data_1A3P # _entry.id 1A3P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.291 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1A3P WWPDB D_1000170353 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1A3P _pdbx_database_status.recvd_initial_deposition_date 1998-01-22 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Barnham, K.' 1 'Torres, A.' 2 'Alewood, D.' 3 'Alewood, P.' 4 'Domagala, T.' 5 'Nice, E.' 6 'Norton, R.' 7 # _citation.id primary _citation.title 'Role of the 6-20 disulfide bridge in the structure and activity of epidermal growth factor.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 7 _citation.page_first 1738 _citation.page_last 1749 _citation.year 1998 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10082370 _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Barnham, K.J.' 1 primary 'Torres, A.M.' 2 primary 'Alewood, D.' 3 primary 'Alewood, P.F.' 4 primary 'Domagala, T.' 5 primary 'Nice, E.C.' 6 primary 'Norton, R.S.' 7 # _cell.entry_id 1A3P _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1A3P _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'EPIDERMAL GROWTH FACTOR' _entity.formula_weight 4878.402 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'DEL(1-3, 49-53), C6(AMINO-BUTYRIC ACID), C20 (AMINO-BUTYRIC ACID)' _entity.pdbx_fragment 'RESIDUES 4 - 48' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name '[ABU6, 20] MEGF4-48' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'PG(ABA)PSSYDGYCLNGGV(ABA)MHIESLDSYTCNCVIGYSGDRCQTRDLR' _entity_poly.pdbx_seq_one_letter_code_can PGAPSSYDGYCLNGGVAMHIESLDSYTCNCVIGYSGDRCQTRDLR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 GLY n 1 3 ABA n 1 4 PRO n 1 5 SER n 1 6 SER n 1 7 TYR n 1 8 ASP n 1 9 GLY n 1 10 TYR n 1 11 CYS n 1 12 LEU n 1 13 ASN n 1 14 GLY n 1 15 GLY n 1 16 VAL n 1 17 ABA n 1 18 MET n 1 19 HIS n 1 20 ILE n 1 21 GLU n 1 22 SER n 1 23 LEU n 1 24 ASP n 1 25 SER n 1 26 TYR n 1 27 THR n 1 28 CYS n 1 29 ASN n 1 30 CYS n 1 31 VAL n 1 32 ILE n 1 33 GLY n 1 34 TYR n 1 35 SER n 1 36 GLY n 1 37 ASP n 1 38 ARG n 1 39 CYS n 1 40 GLN n 1 41 THR n 1 42 ARG n 1 43 ASP n 1 44 LEU n 1 45 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGF_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01132 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MPWGRRPTWLLLAFLLVFLKISILSVTAWQTGNCQPGPLERSERSGTCAGPAPFLVFSQGKSISRIDPDGTNHQQLVVDA GISADMDIHYKKERLYWVDVERQVLLRVFLNGTGLEKVCNVERKVSGLAIDWIDDEVLWVDQQNGVITVTDMTGKNSRVL LSSLKHPSNIAVDPIERLMFWSSEVTGSLHRAHLKGVDVKTLLETGGISVLTLDVLDKRLFWVQDSGEGSHAYIHSCDYE GGSVRLIRHQARHSLSSMAFFGDRIFYSVLKSKAIWIANKHTGKDTVRINLHPSFVTPGKLMVVHPRAQPRTEDAAKDPD PELLKQRGRPCRFGLCERDPKSHSSACAEGYTLSRDRKYCEDVNECATQNHGCTLGCENTPGSYHCTCPTGFVLLPDGKQ CHELVSCPGNVSKCSHGCVLTSDGPRCICPAGSVLGRDGKTCTGCSSPDNGGCSQICLPLRPGSWECDCFPGYDLQSDRK SCAASGPQPLLLFANSQDIRHMHFDGTDYKVLLSRQMGMVFALDYDPVESKIYFAQTALKWIERANMDGSQRERLITEGV DTLEGLALDWIGRRIYWTDSGKSVVGGSDLSGKHHRIIIQERISRPRGIAVHPRARRLFWTDVGMSPRIESASLQGSDRV LIASSNLLEPSGITIDYLTDTLYWCDTKRSVIEMANLDGSKRRRLIQNDVGHPFSLAVFEDHLWVSDWAIPSVIRVNKRT GQNRVRLQGSMLKPSSLVVVHPLAKPGADPCLYRNGGCEHICQESLGTARCLCREGFVKAWDGKMCLPQDYPILSGENAD LSKEVTSLSNSTQAEVPDDDGTESSTLVAEIMVSGMNYEDDCGPGGCGSHARCVSDGETAECQCLKGFARDGNLCSDIDE CVLARSDCPSTSSRCINTEGGYVCRCSEGYEGDGISCFDIDECQRGAHNCAENAACTNTEGGYNCTCAGRPSSPGRSCPD STAPSLLGEDGHHLDRNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELRHAGYGQKHDIM VVAVCMVALVLLLLLGMWGTYYYRTRKQLSNPPKNPCDEPSGSVSSSGPDSSSGAAVASCPQPWFVVLEKHQDPKNGSLP ADGTNGAVVDAGLSPSLQLGSVHLTSWRQKPHIDGMGTGQSCWIPPSSDRGPQEIEGNSHLPSYRPVGPEKLHSLQSANG SCHERAPDLPRQTEPVK ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1A3P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 45 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01132 _struct_ref_seq.db_align_beg 980 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1024 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 48 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1A3P ABA A 3 ? UNP P01132 CYS 982 'ENGINEERED MUTATION' 6 1 1 1A3P ABA A 17 ? UNP P01132 CYS 996 'ENGINEERED MUTATION' 20 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ABA 'L-peptide linking' n 'ALPHA-AMINOBUTYRIC ACID' ? 'C4 H9 N O2' 103.120 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOSEY 1 2 1 DQF-COSY 1 3 1 TOCSY 1 4 1 E-COSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 2.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents H2O # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 AMX Bruker 500 2 AMX Bruker 600 # _pdbx_nmr_refine.entry_id 1A3P _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1A3P _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING STANDARD 2D METHODS.' # _pdbx_nmr_ensemble.entry_id 1A3P _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria '20 BEST, BASED ON STEREOCHEMICAL AND NOE ENERGIES' # _pdbx_nmr_representative.entry_id 1A3P _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.8 BRUNGER 1 'structure solution' DYANA ? ? 2 'structure solution' X-PLOR ? ? 3 # _exptl.entry_id 1A3P _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1A3P _struct.title 'ROLE OF THE 6-20 DISULFIDE BRIDGE IN THE STRUCTURE AND ACTIVITY OF EPIDERMAL GROWTH FACTOR, NMR, 20 STRUCTURES' _struct.pdbx_descriptor 'EPIDERMAL GROWTH FACTOR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1A3P _struct_keywords.pdbx_keywords 'GROWTH FACTOR' _struct_keywords.text 'GROWTH FACTOR, MURINE EPIDERMAL GROWTH FACTOR, DISULFIDE CONNECTIVITIES, EGF-LIKE DOMAIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 14 A CYS 31 1_555 ? ? ? ? ? ? ? 2.021 ? disulf2 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 33 A CYS 42 1_555 ? ? ? ? ? ? ? 2.030 ? covale1 covale ? ? A ABA 3 N ? ? ? 1_555 A GLY 2 C ? ? A ABA 6 A GLY 5 1_555 ? ? ? ? ? ? ? 1.311 ? covale2 covale ? ? A ABA 3 C ? ? ? 1_555 A PRO 4 N ? ? A ABA 6 A PRO 7 1_555 ? ? ? ? ? ? ? 1.317 ? covale3 covale ? ? A ABA 17 N ? ? ? 1_555 A VAL 16 C ? ? A ABA 20 A VAL 19 1_555 ? ? ? ? ? ? ? 1.301 ? covale4 covale ? ? A ABA 17 C ? ? ? 1_555 A MET 18 N ? ? A ABA 20 A MET 21 1_555 ? ? ? ? ? ? ? 1.304 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 16 ? HIS A 19 ? VAL A 19 HIS A 22 A 2 TYR A 26 ? ASN A 29 ? TYR A 29 ASN A 32 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 16 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 19 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id ASN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 29 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 32 # _database_PDB_matrix.entry_id 1A3P _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1A3P _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 4 4 PRO PRO A . n A 1 2 GLY 2 