data_1A2U
# 
_entry.id   1A2U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.375 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1A2U         pdb_00001a2u 10.2210/pdb1a2u/pdb 
WWPDB D_1000170322 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1A2U 
_pdbx_database_status.recvd_initial_deposition_date   1998-01-11 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wynn, R.'       1 
'Harkins, P.C.'  2 
'Richards, F.M.' 3 
'Fox, R.O.'      4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Mobile unnatural amino acid side chains in the core of staphylococcal nuclease.' 'Protein Sci.' 5 1026 1031 1996 PRCIEI 
US 0961-8368 0795 ? 8762134 ? 
1       'Interactions in Nonnative and Truncated Forms of Staphylococcal Nuclease as Indicated by Mutational Free Energy Changes' 
'Protein Sci.' 4 1815 ?    1995 PRCIEI US 0961-8368 0795 ? ?       ? 
2       
;Unnatural Amino Acid Packing Mutants of Escherichia Coli Thioredoxin Produced by Combined Mutagenesis/Chemical Modification Techniques
;
'Protein Sci.' 2 395  ?    1993 PRCIEI US 0961-8368 0795 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wynn, R.'       1  ? 
primary 'Harkins, P.C.'  2  ? 
primary 'Richards, F.M.' 3  ? 
primary 'Fox, R.O.'      4  ? 
1       'Wynn, R.'       5  ? 
1       'Anderson, C.L.' 6  ? 
1       'Richards, F.M.' 7  ? 
1       'Fox, R.O.'      8  ? 
2       'Wynn, R.'       9  ? 
2       'Richards, F.M.' 10 ? 
# 
_cell.entry_id           1A2U 
_cell.length_a           48.500 
_cell.length_b           48.500 
_cell.length_c           63.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1A2U 
_symmetry.space_group_name_H-M             'P 41' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                76 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'STAPHYLOCOCCAL NUCLEASE'     16935.514 1  3.1.31.1 'V23C, S-THIOBUTYL DISULFIDE' ? 
'VARIANT FORMED BY CHEMICAL MODIFICATION OF THE SOLE CYSTEINE RESIDUE' 
2 non-polymer syn 'CALCIUM ION'                 40.078    1  ?        ?                             ? ? 
3 non-polymer syn "THYMIDINE-3',5'-DIPHOSPHATE" 402.188   1  ?        ?                             ? ? 
4 water       nat water                         18.015    42 ?        ?                             ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;ATSTKKLHKEPATLIKAIDGDT(BUC)KLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEF
DKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWSEDNADSGQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ATSTKKLHKEPATLIKAIDGDTCKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQ
RTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWSEDNADSGQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   THR n 
1 3   SER n 
1 4   THR n 
1 5   LYS n 
1 6   LYS n 
1 7   LEU n 
1 8   HIS n 
1 9   LYS n 
1 10  GLU n 
1 11  PRO n 
1 12  ALA n 
1 13  THR n 
1 14  LEU n 
1 15  ILE n 
1 16  LYS n 
1 17  ALA n 
1 18  ILE n 
1 19  ASP n 
1 20  GLY n 
1 21  ASP n 
1 22  THR n 
1 23  BUC n 
1 24  LYS n 
1 25  LEU n 
1 26  MET n 
1 27  TYR n 
1 28  LYS n 
1 29  GLY n 
1 30  GLN n 
1 31  PRO n 
1 32  MET n 
1 33  THR n 
1 34  PHE n 
1 35  ARG n 
1 36  LEU n 
1 37  LEU n 
1 38  LEU n 
1 39  VAL n 
1 40  ASP n 
1 41  THR n 
1 42  PRO n 
1 43  GLU n 
1 44  THR n 
1 45  LYS n 
1 46  HIS n 
1 47  PRO n 
1 48  LYS n 
1 49  LYS n 
1 50  GLY n 
1 51  VAL n 
1 52  GLU n 
1 53  LYS n 
1 54  TYR n 
1 55  GLY n 
1 56  PRO n 
1 57  GLU n 
1 58  ALA n 
1 59  SER n 
1 60  ALA n 
1 61  PHE n 
1 62  THR n 
1 63  LYS n 
1 64  LYS n 
1 65  MET n 
1 66  VAL n 
1 67  GLU n 
1 68  ASN n 
1 69  ALA n 
1 70  LYS n 
1 71  LYS n 
1 72  ILE n 
1 73  GLU n 
1 74  VAL n 
1 75  GLU n 
1 76  PHE n 
1 77  ASP n 
1 78  LYS n 
1 79  GLY n 
1 80  GLN n 
1 81  ARG n 
1 82  THR n 
1 83  ASP n 
1 84  LYS n 
1 85  TYR n 
1 86  GLY n 
1 87  ARG n 
1 88  GLY n 
1 89  LEU n 
1 90  ALA n 
1 91  TYR n 
1 92  ILE n 
1 93  TYR n 
1 94  ALA n 
1 95  ASP n 
1 96  GLY n 
1 97  LYS n 
1 98  MET n 
1 99  VAL n 
1 100 ASN n 
1 101 GLU n 
1 102 ALA n 
1 103 LEU n 
1 104 VAL n 
1 105 ARG n 
1 106 GLN n 
1 107 GLY n 
1 108 LEU n 
1 109 ALA n 
1 110 LYS n 
1 111 VAL n 
1 112 ALA n 
1 113 TYR n 
1 114 VAL n 
1 115 TYR n 
1 116 LYS n 
1 117 PRO n 
1 118 ASN n 
1 119 ASN n 
1 120 THR n 
1 121 HIS n 
1 122 GLU n 
1 123 GLN n 
1 124 HIS n 
1 125 LEU n 
1 126 ARG n 
1 127 LYS n 
1 128 SER n 
1 129 GLU n 
1 130 ALA n 
1 131 GLN n 
1 132 ALA n 
1 133 LYS n 
1 134 LYS n 
1 135 GLU n 
1 136 LYS n 
1 137 LEU n 
1 138 ASN n 
1 139 ILE n 
1 140 TRP n 
1 141 SER n 
1 142 GLU n 
1 143 ASP n 
1 144 ASN n 
1 145 ALA n 
1 146 ASP n 
1 147 SER n 
1 148 GLY n 
