data_1A2I # _entry.id 1A2I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1A2I pdb_00001a2i 10.2210/pdb1a2i/pdb WWPDB D_1000170311 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1A2I _pdbx_database_status.recvd_initial_deposition_date 1998-01-05 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Messias, A.C.' 1 'Kastrau, D.H.K.' 2 'Costa, H.S.' 3 'Legall, J.' 4 'Turner, D.L.' 5 'Santos, H.' 6 'Xavier, A.V.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of Desulfovibrio vulgaris (Hildenborough) ferrocytochrome c3: structural basis for functional cooperativity.' J.Mol.Biol. 281 719 739 1998 JMOBAK UK 0022-2836 0070 ? 9710542 10.1006/jmbi.1998.1974 1 ;Refinement of the Three-Dimensional Structures of Cytochromes C3 from Desulfovibrio Vulgaris Hildenborough at 1.67 A Resolution and from Desulfovibrio Desulfuricans Atcc27774 at 1.6 A Resolution ; 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 2 ;Redox-Bohr Effect in Electron/Proton Energy Transduction: Cytochrome C3 Coupled to Hydrogenase Works as a 'Proton Thruster' in Desulfovibrio Vulgaris ; J.Biol.Inorg.Chem. 2 488 ? 1997 JJBCFA GW 0949-8257 2154 ? ? ? 3 'NMR Studies of Cooperativity in the Tetrahaem Cytochrome C3 from Desulfovibrio Vulgaris' Eur.J.Biochem. 241 723 ? 1996 EJBCAI IX 0014-2956 0262 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Messias, A.C.' 1 ? primary 'Kastrau, D.H.' 2 ? primary 'Costa, H.S.' 3 ? primary 'LeGall, J.' 4 ? primary 'Turner, D.L.' 5 ? primary 'Santos, H.' 6 ? primary 'Xavier, A.V.' 7 ? 1 'Simoes, P.' 8 ? 1 'Matias, P.M.' 9 ? 1 'Morais, J.' 10 ? 1 'Wilson, K.' 11 ? 1 'Dauter, Z.' 12 ? 1 'Carrondo, M.A.' 13 ? 2 'Louro, R.O.' 14 ? 2 'Catarino, T.' 15 ? 2 'Legall, J.' 16 ? 2 'Xavier, A.V.' 17 ? 3 'Turner, D.L.' 18 ? 3 'Salgueiro, C.A.' 19 ? 3 'Catarino, T.' 20 ? 3 'Legall, J.' 21 ? 3 'Xavier, A.V.' 22 ? # _cell.entry_id 1A2I _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1A2I _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'CYTOCHROME C3' 11687.463 1 ? ? ? 'CLASS III OF C-TYPE CYTOCHROMES, FULLY REDUCED FORM' 2 non-polymer syn 'HEME C' 618.503 4 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TETRAHEME CYTOCHROME' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;APKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDKKDKSAKGYYHVMHDKNTKFKSCV GCHVEVAGADAAKKKDLTGCKKSKCHE ; _entity_poly.pdbx_seq_one_letter_code_can ;APKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDKKDKSAKGYYHVMHDKNTKFKSCV GCHVEVAGADAAKKKDLTGCKKSKCHE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PRO n 1 3 LYS n 1 4 ALA n 1 5 PRO n 1 6 ALA n 1 7 ASP n 1 8 GLY n 1 9 LEU n 1 10 LYS n 1 11 MET n 1 12 GLU n 1 13 ALA n 1 14 THR n 1 15 LYS n 1 16 GLN n 1 17 PRO n 1 18 VAL n 1 19 VAL n 1 20 PHE n 1 21 ASN n 1 22 HIS n 1 23 SER n 1 24 THR n 1 25 HIS n 1 26 LYS n 1 27 SER n 1 28 VAL n 1 29 LYS n 1 30 CYS n 1 31 GLY n 1 32 ASP n 1 33 CYS n 1 34 HIS n 1 35 HIS n 1 36 PRO n 1 37 VAL n 1 38 ASN n 1 39 GLY n 1 40 LYS n 1 41 GLU n 1 42 ASP n 1 43 TYR n 1 44 ARG n 1 45 LYS n 1 46 CYS n 1 47 GLY n 1 48 THR n 1 49 ALA n 1 50 GLY n 1 51 CYS n 1 52 HIS n 1 53 ASP n 1 54 SER n 1 55 MET n 1 56 ASP n 1 57 LYS n 1 58 LYS n 1 59 ASP n 1 60 LYS n 1 61 SER n 1 62 ALA n 1 63 LYS n 1 64 GLY n 1 65 TYR n 1 66 TYR n 1 67 HIS n 1 68 VAL n 1 69 MET n 1 70 HIS n 1 71 ASP n 1 72 LYS n 1 73 ASN n 1 74 THR n 1 75 LYS n 1 76 PHE n 1 77 LYS n 1 78 SER n 1 79 CYS n 1 80 VAL n 1 81 GLY n 1 82 CYS n 1 83 HIS n 1 84 VAL n 1 85 GLU n 1 86 VAL n 1 87 ALA n 1 88 GLY n 1 89 ALA n 1 90 ASP n 1 91 ALA n 1 92 ALA n 1 93 LYS n 1 94 LYS n 1 95 LYS n 1 96 ASP n 1 97 LEU n 1 98 THR n 1 99 GLY n 1 100 CYS n 1 101 LYS n 1 102 LYS n 1 103 SER n 1 104 LYS n 1 105 CYS n 1 106 HIS n 1 107 GLU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough' _entity_src_nat.pdbx_ncbi_taxonomy_id 882 _entity_src_nat.genus Desulfovibrio _entity_src_nat.species 'Desulfovibrio vulgaris' _entity_src_nat.strain HILDENBOROUGH _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location PERIPLASM _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYC3_DESVH _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00131 