5 5 GLY GLY A . n A 1 3 ABA 3 6 6 ABA ABA A . n A 1 4 PRO 4 7 7 PRO PRO A . n A 1 5 SER 5 8 8 SER SER A . n A 1 6 SER 6 9 9 SER SER A . n A 1 7 TYR 7 10 10 TYR TYR A . n A 1 8 ASP 8 11 11 ASP ASP A . n A 1 9 GLY 9 12 12 GLY GLY A . n A 1 10 TYR 10 13 13 TYR TYR A . n A 1 11 CYS 11 14 14 CYS CYS A . n A 1 12 LEU 12 15 15 LEU LEU A . n A 1 13 ASN 13 16 16 ASN ASN A . n A 1 14 GLY 14 17 17 GLY GLY A . n A 1 15 GLY 15 18 18 GLY GLY A . n A 1 16 VAL 16 19 19 VAL VAL A . n A 1 17 ABA 17 20 20 ABA ABA A . n A 1 18 MET 18 21 21 MET MET A . n A 1 19 HIS 19 22 22 HIS HIS A . n A 1 20 ILE 20 23 23 ILE ILE A . n A 1 21 GLU 21 24 24 GLU GLU A . n A 1 22 SER 22 25 25 SER SER A . n A 1 23 LEU 23 26 26 LEU LEU A . n A 1 24 ASP 24 27 27 ASP ASP A . n A 1 25 SER 25 28 28 SER SER A . n A 1 26 TYR 26 29 29 TYR TYR A . n A 1 27 THR 27 30 30 THR THR A . n A 1 28 CYS 28 31 31 CYS CYS A . n A 1 29 ASN 29 32 32 ASN ASN A . n A 1 30 CYS 30 33 33 CYS CYS A . n A 1 31 VAL 31 34 34 VAL VAL A . n A 1 32 ILE 32 35 35 ILE ILE A . n A 1 33 GLY 33 36 36 GLY GLY A . n A 1 34 TYR 34 37 37 TYR TYR A . n A 1 35 SER 35 38 38 SER SER A . n A 1 36 GLY 36 39 39 GLY GLY A . n A 1 37 ASP 37 40 40 ASP ASP A . n A 1 38 ARG 38 41 41 ARG ARG A . n A 1 39 CYS 39 42 42 CYS CYS A . n A 1 40 GLN 40 43 43 GLN GLN A . n A 1 41 THR 41 44 44 THR THR A . n A 1 42 ARG 42 45 45 ARG ARG A . n A 1 43 ASP 43 46 46 ASP ASP A . n A 1 44 LEU 44 47 47 LEU LEU A . n A 1 45 ARG 45 48 48 ARG ARG A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A ABA 3 A ABA 6 ? ALA 'ALPHA-AMINOBUTYRIC ACID' 2 A ABA 17 A ABA 20 ? ALA 'ALPHA-AMINOBUTYRIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-07-29 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-03-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Experimental preparation' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_nmr_exptl_sample_conditions 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 4 'Structure model' '_pdbx_nmr_exptl_sample_conditions.pressure_units' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.8 ? 1 X-PLOR refinement 3.8 ? 2 X-PLOR phasing 3.8 ? 3 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.307 1.373 -0.066 0.011 N 2 2 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.305 1.373 -0.068 0.011 N 3 3 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.306 1.373 -0.067 0.011 N 4 4 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.305 1.373 -0.068 0.011 N 5 5 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.306 1.373 -0.067 0.011 N 6 6 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.305 1.373 -0.068 0.011 N 7 7 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.305 1.373 -0.068 0.011 N 8 8 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.305 1.373 -0.068 0.011 N 9 9 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.304 1.373 -0.069 0.011 N 10 10 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.306 1.373 -0.067 0.011 N 11 11 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.305 1.373 -0.068 0.011 N 12 12 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.305 1.373 -0.068 0.011 N 13 13 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.307 1.373 -0.066 0.011 N 14 14 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.305 1.373 -0.068 0.011 N 15 15 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.306 1.373 -0.067 0.011 N 16 16 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.304 1.373 -0.069 0.011 N 17 17 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.305 1.373 -0.068 0.011 N 18 18 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.306 1.373 -0.067 0.011 N 19 19 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.307 1.373 -0.066 0.011 N 20 20 NE2 A HIS 22 ? ? CD2 A HIS 22 ? ? 