1 149 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Staphylococcus aureus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1280 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               AR120 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PAS1 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NUC_STAAU 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00644 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MLVMTEYLLSAGICMAIVSILLIGMAISNVSKGQYAKRFFFFATSCLVLTLVVVSSLSSSANASQTDNGVNRSGSEDPTV
YSATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDK
GQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWSEDNADSGQ
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1A2U 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 149 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00644 
_struct_ref_seq.db_align_beg                  83 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  231 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       149 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1A2U 
_struct_ref_seq_dif.mon_id                       BUC 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      23 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P00644 
_struct_ref_seq_dif.db_mon_id                    VAL 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          105 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            23 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                       ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ? 'C4 H7 N O4'        133.103 
BUC 'L-peptide linking' n S,S-BUTYLTHIOCYSTEINE         ? 'C7 H15 N O2 S2'    209.329 
CA  non-polymer         . 'CALCIUM ION'                 ? 'Ca 2'              40.078  
GLN 'L-peptide linking' y GLUTAMINE                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                    ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                        ? 'C3 H7 N O3'        105.093 
THP 'DNA linking'       . "THYMIDINE-3',5'-DIPHOSPHATE" ? 'C10 H16 N2 O11 P2' 402.188 
THR 'L-peptide linking' y THREONINE                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1A2U 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.19 
_exptl_crystal.density_percent_sol   43.84 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.15 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'10 MM POTASSIUM PHOSPHATE, PH 8.15 PROTEIN CONCENTRATION = 2 MGS/ML MPD =21% T=4 DEGREES C, temperature 277K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           278.15 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MACSCIENCE 
_diffrn_detector.pdbx_collection_date   1996-01 
_diffrn_detector.details                COLLIMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1A2U 
_reflns.observed_criterion_sigma_I   2. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             6.0 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   8454 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.1 
_reflns.pdbx_Rmerge_I_obs            0.0590000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.09 
_reflns_shell.percent_possible_all   75.4 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1A2U 
_refine.ls_number_reflns_obs                     8454 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1740000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1740000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1SNC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1086 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         26 
_refine_hist.number_atoms_solvent             42 
_refine_hist.number_atoms_total               1154 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        6.0 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM19X.PRO TOPH19X.PRO 'X-RAY DIFFRACTION' 
2 PARAM11.DNA  ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1A2U 
_struct.title                     
;STAPHYLOCOCCAL NUCLEASE, V23C VARIANT, COMPLEX WITH 1-N-BUTANE THIOL AND 3',5'-THYMIDINE DIPHOSPHATE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1A2U 
_struct_keywords.pdbx_keywords   NUCLEASE 
_struct_keywords.text            'NUCLEASE, UNNATURAL AMINO ACID, HYDROLASE, ENDONUCLEASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 55  ? GLU A 67  ? GLY A 55  GLU A 67  1 ? 13 
HELX_P HELX_P2 2 VAL A 99  ? ARG A 105 ? VAL A 99  ARG A 105 1 ? 7  
HELX_P HELX_P3 3 GLU A 122 ? LYS A 134 ? GLU A 122 LYS A 134 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A THR 22 C   ? ? ? 1_555 A BUC 23 N   ? ? A THR 22  A BUC 23  1_555 ? ? ? ? ? ? ? 1.332 ? ? 
