data_1ZZF # _entry.id 1ZZF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ZZF pdb_00001zzf 10.2210/pdb1zzf/pdb RCSB RCSB033301 ? ? WWPDB D_1000033301 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1R8P _pdbx_database_related.details 'HPV-16 E2C solution structure' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ZZF _pdbx_database_status.recvd_initial_deposition_date 2005-06-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Eliseo, T.' 1 'Nadra, A.D.' 2 'De Prat-Gay, G.' 3 'Paci, M.' 4 'Cicero, O.D.' 5 # _citation.id primary _citation.title 'The DNA-bound solution structure of HPV-16 E2 DNA-binding domain' _citation.journal_abbrev 'to be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eliseo, T.' 1 ? primary 'Nadra, A.D.' 2 ? primary 'De Prat-Gay, G.' 3 ? primary 'Paci, M.' 4 ? primary 'Cicero, O.D.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Regulatory protein E2' _entity.formula_weight 9398.914 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'DNA-binding domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HPV-16 E2 transcription factor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTPIVHLKGDANTLKCLRYRFKKHCTLYTAVSSTWHWTGHNVKHKSAIVTLTYDSEWQRDQFLSQVKIPKTITVSTGFMS I ; _entity_poly.pdbx_seq_one_letter_code_can ;MTPIVHLKGDANTLKCLRYRFKKHCTLYTAVSSTWHWTGHNVKHKSAIVTLTYDSEWQRDQFLSQVKIPKTITVSTGFMS I ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 PRO n 1 4 ILE n 1 5 VAL n 1 6 HIS n 1 7 LEU n 1 8 LYS n 1 9 GLY n 1 10 ASP n 1 11 ALA n 1 12 ASN n 1 13 THR n 1 14 LEU n 1 15 LYS n 1 16 CYS n 1 17 LEU n 1 18 ARG n 1 19 TYR n 1 20 ARG n 1 21 PHE n 1 22 LYS n 1 23 LYS n 1 24 HIS n 1 25 CYS n 1 26 THR n 1 27 LEU n 1 28 TYR n 1 29 THR n 1 30 ALA n 1 31 VAL n 1 32 SER n 1 33 SER n 1 34 THR n 1 35 TRP n 1 36 HIS n 1 37 TRP n 1 38 THR n 1 39 GLY n 1 40 HIS n 1 41 ASN n 1 42 VAL n 1 43 LYS n 1 44 HIS n 1 45 LYS n 1 46 SER n 1 47 ALA n 1 48 ILE n 1 49 VAL n 1 50 THR n 1 51 LEU n 1 52 THR n 1 53 TYR n 1 54 ASP n 1 55 SER n 1 56 GLU n 1 57 TRP n 1 58 GLN n 1 59 ARG n 1 60 ASP n 1 61 GLN n 1 62 PHE n 1 63 LEU n 1 64 SER n 1 65 GLN n 1 66 VAL n 1 67 LYS n 1 68 ILE n 1 69 PRO n 1 70 LYS n 1 71 THR n 1 72 ILE n 1 73 THR n 1 74 VAL n 1 75 SER n 1 76 THR n 1 77 GLY n 1 78 PHE n 1 79 MET n 1 80 SER n 1 81 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Alphapapillomavirus _entity_src_gen.pdbx_gene_src_gene E2 _entity_src_gen.gene_src_species 'Human papillomavirus - 16' _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human papillomavirus type 16' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 333760 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain JM109 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ptz18U-E2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code VE2_HPV16 _struct_ref.pdbx_db_accession P03120 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 286 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1ZZF A 2 ? 81 ? P03120 286 ? 365 ? 2 81 2 1 1ZZF B 2 ? 81 ? P03120 286 ? 365 ? 2 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1ZZF MET A 1 ? UNP P03120 ? ? 