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MRKLFFCGVLALAVAFALPVVAAPKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDKK DKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGCKKSKCHE ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1A2I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 107 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00131 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 129 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 107 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '2D-1H-NOESY 2D-1H-TOCSY 2D-1H-COSY' _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 8.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1A2I _pdbx_nmr_refine.method 'RESTRAINED MOLECULAR DYNAMICS WITH SIMULATED ANNEALING' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1A2I _pdbx_nmr_ensemble.conformers_calculated_total_number 600 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DYANA 1.4 GUNTERT,WUTHRICH 1 'structure solution' DYANA ? ? 2 # _exptl.entry_id 1A2I _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1A2I _struct.title 'SOLUTION STRUCTURE OF DESULFOVIBRIO VULGARIS (HILDENBOROUGH) FERROCYTOCHROME C3, NMR, 20 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1A2I _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'ELECTRON TRANSPORT, HEMEPROTEIN, ELECTRON TRANSFER, REDOX-BOHR EFFECT, COOPERATIVITY, ENERGY TRANSDUCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 29 ? HIS A 34 ? LYS A 29 HIS A 34 1 ? 6 HELX_P HELX_P2 2 GLY A 64 ? VAL A 68 ? GLY A 64 VAL A 68 5 ? 5 HELX_P HELX_P3 3 SER A 78 ? GLY A 88 ? SER A 78 GLY A 88 1 ? 11 HELX_P HELX_P4 4 ALA A 92 ? LYS A 94 ? ALA A 92 LYS A 94 1 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 30 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 30 A HEC 108 1_555 ? ? ? ? ? ? ? 1.850 ? ? covale2 covale none ? A CYS 33 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 33 A HEC 108 1_555 ? ? ? ? ? ? ? 1.810 ? ? covale3 covale none ? A CYS 46 SG ? ? ? 1_555 C HEC . CAB ? ? A CYS 46 A HEC 109 1_555 ? ? ? ? ? ? ? 1.825 ? ? covale4 covale none ? A CYS 51 SG ? ? ? 1_555 C HEC . CAC ? ? A CYS 51 A HEC 109 1_555 ? ? ? ? ? ? ? 1.810 ? ? covale5 covale none ? A CYS 79 SG ? ? ? 1_555 D HEC . CAB ? ? A CYS 79 A HEC 110 1_555 ? ? ? ? ? ? ? 1.847 ? ? covale6 covale none ? A CYS 82 SG ? ? ? 1_555 D HEC . CAC ? ? A CYS 82 A HEC 110 1_555 ? ? ? ? ? ? ? 1.810 ? ? covale7 covale none ? A CYS 100 SG ? ? ? 1_555 E HEC . CAB ? ? A CYS 100 A HEC 111 1_555 ? ? ? ? ? ? ? 1.866 ? ? covale8 covale none ? A CYS 105 SG ? ? ? 1_555 E HEC . CAC ? ? A CYS 105 A HEC 111 1_555 ? ? ? ? ? ? ? 1.809 ? ? metalc1 metalc ? ? A HIS 22 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 22 A HEC 108 1_555 ? ? ? ? ? ? ? 1.934 ? ? metalc2 metalc ? ? A HIS 25 NE2 ? ? ? 1_555 D HEC . FE ? ? A HIS 25 A HEC 110 1_555 ? ? ? ? ? ? ? 1.905 ? ? metalc3 metalc ? ? A HIS 34 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 34 A HEC 108 1_555 ? ? ? ? ? ? ? 1.936 ? ? metalc4 metalc ? ? A HIS 35 NE2 ? ? ? 1_555 C HEC . FE ? ? A HIS 35 A HEC 109 1_555 ? ? ? ? ? ? ? 1.927 ? ? metalc5 metalc ? ? A HIS 52 NE2 ? ? ? 1_555 C HEC . FE ? ? A HIS 52 A HEC 109 1_555 ? ? ? ? ? ? ? 1.929 ? ? metalc6 metalc ? ? A HIS 70 NE2 ? ? ? 1_555 E HEC . FE ? ? A HIS 70 A HEC 111 1_555 ? ? ? ? ? ? ? 1.919 ? ? metalc7 metalc ? ? A HIS 83 NE2 ? ? ? 1_555 D HEC . FE ? ? A HIS 83 A HEC 110 1_555 ? ? ? ? ? ? ? 1.943 ? ? metalc8 metalc ? ? A HIS 106 NE2 ? ? ? 1_555 E HEC . FE ? ? A HIS 106 A HEC 111 1_555 ? ? ? ? ? ? ? 1.933 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 9 ? MET A 11 ? LEU A 9 MET A 11 A 2 VAL A 18 ? PHE A 20 ? VAL A 18 PHE A 20 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 9 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 9 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 20 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 20 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A HEC 108 ? 19 'BINDING SITE FOR RESIDUE HEC A 108' AC2 Software A HEC 109 ? 15 'BINDING SITE FOR RESIDUE HEC A 109' AC3 Software A HEC 110 ? 