covale2 covale both ? A BUC 23 C   ? ? ? 1_555 A LYS 24 N   ? ? A BUC 23  A LYS 24  1_555 ? ? ? ? ? ? ? 1.324 ? ? 
metalc1 metalc ?    ? A ASP 21 OD2 ? ? ? 1_555 B CA  .  CA  ? ? A ASP 21  A CA  150 1_555 ? ? ? ? ? ? ? 2.338 ? ? 
metalc2 metalc ?    ? A ASP 21 OD1 ? ? ? 1_555 B CA  .  CA  ? ? A ASP 21  A CA  150 1_555 ? ? ? ? ? ? ? 3.382 ? ? 
metalc3 metalc ?    ? A ASP 40 OD1 ? ? ? 1_555 B CA  .  CA  ? ? A ASP 40  A CA  150 1_555 ? ? ? ? ? ? ? 2.432 ? ? 
metalc4 metalc ?    ? A THR 41 O   ? ? ? 1_555 B CA  .  CA  ? ? A THR 41  A CA  150 1_555 ? ? ? ? ? ? ? 2.661 ? ? 
metalc5 metalc ?    ? B CA  .  CA  ? ? ? 1_555 C THP .  O4P ? ? A CA  150 A THP 151 1_555 ? ? ? ? ? ? ? 2.664 ? ? 
metalc6 metalc ?    ? B CA  .  CA  ? ? ? 1_555 D HOH .  O   ? ? A CA  150 A HOH 212 1_555 ? ? ? ? ? ? ? 2.283 ? ? 
metalc7 metalc ?    ? B CA  .  CA  ? ? ? 1_555 D HOH .  O   ? ? A CA  150 A HOH 217 1_555 ? ? ? ? ? ? ? 2.156 ? ? 
metalc8 metalc ?    ? B CA  .  CA  ? ? ? 1_555 D HOH .  O   ? ? A CA  150 A HOH 243 1_555 ? ? ? ? ? ? ? 1.528 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           116 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            116 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    117 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     117 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 9   ? ALA A 12  ? LYS A 9   ALA A 12  
A 2 ILE A 72  ? PHE A 76  ? ILE A 72  PHE A 76  
A 3 GLY A 88  ? ALA A 94  ? GLY A 88  ALA A 94  
A 4 GLN A 30  ? LEU A 36  ? GLN A 30  LEU A 36  
A 5 THR A 22  ? TYR A 27  ? THR A 22  TYR A 27  
A 6 THR A 13  ? ALA A 17  ? THR A 13  ALA A 17  
B 1 VAL A 39  ? THR A 41  ? VAL A 39  THR A 41  
B 2 ALA A 109 ? VAL A 111 ? ALA A 109 VAL A 111 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 10 ? O GLU A 10 N VAL A 74  ? N VAL A 74  
A 2 3 O GLU A 73 ? O GLU A 73 N TYR A 93  ? N TYR A 93  
A 3 4 O GLY A 88 ? O GLY A 88 N ARG A 35  ? N ARG A 35  
A 4 5 O GLN A 30 ? O GLN A 30 N TYR A 27  ? N TYR A 27  
A 5 6 O LYS A 24 ? O LYS A 24 N LYS A 16  ? N LYS A 16  
B 1 2 O ASP A 40 ? O ASP A 40 N LYS A 110 ? N LYS A 110 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA  150 ? 7  'BINDING SITE FOR RESIDUE CA A 150'  
AC2 Software A THP 151 ? 16 'BINDING SITE FOR RESIDUE THP A 151' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  ASP A 21  ? ASP A 21  . ? 1_555 ? 