'initiating methionine' 1 1 2 1ZZF MET B 1 ? UNP P03120 ? ? 'initiating methionine' 1 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength '250 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 'DNA-E2C complex (15N) 0.6mM, 25mM Acetate+ 10mM Phosphate, pH 5.6, NaCl 250mM, DTT 5mM' '95% H20, 5% D2O' 2 'DNA-E2C complex (15N, 13C) 0.6mM, 25mM Acetate+ 10mM Phosphate, pH 5.6, NaCl 250mM, DTT 5mM' '95% H20, 5% D2O' 3 'DNA-E2C complex (15N) 0.2mM, 25mM Acetate+ 10mM Phosphate, pH 5.6, NaCl 250mM, DTT 5mM, Philamentosus phage 17mg/ml' '95% H20, 5% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 700 ? 2 AVANCE Bruker 400 ? # _pdbx_nmr_refine.entry_id 1ZZF _pdbx_nmr_refine.method 'refinement by restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1ZZF _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1ZZF _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.0 ? 1 processing NMRPipe ? ? 2 'data analysis' NMRView ? ? 3 refinement X-PLOR ? ? 4 # _exptl.entry_id 1ZZF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ZZF _struct.title 'The DNA-bound solution structure of HPV-16 E2 DNA-binding domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ZZF _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'dna-protein complex, papillomavirus transcription factor, dimeric beta-barrel, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 11 ? LYS A 22 ? ALA A 11 LYS A 22 1 ? 12 HELX_P HELX_P2 2 LYS A 23 ? TYR A 28 ? LYS A 23 TYR A 28 5 ? 6 HELX_P HELX_P3 3 SER A 55 ? SER A 64 ? SER A 55 SER A 64 1 ? 10 HELX_P HELX_P4 4 ALA B 11 ? LYS B 22 ? ALA B 11 LYS B 22 1 ? 12 HELX_P HELX_P5 5 LYS B 23 ? TYR B 28 ? LYS B 23 TYR B 28 5 ? 6 HELX_P HELX_P6 6 SER B 55 ? SER B 64 ? SER B 55 SER B 64 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 30 ? TRP A 35 ? ALA A 30 TRP A 35 A 2 SER A 46 ? THR A 52 ? SER A 46 THR A 52 A 3 THR A 2 ? ASP A 10 ? THR A 2 ASP A 10 A 4 ILE A 72 ? SER A 80 ? ILE A 72 SER A 80 A 5 ILE B 72 ? SER B 80 ? ILE B 72 SER B 80 A 6 THR B 2 ? ASP B 10 ? THR B 2 ASP B 10 A 7 SER B 46 ? THR B 52 ? SER B 46 THR B 52 A 8 ALA B 30 ? TRP B 35 ? ALA B 30 TRP B 35 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TRP A 35 ? N TRP A 35 O ILE A 48 ? O ILE A 48 A 2 3 O LEU A 51 ? O LEU A 51 N VAL A 5 ? N VAL A 5 A 3 4 N LYS A 8 ? N LYS A 8 O THR A 73 ? O THR A 73 A 4 5 N PHE A 78 ? N PHE A 78 O PHE B 78 ? O PHE B 78 A 5 6 O THR B 73 ? O THR B 73 N LYS B 8 ? N LYS B 8 A 6 7 N VAL B 5 ? N VAL B 5 O LEU B 51 ? O LEU B 51 A 7 8 O THR B 50 ? O THR B 50 N SER B 32 ? N SER B 32 # _database_PDB_matrix.entry_id 1ZZF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ZZF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 HIS 36 36 36 HIS HIS A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ILE 81 81 81 ILE ILE A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 THR 2 2 2 THR THR B . n B 1 3 PRO 3 3 3 PRO PRO B . n B 1 4 ILE 4 4 4 ILE ILE B . n B 1 5 VAL 5 5 5 VAL VAL B . n B 1 6 HIS 6 6 6 HIS HIS B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 GLY 9 9 9 GLY GLY B . n B 1 10 ASP 10 10 10 ASP ASP B . n