13 'BINDING SITE FOR RESIDUE HEC A 110' AC4 Software A HEC 111 ? 16 'BINDING SITE FOR RESIDUE HEC A 111' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 19 LYS A 3 ? LYS A 3 . ? 1_555 ? 2 AC1 19 ALA A 4 ? ALA A 4 . ? 1_555 ? 3 AC1 19 PRO A 5 ? PRO A 5 . ? 1_555 ? 4 AC1 19 LEU A 9 ? LEU A 9 . ? 1_555 ? 5 AC1 19 MET A 11 ? MET A 11 . ? 1_555 ? 6 AC1 19 PHE A 20 ? PHE A 20 . ? 1_555 ? 7 AC1 19 HIS A 22 ? HIS A 22 . ? 1_555 ? 8 AC1 19 HIS A 25 ? HIS A 25 . ? 1_555 ? 9 AC1 19 VAL A 28 ? VAL A 28 . ? 1_555 ? 10 AC1 19 LYS A 29 ? LYS A 29 . ? 1_555 ? 11 AC1 19 CYS A 30 ? CYS A 30 . ? 1_555 ? 12 AC1 19 CYS A 33 ? CYS A 33 . ? 1_555 ? 13 AC1 19 HIS A 34 ? HIS A 34 . ? 1_555 ? 14 AC1 19 TYR A 43 ? TYR A 43 . ? 1_555 ? 15 AC1 19 ARG A 44 ? ARG A 44 . ? 1_555 ? 16 AC1 19 LYS A 45 ? LYS A 45 . ? 1_555 ? 17 AC1 19 CYS A 46 ? CYS A 46 . ? 1_555 ? 18 AC1 19 HEC C . ? HEC A 109 . ? 1_555 ? 19 AC1 19 HEC D . ? HEC A 110 . ? 1_555 ? 20 AC2 15 CYS A 33 ? CYS A 33 . ? 1_555 ? 21 AC2 15 HIS A 35 ? HIS A 35 . ? 1_555 ? 22 AC2 15 LYS A 45 ? LYS A 45 . ? 1_555 ? 23 AC2 15 CYS A 46 ? CYS A 46 . ? 1_555 ? 24 AC2 15 CYS A 51 ? CYS A 51 . ? 1_555 ? 25 AC2 15 HIS A 52 ? HIS A 52 . ? 1_555 ? 26 AC2 15 SER A 61 ? SER A 61 . ? 1_555 ? 27 AC2 15 ALA A 62 ? ALA A 62 . ? 1_555 ? 28 AC2 15 HIS A 67 ? HIS A 67 . ? 1_555 ? 29 AC2 15 VAL A 68 ? VAL A 68 . ? 1_555 ? 30 AC2 15 ASN A 73 ? ASN A 73 . ? 1_555 ? 31 AC2 15 THR A 74 ? THR A 74 . ? 1_555 ? 32 AC2 15 LYS A 75 ? LYS A 75 . ? 1_555 ? 33 AC2 15 PHE A 76 ? PHE A 76 . ? 1_555 ? 34 AC2 15 HEC B . ? HEC A 108 . ? 1_555 ? 35 AC3 13 PHE A 20 ? PHE A 20 . ? 1_555 ? 36 AC3 13 THR A 24 ? THR A 24 . ? 1_555 ? 37 AC3 13 HIS A 25 ? HIS A 25 . ? 1_555 ? 38 AC3 13 ASP A 32 ? ASP A 32 . ? 1_555 ? 39 AC3 13 CYS A 33 ? CYS A 33 . ? 1_555 ? 40 AC3 13 LYS A 77 ? LYS A 77 . ? 1_555 ? 41 AC3 13 CYS A 79 ? CYS A 79 . ? 1_555 ? 42 AC3 13 CYS A 82 ? CYS A 82 . ? 1_555 ? 43 AC3 13 HIS A 83 ? HIS A 83 . ? 1_555 ? 44 AC3 13 VAL A 86 ? VAL A 86 . ? 1_555 ? 45 AC3 13 LEU A 97 ? LEU A 97 . ? 1_555 ? 46 AC3 13 LYS A 104 ? LYS A 104 . ? 1_555 ? 47 AC3 13 HEC B . ? HEC A 108 . ? 1_555 ? 48 AC4 16 MET A 11 ? MET A 11 . ? 1_555 ? 49 AC4 16 ALA A 13 ? ALA A 13 . ? 1_555 ? 50 AC4 16 THR A 14 ? THR A 14 . ? 1_555 ? 51 AC4 16 GLN A 16 ? GLN A 16 . ? 1_555 ? 52 AC4 16 VAL A 18 ? VAL A 18 . ? 1_555 ? 53 AC4 16 TYR A 65 ? TYR A 65 . ? 1_555 ? 54 AC4 16 TYR A 66 ? TYR A 66 . ? 1_555 ? 55 AC4 16 HIS A 70 ? HIS A 70 . ? 1_555 ? 56 AC4 16 VAL A 80 ? VAL A 80 . ? 1_555 ? 57 AC4 16 HIS A 83 ? HIS A 83 . ? 1_555 ? 58 AC4 16 LEU A 97 ? LEU A 97 . ? 1_555 ? 59 AC4 16 THR A 98 ? THR A 98 . ? 1_555 ? 60 AC4 16 GLY A 99 ? GLY A 99 . ? 1_555 ? 61 AC4 16 CYS A 100 ? CYS A 100 . ? 1_555 ? 62 AC4 16 CYS A 105 ? CYS A 105 . ? 1_555 ? 63 AC4 16 HIS A 106 ? HIS A 106 . ? 1_555 ? # _database_PDB_matrix.entry_id 1A2I _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1A2I _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 CYS 100 100 100 CYS CYS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 GLU 107 107 107 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEC 1 108 108 HEC HEC A . C 2 HEC 1 109 109 HEC HEC A . D 2 HEC 1 110 110 HEC HEC A . E 2 HEC 1 111 111 HEC HEC A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 NA ? B HEC . ? A HEC 108 ? 1_555 90.5 ? 2 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 NB ? B HEC . ? A HEC 108 ? 1_555 90.2 ? 3 NA ? B HEC . ? A HEC 108 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 NB ? B HEC . ? A HEC 108 ? 1_555 89.8 ? 4 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 NC ? B HEC . ? A HEC 108 ? 1_555 89.0 ? 5 NA ? B HEC . ? A HEC 108 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 NC ? B HEC . ? A HEC 108 ? 1_555 179.4 ? 6 NB ? B HEC . ? A HEC 108 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 NC ? B HEC . ? A HEC 108 ? 1_555 90.4 ? 7 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 ND ? B HEC . ? A HEC 108 ? 1_555 90.4 ? 8 NA ? B HEC . ? A HEC 108 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 ND ? B HEC . ? A HEC 108 ? 1_555 90.1 ? 9 NB ? B HEC . ? A HEC 108 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 ND ? B HEC . ? A HEC 108 ? 