2  AC1 7  ASP A 40  ? ASP A 40  . ? 1_555 ? 
3  AC1 7  THR A 41  ? THR A 41  . ? 1_555 ? 
4  AC1 7  THP C .   ? THP A 151 . ? 1_555 ? 
5  AC1 7  HOH D .   ? HOH A 212 . ? 1_555 ? 
6  AC1 7  HOH D .   ? HOH A 217 . ? 1_555 ? 
7  AC1 7  HOH D .   ? HOH A 243 . ? 1_555 ? 
8  AC2 16 ARG A 35  ? ARG A 35  . ? 1_555 ? 
9  AC2 16 LEU A 36  ? LEU A 36  . ? 1_555 ? 
10 AC2 16 ASP A 40  ? ASP A 40  . ? 1_555 ? 
11 AC2 16 LYS A 71  ? LYS A 71  . ? 3_655 ? 
12 AC2 16 ASP A 83  ? ASP A 83  . ? 1_555 ? 
13 AC2 16 LYS A 84  ? LYS A 84  . ? 1_555 ? 
14 AC2 16 TYR A 85  ? TYR A 85  . ? 1_555 ? 
15 AC2 16 ARG A 87  ? ARG A 87  . ? 1_555 ? 
16 AC2 16 TYR A 113 ? TYR A 113 . ? 1_555 ? 
17 AC2 16 TYR A 115 ? TYR A 115 . ? 1_555 ? 
18 AC2 16 CA  B .   ? CA  A 150 . ? 1_555 ? 
19 AC2 16 HOH D .   ? HOH A 202 . ? 1_555 ? 
20 AC2 16 HOH D .   ? HOH A 212 . ? 1_555 ? 
21 AC2 16 HOH D .   ? HOH A 215 . ? 1_555 ? 
22 AC2 16 HOH D .   ? HOH A 216 . ? 1_555 ? 
23 AC2 16 HOH D .   ? HOH A 243 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1A2U 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1A2U 
_atom_sites.fract_transf_matrix[1][1]   0.020619 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020619 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015848 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
P  
S  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   LYS 5   5   ?   ?   ?   A . n 
A 1 6   LYS 6   6   ?   ?   ?   A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  BUC 23  23  23  BUC BUC A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  MET 26  26  26  MET MET A . n 
A 1 27  TYR 27  27  27  TYR TYR A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  MET 32  32  32  MET MET A . n 
A 1 33  THR 33  33  33  THR THR A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  THR 44  44  44  THR THR A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  HIS 46  46  46  HIS HIS A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  GLU 52  52  52  GLU GLU A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  TYR 54  54  54  TYR TYR A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  MET 65  65  65  MET MET A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  LYS 71  71  71  LYS LYS A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  TYR 85  85  85  TYR TYR A . n 
A 1 86  GLY 86  86  86  GLY GLY A . n 
A 1 87  ARG 87  87  87  ARG ARG A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  TYR 91  91  91  TYR TYR A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  TYR 93  93  93  TYR TYR A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  MET 98  98  98  MET MET A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 TYR 113 113 113 TYR TYR A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 LYS 116 116 116 LYS LYS A . n 
A 1 117 PRO 117 117 117 PRO PRO A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 HIS 121 121 121 HIS HIS A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 HIS 124 124 124 HIS HIS A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 LYS 136 136 136 LYS LYS A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 TRP 140 140 140 TRP TRP A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 GLU 142 142 ?   ?   ?   A . n 
A 1 143 ASP 143 143 ?   ?   ?   A . n 
A 1 144 ASN 144 144 ?   ?   ?   A . n 
A 1 145 ALA 145 145 ?   ?   ?   A . n 
A 1 146 ASP 146 146 ?   ?   ?   A . n 
A 1 147 SER 147 147 ?   ?   ?   A . n 
A 1 148 GLY 148 148 ?   ?   ?   A . n 
A 1 149 GLN 149 149 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1  150 142 CA  CA  A . 
C 3 THP 1  151 143 THP THP A . 
D 4 HOH 1  201 201 HOH HOH A . 
D 4 HOH 2  202 202 HOH HOH A . 
D 4 HOH 3  203 203 HOH HOH A . 
D 4 HOH 4  204 204 HOH HOH A . 
D 4 HOH 5  205 205 HOH HOH A . 
D 4 HOH 6  206 206 HOH HOH A . 
D 4 HOH 7  207 207 HOH HOH A . 
D 4 HOH 8  208 208 HOH HOH A . 
D 4 HOH 9  209 209 HOH HOH A . 