B 1 11 ALA 11 11 11 ALA ALA B . n B 1 12 ASN 12 12 12 ASN ASN B . n B 1 13 THR 13 13 13 THR THR B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 LYS 15 15 15 LYS LYS B . n B 1 16 CYS 16 16 16 CYS CYS B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 ARG 18 18 18 ARG ARG B . n B 1 19 TYR 19 19 19 TYR TYR B . n B 1 20 ARG 20 20 20 ARG ARG B . n B 1 21 PHE 21 21 21 PHE PHE B . n B 1 22 LYS 22 22 22 LYS LYS B . n B 1 23 LYS 23 23 23 LYS LYS B . n B 1 24 HIS 24 24 24 HIS HIS B . n B 1 25 CYS 25 25 25 CYS CYS B . n B 1 26 THR 26 26 26 THR THR B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 TYR 28 28 28 TYR TYR B . n B 1 29 THR 29 29 29 THR THR B . n B 1 30 ALA 30 30 30 ALA ALA B . n B 1 31 VAL 31 31 31 VAL VAL B . n B 1 32 SER 32 32 32 SER SER B . n B 1 33 SER 33 33 33 SER SER B . n B 1 34 THR 34 34 34 THR THR B . n B 1 35 TRP 35 35 35 TRP TRP B . n B 1 36 HIS 36 36 36 HIS HIS B . n B 1 37 TRP 37 37 37 TRP TRP B . n B 1 38 THR 38 38 38 THR THR B . n B 1 39 GLY 39 39 39 GLY GLY B . n B 1 40 HIS 40 40 40 HIS HIS B . n B 1 41 ASN 41 41 41 ASN ASN B . n B 1 42 VAL 42 42 42 VAL VAL B . n B 1 43 LYS 43 43 43 LYS LYS B . n B 1 44 HIS 44 44 44 HIS HIS B . n B 1 45 LYS 45 45 45 LYS LYS B . n B 1 46 SER 46 46 46 SER SER B . n B 1 47 ALA 47 47 47 ALA ALA B . n B 1 48 ILE 48 48 48 ILE ILE B . n B 1 49 VAL 49 49 49 VAL VAL B . n B 1 50 THR 50 50 50 THR THR B . n B 1 51 LEU 51 51 51 LEU LEU B . n B 1 52 THR 52 52 52 THR THR B . n B 1 53 TYR 53 53 53 TYR TYR B . n B 1 54 ASP 54 54 54 ASP ASP B . n B 1 55 SER 55 55 55 SER SER B . n B 1 56 GLU 56 56 56 GLU GLU B . n B 1 57 TRP 57 57 57 TRP TRP B . n B 1 58 GLN 58 58 58 GLN GLN B . n B 1 59 ARG 59 59 59 ARG ARG B . n B 1 60 ASP 60 60 60 ASP ASP B . n B 1 61 GLN 61 61 61 GLN GLN B . n B 1 62 PHE 62 62 62 PHE PHE B . n B 1 63 LEU 63 63 63 LEU LEU B . n B 1 64 SER 64 64 64 SER SER B . n B 1 65 GLN 65 65 65 GLN GLN B . n B 1 66 VAL 66 66 66 VAL VAL B . n B 1 67 LYS 67 67 67 LYS LYS B . n B 1 68 ILE 68 68 68 ILE ILE B . n B 1 69 PRO 69 69 69 PRO PRO B . n B 1 70 LYS 70 70 70 LYS LYS B . n B 1 71 THR 71 71 71 THR THR B . n B 1 72 ILE 72 72 72 ILE ILE B . n B 1 73 THR 73 73 73 THR THR B . n B 1 74 VAL 74 74 74 VAL VAL B . n B 1 75 SER 75 75 75 SER SER B . n B 1 76 THR 76 76 76 THR THR B . n B 1 77 GLY 77 77 77 GLY GLY B . n B 1 78 PHE 78 78 78 PHE PHE B . n B 1 79 MET 79 79 79 MET MET B . n B 1 80 SER 80 80 80 SER SER B . n B 1 81 ILE 81 81 81 ILE ILE B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-03-14 2 'Structure model' 1 1 2008-04-30 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 24 ? ? -92.21 50.62 2 1 SER A 33 ? ? -75.37 -161.63 3 1 VAL A 42 ? ? 51.52 91.39 4 1 HIS A 44 ? ? -140.95 14.29 5 1 HIS B 24 ? ? -92.24 50.64 6 1 SER B 33 ? ? -75.37 -161.69 7 1 VAL B 42 ? ? 51.49 91.38 8 1 HIS B 44 ? ? -140.87 14.14 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 18 ? ? 0.249 'SIDE CHAIN' 2 1 ARG A 20 ? ? 0.299 'SIDE CHAIN' 3 1 ARG A 59 ? ? 0.307 'SIDE CHAIN' 4 1 ARG B 18 ? ? 0.249 'SIDE CHAIN' 5 1 ARG B 20 ? ? 0.299 'SIDE CHAIN' 6 1 ARG B 59 ? ? 0.307 'SIDE CHAIN' #