? ? -57.87 84.06 35 8 PRO A 167 ? ? -76.19 21.67 36 9 LYS A 2 ? ? -66.43 -134.30 37 9 SER A 89 ? ? -103.32 -154.33 38 9 GLU A 133 ? ? 172.39 108.75 39 9 LYS A 153 ? ? -57.18 84.83 40 9 PRO A 167 ? ? -75.80 21.30 41 10 LYS A 2 ? ? 52.40 96.25 42 10 THR A 3 ? ? -98.03 40.71 43 10 SER A 89 ? ? -102.58 -154.91 44 10 GLU A 133 ? ? 176.67 109.67 45 10 LYS A 153 ? ? -58.68 83.94 46 10 PRO A 167 ? ? -76.05 21.31 47 11 GLN A 92 ? ? -120.55 -141.01 48 11 GLU A 133 ? ? 174.13 105.96 49 11 LYS A 153 ? ? -55.74 86.33 50 11 PRO A 167 ? ? -76.15 21.56 51 12 SER A 89 ? ? -103.15 -154.87 52 12 GLU A 133 ? ? 172.14 108.32 53 12 LYS A 153 ? ? -59.30 84.19 54 12 PRO A 167 ? ? -75.70 25.48 55 13 SER A 89 ? ? -103.65 -154.94 56 13 GLU A 133 ? ? 172.51 107.87 57 13 LYS A 153 ? ? -57.12 84.34 58 13 PRO A 167 ? ? -75.43 21.25 59 14 SER A 89 ? ? -103.17 -154.99 60 14 GLU A 133 ? ? 172.95 108.83 61 14 LYS A 153 ? ? -58.72 83.39 62 14 PRO A 167 ? ? -76.09 21.17 63 15 SER A 89 ? ? -103.47 -154.48 64 15 GLU A 133 ? ? 171.35 108.29 65 15 LYS A 153 ? ? 49.37 78.86 66 15 PRO A 167 ? ? -75.22 24.85 67 16 THR A 3 ? ? -89.90 -139.74 68 16 SER A 89 ? ? -103.34 -154.39 69 16 GLU A 133 ? ? 172.68 107.56 70 16 LYS A 153 ? ? -56.53 83.69 71 16 PRO A 167 ? ? -76.19 21.23 72 17 LYS A 2 ? ? -68.40 -112.48 73 17 SER A 89 ? ? -102.96 -154.82 74 17 GLU A 133 ? ? 172.57 108.05 75 17 LYS A 153 ? ? -56.66 85.41 76 17 PRO A 167 ? ? -74.77 21.57 77 18 SER A 89 ? ? -102.66 -154.80 78 18 GLU A 133 ? ? 173.01 108.29 79 18 LYS A 153 ? ? -59.38 83.24 80 18 PRO A 167 ? ? -76.37 21.58 81 19 LYS A 2 ? ? -70.58 -133.51 82 19 SER A 89 ? ? -103.15 -154.54 83 19 GLU A 133 ? ? 172.69 109.04 84 19 LYS A 153 ? ? -57.97 84.05 85 19 PRO A 167 ? ? -76.16 21.55 86 20 THR A 3 ? ? -90.67 -139.88 87 20 GLU A 133 ? ? 172.60 108.30 88 20 LYS A 153 ? ? -57.41 84.07 89 20 PRO A 167 ? ? -75.97 21.72 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 177 ? O ? A GLU 177 O 2 2 Y 1 A GLU 177 ? O ? A GLU 177 O 3 3 Y 1 A GLU 177 ? O ? A GLU 177 O 4 4 Y 1 A GLU 177 ? O ? A GLU 177 O 5 5 Y 1 A GLU 177 ? O ? A GLU 177 O 6 6 Y 1 A GLU 177 ? O ? A GLU 177 O 7 7 Y 1 A GLU 177 ? O ? A GLU 177 O 8 8 Y 1 A GLU 177 ? O ? A GLU 177 O 9 9 Y 1 A GLU 177 ? O ? A GLU 177 O 10 10 Y 1 A GLU 177 ? O ? A GLU 177 O 11 11 Y 1 A GLU 177 ? O ? A GLU 177 O 12 12 Y 1 A GLU 177 ? O ? A GLU 177 O 13 13 Y 1 A GLU 177 ? O ? A GLU 177 O 14 14 Y 1 A GLU 177 ? O ? A GLU 177 O 15 15 Y 1 A GLU 177 ? O ? A GLU 177 O 16 16 Y 1 A GLU 177 ? O ? A GLU 177 O 17 17 Y 1 A GLU 177 ? O ? A GLU 177 O 18 18 Y 1 A GLU 177 ? O ? A GLU 177 O 19 19 Y 1 A GLU 177 ? O ? A GLU 177 O 20 20 Y 1 A GLU 177 ? O ? A GLU 177 O #