1_555 179.4 ? 10 NC ? B HEC . ? A HEC 108 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 ND ? B HEC . ? A HEC 108 ? 1_555 89.7 ? 11 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 179.7 ? 12 NA ? B HEC . ? A HEC 108 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 89.6 ? 13 NB ? B HEC . ? A HEC 108 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 90.2 ? 14 NC ? B HEC . ? A HEC 108 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 91.0 ? 15 ND ? B HEC . ? A HEC 108 ? 1_555 FE ? B HEC . ? A HEC 108 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 89.2 ? 16 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 NA ? D HEC . ? A HEC 110 ? 1_555 91.4 ? 17 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 NB ? D HEC . ? A HEC 110 ? 1_555 91.8 ? 18 NA ? D HEC . ? A HEC 110 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 NB ? D HEC . ? A HEC 110 ? 1_555 89.8 ? 19 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 NC ? D HEC . ? A HEC 110 ? 1_555 89.3 ? 20 NA ? D HEC . ? A HEC 110 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 NC ? D HEC . ? A HEC 110 ? 1_555 179.2 ? 21 NB ? D HEC . ? A HEC 110 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 NC ? D HEC . ? A HEC 110 ? 1_555 90.2 ? 22 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 ND ? D HEC . ? A HEC 110 ? 1_555 87.4 ? 23 NA ? D HEC . ? A HEC 110 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 ND ? D HEC . ? A HEC 110 ? 1_555 90.0 ? 24 NB ? D HEC . ? A HEC 110 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 ND ? D HEC . ? A HEC 110 ? 1_555 179.2 ? 25 NC ? D HEC . ? A HEC 110 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 ND ? D HEC . ? A HEC 110 ? 1_555 89.9 ? 26 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 177.8 ? 27 NA ? D HEC . ? A HEC 110 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 88.7 ? 28 NB ? D HEC . ? A HEC 110 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 90.4 ? 29 NC ? D HEC . ? A HEC 110 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 90.6 ? 30 ND ? D HEC . ? A HEC 110 ? 1_555 FE ? D HEC . ? A HEC 110 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 90.4 ? 31 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 NA ? C HEC . ? A HEC 109 ? 1_555 90.6 ? 32 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 NB ? C HEC . ? A HEC 109 ? 1_555 90.4 ? 33 NA ? C HEC . ? A HEC 109 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 NB ? C HEC . ? A HEC 109 ? 1_555 89.6 ? 34 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 NC ? C HEC . ? A HEC 109 ? 1_555 88.3 ? 35 NA ? C HEC . ? A HEC 109 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 NC ? C HEC . ? A HEC 109 ? 1_555 178.8 ? 36 NB ? C HEC . ? A HEC 109 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 NC ? C HEC . ? A HEC 109 ? 1_555 90.9 ? 37 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 ND ? C HEC . ? A HEC 109 ? 1_555 90.7 ? 38 NA ? C HEC . ? A HEC 109 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 ND ? C HEC . ? A HEC 109 ? 1_555 90.1 ? 39 NB ? C HEC . ? A HEC 109 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 ND ? C HEC . ? A HEC 109 ? 1_555 178.8 ? 40 NC ? C HEC . ? A HEC 109 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 ND ? C HEC . ? A HEC 109 ? 1_555 89.5 ? 41 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 178.5 ? 42 NA ? C HEC . ? A HEC 109 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 90.7 ? 43 NB ? C HEC . ? A HEC 109 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 90.3 ? 44 NC ? C HEC . ? A HEC 109 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 90.4 ? 45 ND ? C HEC . ? A HEC 109 ? 1_555 FE ? C HEC . ? A HEC 109 ? 1_555 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 88.6 ? 46 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 NA ? E HEC . ? A HEC 111 ? 1_555 91.4 ? 47 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 NB ? E HEC . ? A HEC 111 ? 1_555 90.4 ? 48 NA ? E HEC . ? A HEC 111 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 NB ? E HEC . ? A HEC 111 ? 1_555 90.1 ? 