D 4 HOH 10 210 210 HOH HOH A . 
D 4 HOH 11 211 211 HOH HOH A . 
D 4 HOH 12 212 212 HOH HOH A . 
D 4 HOH 13 213 213 HOH HOH A . 
D 4 HOH 14 214 214 HOH HOH A . 
D 4 HOH 15 215 215 HOH HOH A . 
D 4 HOH 16 216 216 HOH HOH A . 
D 4 HOH 17 217 217 HOH HOH A . 
D 4 HOH 18 218 218 HOH HOH A . 
D 4 HOH 19 223 223 HOH HOH A . 
D 4 HOH 20 224 224 HOH HOH A . 
D 4 HOH 21 225 225 HOH HOH A . 
D 4 HOH 22 226 226 HOH HOH A . 
D 4 HOH 23 227 227 HOH HOH A . 
D 4 HOH 24 229 229 HOH HOH A . 
D 4 HOH 25 230 230 HOH HOH A . 
D 4 HOH 26 231 231 HOH HOH A . 
D 4 HOH 27 232 232 HOH HOH A . 
D 4 HOH 28 233 233 HOH HOH A . 
D 4 HOH 29 235 235 HOH HOH A . 
D 4 HOH 30 236 236 HOH HOH A . 
D 4 HOH 31 237 237 HOH HOH A . 
D 4 HOH 32 238 238 HOH HOH A . 
D 4 HOH 33 239 239 HOH HOH A . 
D 4 HOH 34 240 240 HOH HOH A . 
D 4 HOH 35 241 241 HOH HOH A . 
D 4 HOH 36 242 242 HOH HOH A . 
D 4 HOH 37 243 243 HOH HOH A . 
D 4 HOH 38 244 244 HOH HOH A . 
D 4 HOH 39 245 245 HOH HOH A . 
D 4 HOH 40 246 246 HOH HOH A . 
D 4 HOH 41 248 248 HOH HOH A . 
D 4 HOH 42 249 249 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    BUC 
_pdbx_struct_mod_residue.label_seq_id     23 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     BUC 
_pdbx_struct_mod_residue.auth_seq_id      23 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   CYS 
_pdbx_struct_mod_residue.details          S,S-BUTYLTHIOCYSTEINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 21 ? A ASP 21  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OD1 ? A ASP 21 ? A ASP 21  ? 1_555 40.2  ? 
2  OD2 ? A ASP 21 ? A ASP 21  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OD1 ? A ASP 40 ? A ASP 40  ? 1_555 86.0  ? 
3  OD1 ? A ASP 21 ? A ASP 21  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 OD1 ? A ASP 40 ? A ASP 40  ? 1_555 124.4 ? 
4  OD2 ? A ASP 21 ? A ASP 21  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? A THR 41 ? A THR 41  ? 1_555 95.3  ? 
5  OD1 ? A ASP 21 ? A ASP 21  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? A THR 41 ? A THR 41  ? 1_555 111.4 ? 
6  OD1 ? A ASP 40 ? A ASP 40  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? A THR 41 ? A THR 41  ? 1_555 80.0  ? 
7  OD2 ? A ASP 21 ? A ASP 21  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O4P ? C THP .  ? A THP 151 ? 1_555 95.4  ? 
8  OD1 ? A ASP 21 ? A ASP 21  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O4P ? C THP .  ? A THP 151 ? 1_555 97.5  ? 
9  OD1 ? A ASP 40 ? A ASP 40  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O4P ? C THP .  ? A THP 151 ? 1_555 68.7  ? 
10 O   ? A THR 41 ? A THR 41  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O4P ? C THP .  ? A THP 151 ? 1_555 146.0 ? 