49 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 NC ? E HEC . ? A HEC 111 ? 1_555 87.2 ? 50 NA ? E HEC . ? A HEC 111 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 NC ? E HEC . ? A HEC 111 ? 1_555 178.6 ? 51 NB ? E HEC . ? A HEC 111 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 NC ? E HEC . ? A HEC 111 ? 1_555 90.3 ? 52 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 ND ? E HEC . ? A HEC 111 ? 1_555 90.9 ? 53 NA ? E HEC . ? A HEC 111 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 ND ? E HEC . ? A HEC 111 ? 1_555 89.8 ? 54 NB ? E HEC . ? A HEC 111 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 ND ? E HEC . ? A HEC 111 ? 1_555 178.7 ? 55 NC ? E HEC . ? A HEC 111 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 ND ? E HEC . ? A HEC 111 ? 1_555 89.9 ? 56 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 NE2 ? A HIS 106 ? A HIS 106 ? 1_555 177.6 ? 57 NA ? E HEC . ? A HEC 111 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 NE2 ? A HIS 106 ? A HIS 106 ? 1_555 90.9 ? 58 NB ? E HEC . ? A HEC 111 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 NE2 ? A HIS 106 ? A HIS 106 ? 1_555 90.0 ? 59 NC ? E HEC . ? A HEC 111 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 NE2 ? A HIS 106 ? A HIS 106 ? 1_555 90.4 ? 60 ND ? E HEC . ? A HEC 111 ? 1_555 FE ? E HEC . ? A HEC 111 ? 1_555 NE2 ? A HIS 106 ? A HIS 106 ? 1_555 88.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-07-08 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_conn_type 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.value' 13 4 'Structure model' '_struct_conn.conn_type_id' 14 4 'Structure model' '_struct_conn.id' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 29 4 'Structure model' '_struct_conn_type.id' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DYANA 'model building' . ? 1 DYANA refinement . ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG1 A THR 14 ? ? O1D A HEC 111 ? ? 1.44 2 1 O A HIS 83 ? ? H A ALA 87 ? ? 1.50 3 1 O A VAL 80 ? ? H A VAL 84 ? ? 1.56 4 2 HG1 A THR 14 ? ? O2D A HEC 111 ? ? 1.43 5 2 O A HIS 83 ? ? H A ALA 87 ? ? 1.50 6 2 O A SER 78 ? ? H A CYS 82 ? ? 1.56 7 2 O A VAL 80 ? ? H A VAL 84 ? ? 1.56 8 2 HH A TYR 65 ? ? O1D A HEC 111 ? ? 1.56 9 3 HG1 A THR 14 ? ? O1D A HEC 111 ? ? 1.48 10 3 O A HIS 83 ? ? H A ALA 87 ? ? 1.50 11 3 O A VAL 80 ? ? H A VAL 84 ? ? 1.53 12 3 H A LYS 75 ? ? O2A A HEC 109 ? ? 1.55 13 3 O A SER 78 ? ? H A CYS 82 ? ? 1.58 14 4 O A HIS 83 ? ? H A ALA 87 ? ? 1.47 15 4 O A LYS 93 ? ? H A LEU 97 ? ? 1.48 16 4 O A VAL 80 ? ? H A VAL 84 ? ? 1.54 17 4 H A SER 103 ? ? O A HIS 106 ? ? 1.55 18 4 O A ASP 90 ? ? H A LYS 94 ? ? 1.55 19 4 O A SER 78 ? ? H A CYS 82 ? ? 1.57 20 5 HG1 A THR 14 ? ? O1D A HEC 111 ? ? 1.45 21 5 O A HIS 83 ? ? H A ALA 87 ? ? 1.51 22 5 H A SER 103 ? ? O A HIS 106 ? ? 1.55 23 5 O A VAL 80 ? ? H A VAL 84 ? ? 1.57 24 5 O A SER 78 ? ? H A CYS 82 ? ? 1.59 25 5 O A GLY 64 ? ? H A HIS 67 ? ? 1.60 26 6 HG1 A THR 14 ? ? O1D A HEC 111 ? ? 1.46 27 6 O A VAL 80 ? ? H A VAL 84 ? ? 1.46 28 6 O A HIS 83 ? ? H A ALA 87 ? ? 1.48 29 6 O A ASP 90 ? ? H A LYS 94 ? ? 1.55 30 6 HG1 A THR 74 ? ? O A PHE 76 ? ? 1.58 31 7 HG1 A THR 74 ? ? O A PHE 76 ? ? 1.49 32 7 O A LYS 93 ? ? H A LEU 97 ? ? 1.51 33 7 O A HIS 83 ? ? H A ALA 87 ? ? 1.53 34 7 O A VAL 80 ? ? H A VAL 84 ? ? 1.55 35 7 H A SER 103 ? ? O A HIS 106 ? ? 1.55 36 7 O A GLY 64 ? ? H A HIS 67 ? ? 1.56 37 7 HD1 A HIS 83 ? ? O A LEU 97 ? ? 1.58 38 8 HG1 A THR 14 ? ? O2D A HEC 111 ? ? 1.43 39 8 O A HIS 83 ? ? H A ALA 87 ? ? 1.51 40 8 O A SER 78 ? ? H A CYS 82 ? ? 1.57 41 8 O A VAL 80 ? ? H A VAL 84 ? ? 1.59 42 9 HG1 A THR 14 ? ? O2D A HEC 111 ? ? 1.45 43 9 HG1 A THR 74 ? ? O A PHE 76 ? ? 1.47 44 9 O A HIS 83 ? ? H A ALA 87 ? ? 1.51 45 9 O A VAL 80 ? ? H A VAL 84 ? ? 1.56 46 9 H A LYS 75 ? ? O2A A HEC 109 ? ? 1.56 47 9 O A ASP 90 ? ? H A LYS 94 ? ? 1.56 48 9 O A SER 78 ? ? H A CYS 82 ? ? 1.58 49 10 O A LYS 93 ? ? H A LEU 97 ? ? 1.48 50 10 O A HIS 83 ? ? H A ALA 87 ? ? 1.49 51 10 O A VAL 80 ? ? H A VAL 84 ? ? 1.53 52 10 HG1 A THR 74 ? ? O A PHE 76 ? ? 1.54 53 10 O A SER 78 ? ? H A CYS 82 ? ? 1.55 54 10 O A ASP 90 ? ? H A LYS 94 ? ? 1.57 55 10 HD1 A HIS 83 ? ? O A LEU 97 ? ? 1.57 56 10 O A GLY 64 ? ? H A HIS 67 ? ? 1.59 57 11 O A HIS 83 ? ? H A ALA 87 ? ? 1.49 58 11 H A LYS 75 ? ? O1A A HEC 109 ? ? 1.52 59 11 O A SER 78 ? ? H A CYS 82 ? ? 1.53 60 11 O A VAL 80 ? ? H A VAL 84 ? ? 1.55 61 12 O A LYS 93 ? ? H A LEU 97 ? ? 1.47 62 12 O A HIS 83 ? ? H A ALA 87 ? ? 1.50 63 12 O A ASP 90 ? ? H A LYS 94 ? ? 1.54 64 12 O A ASP 71 ? ? HG A SER 78 ? ? 1.54 65 12 O A SER 78 ? ? H A CYS 82 ? ? 1.55 66 12 O A VAL 80 ? ? H A VAL 84 ? ? 1.55 67 12 HD1 A HIS 83 ? ? O A LEU 97 ? ? 1.57 68 13 O A HIS 83 ? ? H A ALA 87 ? ? 1.51 69 13 H A SER 103 ? ? O A HIS 106 ? ? 1.56 70 13 O A VAL 80 ? ? H A VAL 84 ? ? 1.57 71 13 O A SER 78 ? ? H A CYS 82 ? ? 1.57 72 14 O A HIS 83 ? ? H A ALA 87 ? ? 1.50 73 14 O A VAL 80 ? ? H A VAL 84 ? ? 1.55 74 14 O A SER 78 ? ? H A CYS 82 ? ? 1.56 75 14 O A GLY 64 ? ? H A HIS 67 ? ? 1.58 76 15 HG1 A THR 14 ? ? O2D A HEC 111 ? ? 1.45 77 15 HG1 A THR 74 ? ? O A PHE 76 ? ? 1.49 78 15 O A HIS 83 ? ? H A ALA 87 ? ? 1.50 79 15 O A SER 78 ? ? H A CYS 82 ? ? 1.54 80 15 O A VAL 80 ? ? H A VAL 84 ? ? 1.56 81 15 H A SER 103 ? ? O A HIS 106 ? ? 1.57 82 15 O A LYS 93 ? ? H A LEU 97 ? ? 1.60 83 16 HG1 A THR 14 ? ? O2D A HEC 111 ? ? 1.49 84 16 O A HIS 83 ? ? H A ALA 87 ? ? 1.50 85 16 O A VAL 80 ? ? H A VAL 84 ? ? 1.54 86 16 H A SER 103 ? ? O A HIS 106 ? ? 1.55 87 16 H A MET 11 ? ? O A VAL 18 ? ? 1.57 88 16 O A ASP 90 ? ? H A LYS 94 ? ? 1.57 89 16 O A SER 78 ? ? H A CYS 82 ? ? 1.59 90 17 O A HIS 83 ? ? H A ALA 87 ? ? 1.49 91 17 O A VAL 80 ? ? H A VAL 84 ? ? 1.53 92 17 HG1 A THR 74 ? ? O A PHE 76 ? ? 1.54 93 17 H A LYS 75 ? ? O2A A HEC 109 ? ? 1.59 94 18 HG1 A THR 14 ? ? O2D A HEC 111 ? ? 1.43 95 18 O A HIS 83 ? ? H A ALA 87 ? ? 1.53 96 18 O A SER 78 ? ? H A CYS 82 ? ? 1.55 97 18 O A VAL 80 ? ? H A VAL 84 ? ? 1.56 98 18 H A LYS 75 ? ? O2A A HEC 109 ? ? 1.57 99 19 O A HIS 83 ? ? H A ALA 87 ? ? 1.49 100 19 O A VAL 80 ? ? H A VAL 84 ? ? 1.54 101 19 H A LYS 75 ? ? O1A A HEC 109 ? ? 1.54 102 19 O A SER 78 ? ? H A CYS 82 ? ? 1.55 103 20 O A HIS 83 ? ? H A ALA 87 ? ? 1.50 104 20 O A SER 78 ? ? H A CYS 82 ? ? 1.53 105 20 O A ASP 71 ? ? HG A SER 78 ? ? 1.54 106 20 O A VAL 80 ? ? H A VAL 84 ? ? 1.55 107 20 H A SER 103 ? ? O A HIS 106 ? ? 1.57 108 20 O A GLY 64 ? ? H A HIS 67 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 3 ? ? 47.51 -172.49 2 1 GLU A 12 ? ? -108.19 67.33 3 1 HIS A 25 ? ? -99.23 34.66 4 1 ASN A 38 ? ? 82.55 -1.13 5 1 ALA A 49 ? ? -54.92 102.37 6 1 CYS A 51 ? ? -108.74 -92.25 7 1 HIS A 52 ? ? -107.11 74.60 8 1 LYS A 57 ? ? 69.64 -64.81 9 1 ASP A 59 ? ? -140.63 -51.15 10 1 LYS A 60 ? ? 41.99 90.51 11 1 SER A 61 ? ? -157.87 -54.65 12 1 ALA A 62 ? ? -179.44 -54.48 13 1 HIS A 70 ? ? -132.91 -60.06 14 1 ASP A 71 ? ? -39.00 132.14 15 1 ALA A 89 ? ? -113.13 60.93 16 1 ALA A 91 ? ? 61.37 146.01 17 1 ALA A 92 ? ? 84.03 -50.41 18 1 LYS A 102 ? ? 72.15 46.03 19 2 PRO A 2 ? ? -74.96 -89.65 20 2 LYS A 3 ? ? 176.29 157.82 21 2 ALA A 6 ? ? -56.27 -170.56 22 2 GLU A 12 ? ? -108.63 67.21 23 2 ASN A 38 ? ? -98.88 35.03 24 2 ALA A 49 ? ? -54.69 108.74 25 2 CYS A 51 ? ? -105.53 -90.53 26 2 HIS A 52 ? ? -109.55 70.80 27 2 ASP A 59 ? ? -171.91 90.56 28 2 SER A 61 ? ? 174.12 -66.94 29 2 ALA A 62 ? ? -176.25 -45.51 30 2 HIS A 70 ? ? -132.49 -61.91 31 2 ASP A 71 ? ? -38.87 132.01 32 2 ALA A 89 ? ? 40.25 89.92 33 2 ASP A 90 ? ? -165.05 -43.28 34 2 ALA A 91 ? ? 75.20 144.11 35 2 ALA A 92 ? ? 84.49 -48.19 36 2 LYS A 102 ? ? 74.09 42.51 37 3 PRO A 2 ? ? -74.94 -87.01 38 3 LYS A 3 ? ? 172.71 155.82 39 3 ALA A 6 ? ? -54.96 -172.17 40 3 GLU A 12 ? ? -108.84 68.50 41 3 HIS A 25 ? ? -97.55 33.45 42 3 ASN A 38 ? ? -94.82 32.21 43 3 ALA A 49 ? ? -54.83 108.53 44 3 CYS A 51 ? ? -105.51 -91.10 45 3 HIS A 52 ? ? -109.00 69.66 46 3 ASP A 59 ? ? -122.95 -58.09 47 3 LYS A 60 ? ? 63.21 -139.60 48 3 SER A 61 ? ? 72.16 -71.55 49 3 ALA A 62 ? ? -178.69 -42.51 50 3 HIS A 70 ? ? -132.60 -63.35 51 3 ASP A 71 ? ? -37.84 132.00 52 3 ASN A 73 ? ? -69.47 65.90 53 3 ALA A 91 ? ? 82.97 -76.37 54 3 LYS A 102 ? ? 70.91 45.32 55 4 GLU A 12 ? ? -102.21 65.71 56 4 ASN A 38 ? ? -97.53 34.63 57 4 GLU A 41 ? ? -107.52 66.19 58 4 CYS A 51 ? ? -103.80 -91.61 59 4 HIS A 52 ? ? -109.07 74.10 60 4 LYS A 57 ? ? 