11 OD2 ? A ASP 21 ? A ASP 21  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 212 ? 1_555 82.5  ? 
12 OD1 ? A ASP 21 ? A ASP 21  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 212 ? 1_555 47.6  ? 
13 OD1 ? A ASP 40 ? A ASP 40  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 212 ? 1_555 135.5 ? 
14 O   ? A THR 41 ? A THR 41  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 212 ? 1_555 143.7 ? 
15 O4P ? C THP .  ? A THP 151 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 212 ? 1_555 69.8  ? 
16 OD2 ? A ASP 21 ? A ASP 21  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 217 ? 1_555 90.5  ? 
17 OD1 ? A ASP 21 ? A ASP 21  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 217 ? 1_555 65.0  ? 
18 OD1 ? A ASP 40 ? A ASP 40  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 217 ? 1_555 148.2 ? 
19 O   ? A THR 41 ? A THR 41  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 217 ? 1_555 68.8  ? 
20 O4P ? C THP .  ? A THP 151 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 217 ? 1_555 143.1 ? 
21 O   ? D HOH .  ? A HOH 212 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 217 ? 1_555 74.9  ? 
22 OD2 ? A ASP 21 ? A ASP 21  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 243 ? 1_555 164.7 ? 
23 OD1 ? A ASP 21 ? A ASP 21  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 243 ? 1_555 154.4 ? 
24 OD1 ? A ASP 40 ? A ASP 40  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 243 ? 1_555 78.7  ? 
25 O   ? A THR 41 ? A THR 41  ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 243 ? 1_555 81.3  ? 
26 O4P ? C THP .  ? A THP 151 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 243 ? 1_555 79.9  ? 
27 O   ? D HOH .  ? A HOH 212 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 243 ? 1_555 109.1 ? 
28 O   ? D HOH .  ? A HOH 217 ? 1_555 CA ? B CA . ? A CA 150 ? 1_555 O   ? D HOH .  ? A HOH 243 ? 1_555 102.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-04-29 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-03-14 
5 'Structure model' 1 4 2023-08-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' Other                       
5 5 'Structure model' 'Database references'       
6 5 'Structure model' 'Derived calculations'      
7 5 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status          
2 4 'Structure model' struct_ref_seq_dif            
3 5 'Structure model' database_2                    
4 5 'Structure model' pdbx_initial_refinement_model 
5 5 'Structure model' pdbx_struct_conn_angle        
6 5 'Structure model' struct_conn                   
7 5 'Structure model' struct_ref_seq_dif            
8 5 'Structure model' struct_site                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_pdbx_database_status.process_site'          
2  4 'Structure model' '_struct_ref_seq_dif.details'                 
3  5 'Structure model' '_database_2.pdbx_DOI'                        
4  5 'Structure model' '_database_2.pdbx_database_accession'         
5  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
6  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
7  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
8  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
9  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
17 5 'Structure model' '_pdbx_struct_conn_angle.value'               
18 5 'Structure model' '_struct_conn.pdbx_dist_value'                
19 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
20 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
21 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
22 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
23 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
24 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
25 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
26 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
27 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
28 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
29 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
30 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
31 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
32 5 'Structure model' '_struct_ref_seq_dif.details'                 
33 5 'Structure model' '_struct_site.pdbx_auth_asym_id'              
34 5 'Structure model' '_struct_site.pdbx_auth_comp_id'              
35 5 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' 3.1 ? 1 
X-PLOR    refinement       3.1 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
X-PLOR    phasing          3.1 ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HZ3 A LYS 78  ? ? HG1 A THR 120 ? ? 1.26 
2 1 H2  A HOH 202 ? ? O   A HOH 205 ? ? 1.57 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 19  ? ? -151.38 -159.94 
2 1 LEU A 38  ? ? 53.55   14.51   
3 1 LYS A 45  ? ? -112.58 -89.83  
4 1 HIS A 46  ? ? -31.74  118.10  
5 1 TYR A 54  ? ? 79.22   -2.86   
6 1 ASN A 119 ? ? -143.40 24.40   
7 1 ASN A 138 ? ? 36.82   -105.39 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 1   ? A ALA 1   
2  1 Y 1 A THR 2   ? A THR 2   
3  1 Y 1 A SER 3   ? A SER 3   
4  1 Y 1 A THR 4   ? A THR 4   
5  1 Y 1 A LYS 5   ? A LYS 5   
6  1 Y 1 A LYS 6   ? A LYS 6   
7  1 Y 1 A GLU 142 ? A GLU 142 
8  1 Y 1 A ASP 143 ? A ASP 143 
9  1 Y 1 A ASN 144 ? A ASN 144 
10 1 Y 1 A ALA 145 ? A ALA 145 
11 1 Y 1 A ASP 146 ? A ASP 146 
12 1 Y 1 A SER 147 ? A SER 147 
13 1 Y 1 A GLY 148 ? A GLY 148 
14 1 Y 1 A GLN 149 ? A GLN 149 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'                 CA  
3 "THYMIDINE-3',5'-DIPHOSPHATE" THP 
4 water                         HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   1SNC 
_pdbx_initial_refinement_model.details          'PDB ENTRY 1SNC' 
#