69.83 -63.41 61 4 ASP A 59 ? ? -143.30 -47.44 62 4 LYS A 60 ? ? 66.00 -119.76 63 4 SER A 61 ? ? 63.45 -78.16 64 4 ALA A 62 ? ? -173.96 -40.77 65 4 HIS A 70 ? ? -133.51 -63.17 66 4 ASP A 71 ? ? -38.54 132.38 67 4 ALA A 89 ? ? -109.06 77.18 68 4 LYS A 102 ? ? 71.60 49.68 69 5 ALA A 6 ? ? -54.69 -177.77 70 5 GLU A 12 ? ? -110.02 68.19 71 5 HIS A 25 ? ? -98.71 34.11 72 5 ASN A 38 ? ? 85.47 -8.46 73 5 ALA A 49 ? ? -54.92 107.99 74 5 CYS A 51 ? ? -106.15 -93.00 75 5 HIS A 52 ? ? -105.95 68.94 76 5 SER A 61 ? ? 178.31 -67.59 77 5 ALA A 62 ? ? -177.20 -43.53 78 5 HIS A 70 ? ? -132.62 -62.60 79 5 ASP A 71 ? ? -38.94 119.88 80 5 ASN A 73 ? ? -65.19 79.99 81 5 ALA A 89 ? ? -143.98 58.18 82 5 ALA A 91 ? ? 78.88 -76.08 83 5 LYS A 102 ? ? 72.53 45.92 84 6 ALA A 6 ? ? -55.82 175.17 85 6 GLU A 12 ? ? -107.64 67.62 86 6 HIS A 25 ? ? -96.68 33.06 87 6 ASN A 38 ? ? 87.17 -14.39 88 6 ALA A 49 ? ? -54.82 105.79 89 6 CYS A 51 ? ? -108.22 -93.48 90 6 HIS A 52 ? ? -105.86 66.34 91 6 LYS A 57 ? ? 68.27 -67.97 92 6 LYS A 58 ? ? -69.51 63.85 93 6 SER A 61 ? ? 177.86 -64.35 94 6 ALA A 62 ? ? -179.59 -46.71 95 6 HIS A 70 ? ? -137.37 -62.97 96 6 ASP A 71 ? ? -37.58 126.81 97 7 GLU A 12 ? ? -105.52 66.59 98 7 ASN A 38 ? ? 64.94 -82.95 99 7 GLU A 41 ? ? 177.15 61.74 100 7 TYR A 43 ? ? 45.06 96.30 101 7 CYS A 51 ? ? -102.53 -94.53 102 7 HIS A 52 ? ? -105.19 69.51 103 7 ASP A 59 ? ? -149.17 -47.82 104 7 LYS A 60 ? ? 87.13 -150.12 105 7 SER A 61 ? ? 72.80 170.11 106 7 HIS A 70 ? ? -132.49 -63.34 107 7 ASP A 71 ? ? -38.65 142.48 108 7 ALA A 91 ? ? 68.32 -74.70 109 7 LYS A 102 ? ? 77.07 51.79 110 8 PRO A 2 ? ? -74.98 -169.10 111 8 GLU A 12 ? ? -103.95 65.09 112 8 ASN A 38 ? ? 83.56 -3.32 113 8 ALA A 49 ? ? -54.73 105.67 114 8 CYS A 51 ? ? -108.77 -94.41 115 8 HIS A 52 ? ? -105.02 68.13 116 8 ASP A 56 ? ? -116.02 68.98 117 8 ASP A 59 ? ? -160.56 -59.49 118 8 LYS A 60 ? ? 62.85 131.17 119 8 SER A 61 ? ? 170.27 -66.61 120 8 ALA A 62 ? ? -176.71 -51.51 121 8 HIS A 70 ? ? -134.54 -62.89 122 8 ASP A 71 ? ? -37.93 119.79 123 8 ALA A 89 ? ? -113.37 60.78 124 8 ALA A 91 ? ? 61.31 146.72 125 8 ALA A 92 ? ? 83.78 -50.70 126 9 ALA A 6 ? ? -55.56 177.64 127 9 GLU A 12 ? ? -110.42 67.33 128 9 HIS A 25 ? ? -97.38 33.49 129 9 ALA A 49 ? ? -54.64 109.53 130 9 CYS A 51 ? ? -104.85 -91.18 131 9 HIS A 52 ? ? -109.17 69.80 132 9 ASP A 59 ? ? -162.18 97.44 133 9 SER A 61 ? ? 169.47 -59.14 134 9 ALA A 62 ? ? 171.74 -39.65 135 9 HIS A 70 ? ? -136.25 -63.48 136 9 ASP A 71 ? ? -36.38 134.30 137 9 ASN A 73 ? ? -61.93 82.07 138 9 LEU A 97 ? ? -122.89 -52.35 139 10 LYS A 3 ? ? 40.07 -158.41 140 10 ALA A 6 ? ? -63.86 -179.14 141 10 GLU A 12 ? ? -101.92 65.75 142 10 ASN A 38 ? ? 82.23 -1.68 143 10 ALA A 49 ? ? -55.11 103.47 144 10 CYS A 51 ? ? -109.30 -95.53 145 10 HIS A 52 ? ? -103.53 74.38 146 10 LYS A 57 ? ? 69.37 -65.04 147 10 ASP A 59 ? ? -173.70 54.61 148 10 LYS A 60 ? ? -40.12 97.98 149 10 HIS A 70 ? ? -136.70 -62.62 150 10 ASP A 71 ? ? -38.49 140.46 151 10 ASN A 73 ? ? -69.01 66.06 152 10 ASP A 90 ? ? -153.05 89.17 153 11 ALA A 6 ? ? -54.83 -179.44 154 11 GLU A 12 ? ? -105.03 68.55 155 11 HIS A 35 ? ? -39.64 148.07 156 11 ASN A 38 ? ? 82.48 -5.56 157 11 ALA A 49 ? ? -54.85 108.25 158 11 CYS A 51 ? ? -105.29 -95.82 159 11 HIS A 52 ? ? -103.78 68.22 160 11 ASP A 59 ? ? -141.27 -56.77 161 11 LYS A 60 ? ? 66.08 -145.74 162 11 SER A 61 ? ? 84.50 -70.97 163 11 ALA A 62 ? ? -175.71 -46.22 164 11 HIS A 70 ? ? -135.11 -60.74 165 11 ASP A 71 ? ? -37.84 128.87 166 11 ALA A 89 ? ? -98.59 58.28 167 11 ALA A 91 ? ? 60.36 150.91 168 11 ALA A 92 ? ? 81.92 -52.14 169 12 ALA A 6 ? ? -55.18 -170.36 170 12 ASN A 38 ? ? 84.02 -4.61 171 12 ALA A 49 ? ? -54.68 103.54 172 12 CYS A 51 ? ? -108.49 -94.12 173 12 HIS A 52 ? ? -105.35 75.08 174 12 LYS A 57 ? ? 70.53 -61.97 175 12 ASP A 59 ? ? -144.26 -52.14 176 12 LYS A 60 ? ? 69.27 -119.05 177 12 SER A 61 ? ? 65.47 -74.42 178 12 ALA A 62 ? ? -177.47 -41.79 179 12 HIS A 70 ? ? -131.61 -63.02 180 12 ASP A 71 ? ? -38.53 139.49 181 12 ASN A 73 ? ? -69.79 63.00 182 12 ALA A 89 ? ? -100.48 74.78 183 13 ALA A 6 ? ? -54.92 -179.83 184 13 ASN A 38 ? ? 82.18 -2.34 185 13 ALA A 49 ? ? -54.64 109.24 186 13 CYS A 51 ? ? -105.15 -90.93 187 13 HIS A 52 ? ? -108.26 63.22 188 13 LYS A 57 ? ? 66.44 -74.11 189 13 ASP A 59 ? ? -146.89 -61.97 190 13 LYS A 60 ? ? 67.37 124.72 191 13 SER A 61 ? ? 175.17 -63.67 192 13 ALA A 62 ? ? -177.94 -52.11 193 13 HIS A 70 ? ? -132.31 -63.11 194 13 ASP A 71 ? ? -37.97 124.96 195 13 ASP A 90 ? ? -156.01 -47.88 196 13 ALA A 91 ? ? 73.94 -71.17 197 13 LEU A 97 ? ? -126.59 -50.05 198 13 LYS A 102 ? ? 82.07 41.10 199 14 PRO A 2 ? ? -74.97 -77.30 200 14 LYS A 3 ? ? 173.28 140.01 201 14 ALA A 6 ? ? -54.83 176.29 202 14 GLU A 12 ? ? -107.35 66.74 203 14 HIS A 25 ? ? -99.26 34.49 204 14 VAL A 37 ? ? -84.53 -72.80 205 14 ASN A 38 ? ? -90.86 38.93 206 14 CYS A 51 ? ? -95.12 -108.33 207 14 MET A 55 ? ? -89.28 35.51 208 14 ASP A 56 ? ? -106.23 59.78 209 14 ASP A 59 ? ? -156.34 -46.56 210 14 LYS A 60 ? ? 65.45 100.48 211 14 HIS A 70 ? ? -134.93 -61.74 212 14 ASP A 71 ? ? -38.89 137.92 213 14 ASN A 73 ? ? -69.54 63.77 214 14 ALA A 91 ? ? 80.56 -77.63 215 15 ALA A 6 ? ? -54.92 177.13 216 15 GLU A 12 ? ? -103.01 65.00 217 15 ASN A 38 ? ? 84.35 -6.97 218 15 CYS A 51 ? ? -95.02 -109.87 219 15 MET A 55 ? ? -88.98 34.59 220 15 ASP A 56 ? ? -116.68 75.40 221 15 ASP A 59 ? ? -173.92 93.31 222 15 SER A 61 ? ? 179.38 -61.46 223 15 ALA A 62 ? ? -178.99 -50.36 224 15 HIS A 70 ? ? -135.50 -60.45 225 15 ASP A 71 ? ? -39.42 134.31 226 15 ALA A 91 ? ? 80.57 -73.54 227 16 LYS A 3 ? ? 55.90 178.80 228 16 GLU A 12 ? ? -105.26 65.96 229 16 ASN A 38 ? ? 66.86 -82.13 230 16 GLU A 41 ? ? 178.22 78.95 231 16 ASP A 42 ? ? -141.23 46.98 232 16 TYR A 43 ? ? 45.51 89.03 233 16 ALA A 49 ? ? -54.70 108.08 234 16 CYS A 51 ? ? -105.58 -91.93 235 16 HIS A 52 ? ? -107.78 65.43 236 16 ASP A 59 ? ? -164.45 88.81 237 16 SER A 61 ? ? 174.35 -60.49 238 16 ALA A 62 ? ? 177.29 -48.73 239 16 HIS A 70 ? ? -135.44 -63.22 240 16 ASP A 71 ? ? -38.20 131.49 241 16 ALA A 89 ? ? -94.36 46.29 242 17 LYS A 3 ? ? 55.69 178.07 243 17 ALA A 6 ? ? -75.78 -166.11 244 17 ASN A 38 ? ? 80.18 1.74 245 17 ALA A 49 ? ? -54.80 104.16 246 17 CYS A 51 ? ? -107.54 -100.24 247 17 LYS A 57 ? ? 69.62 -63.78 248 17 ASP A 59 ? ? -135.90 -55.60 249 17 LYS A 60 ? ? 68.72 -139.22 250 17 SER A 61 ? ? 77.68 -70.70 251 17 ALA A 62 ? ? -177.79 -42.26 252 17 HIS A 70 ? ? -131.60 -63.17 253 17 ASP A 71 ? ? -39.38 123.88 254 17 ALA A 89 ? ? 40.38 90.04 255 17 ASP A 90 ? ? -164.68 -43.24 256 17 ALA A 91 ? ? 76.13 145.31 257 17 ALA A 92 ? ? 84.10 -48.34 258 17 LYS A 102 ? ? 73.35 40.63 259 18 GLU A 12 ? ? -105.52 66.18 260 18 GLU A 41 ? ? -174.23 104.22 261 18 ASP A 42 ? ? -145.72 48.78 262 18 TYR A 43 ? ? 50.03 100.84 263 18 ALA A 49 ? ? -54.78 103.53 264 18 CYS A 51 ? ? -107.74 -101.36 265 18 LYS A 57 ? ? 67.17 -76.07 266 18 ASP A 59 ? ? -136.37 -58.17 267 18 LYS A 60 ? ? 72.12 -142.12 268 18 SER A 61 ? ? 80.47 -64.89 269 18 ALA A 62 ? ? 175.20 -44.10 270 18 HIS A 70 ? ? -135.81 -63.22 271 18 ASP A 71 ? ? -38.03 125.07 272 18 ALA A 91 ? ? 82.21 -72.58 273 18 LYS A 102 ? ? 73.87 40.01 274 19 ALA A 6 ? ? -54.70 171.21 275 19 GLU A 12 ? ? -108.97 68.28 276 19 ASN A 38 ? ? -98.08 34.41 277 19 ALA A 49 ? ? -55.74 109.93 278 19 CYS A 51 ? ? -104.38 -100.92 279 19 HIS A 52 ? ? -100.06 71.79 280 19 LYS A 57 ? ? 70.28 -61.11 281 19 ASP A 59 ? ? -172.06 56.49 282 19 LYS A 60 ? ? -40.35 108.32 283 19 HIS A 70 ? ? -133.43 -62.92 284 19 ASP A 71 ? ? -38.72 125.13 285 19 ALA A 89 ? ? -104.34 59.35 286 19 ALA A 91 ? ? 60.20 152.38 287 19 ALA A 92 ? ? 81.54 -51.86 288 19 LYS A 102 ? ? 74.78 49.70 289 20 GLU A 12 ? ? -104.52 67.54 290 20 ASN A 38 ? ? 82.76 -0.32 291 20 ALA A 49 ? ? -54.89 107.09 292 20 CYS A 51 ? ? -105.62 -99.19 293 20 LYS A 57 ? ? 69.11 -66.25 294 20 ASP A 59 ? ? -163.38 94.94 295 20 SER A 61 ? ? -178.38 -69.62 296 20 ALA A 62 ? ? -174.85 -43.14 297 20 HIS A 70 ? ? -134.51 -62.51 298 20 ASP A 71 ? ? -39.08 133.14 299 20 ALA A 89 ? ? -105.69 60.33 300 20 ALA A 91 ? ? 59.59 154.36 301 20 ALA A 92 ? ? 79.02 -53.74 302 20 LYS A 102 ? ? 77.45 46.07 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'HEME C' _pdbx_entity_nonpoly.comp_id HEC #