1.305 1.373 -0.068 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH2 A ARG 45 ? ? 115.65 120.30 -4.65 0.50 N 2 3 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH2 A ARG 41 ? ? 116.97 120.30 -3.33 0.50 N 3 4 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH1 A ARG 41 ? ? 115.81 120.30 -4.49 0.50 N 4 4 NE A ARG 48 ? ? CZ A ARG 48 ? ? NH1 A ARG 48 ? ? 117.24 120.30 -3.06 0.50 N 5 5 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH1 A ARG 41 ? ? 115.41 120.30 -4.89 0.50 N 6 5 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH2 A ARG 45 ? ? 117.27 120.30 -3.03 0.50 N 7 5 NE A ARG 48 ? ? CZ A ARG 48 ? ? NH1 A ARG 48 ? ? 117.10 120.30 -3.20 0.50 N 8 6 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 117.28 120.30 -3.02 0.50 N 9 7 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 116.28 120.30 -4.02 0.50 N 10 8 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH2 A ARG 41 ? ? 116.95 120.30 -3.35 0.50 N 11 8 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH2 A ARG 45 ? ? 116.41 120.30 -3.89 0.50 N 12 8 NE A ARG 48 ? ? CZ A ARG 48 ? ? NH1 A ARG 48 ? ? 116.74 120.30 -3.56 0.50 N 13 9 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH2 A ARG 41 ? ? 117.27 120.30 -3.03 0.50 N 14 10 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH2 A ARG 41 ? ? 116.80 120.30 -3.50 0.50 N 15 10 NE A ARG 48 ? ? CZ A ARG 48 ? ? NH1 A ARG 48 ? ? 116.62 120.30 -3.68 0.50 N 16 11 NE A ARG 48 ? ? CZ A ARG 48 ? ? NH1 A ARG 48 ? ? 117.02 120.30 -3.28 0.50 N 17 12 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH2 A ARG 41 ? ? 116.71 120.30 -3.59 0.50 N 18 12 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 117.02 120.30 -3.28 0.50 N 19 13 CB A TYR 37 ? ? CG A TYR 37 ? ? CD1 A TYR 37 ? ? 124.86 121.00 3.86 0.60 N 20 13 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH2 A ARG 41 ? ? 116.35 120.30 -3.95 0.50 N 21 14 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH2 A ARG 45 ? ? 116.71 120.30 -3.59 0.50 N 22 16 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH2 A ARG 41 ? ? 115.61 120.30 -4.69 0.50 N 23 16 N A THR 44 ? ? CA A THR 44 ? ? C A THR 44 ? ? 94.03 111.00 -16.97 2.70 N 24 16 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 116.62 120.30 -3.68 0.50 N 25 17 CB A TYR 37 ? ? CG A TYR 37 ? ? CD1 A TYR 37 ? ? 125.18 121.00 4.18 0.60 N 26 17 NE A ARG 41 ? ? CZ A ARG 41 ? ? NH2 A ARG 41 ? ? 116.55 120.30 -3.75 0.50 N 27 18 CB A TYR 37 ? ? CG A TYR 37 ? ? CD1 A TYR 37 ? ? 125.72 121.00 4.72 0.60 N 28 19 CB A TYR 37 ? ? CG A TYR 37 ? ? CD1 A TYR 37 ? ? 124.63 121.00 3.63 0.60 N 29 19 NE A ARG 48 ? ? CZ A ARG 48 ? ? NH1 A ARG 48 ? ? 116.94 120.30 -3.36 0.50 N 30 20 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH2 A ARG 45 ? ? 117.03 120.30 -3.27 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 8 ? ? -19.94 -43.56 2 1 ASN A 16 ? ? -144.92 -81.65 3 1 ABA A 20 ? ? -58.93 95.80 4 1 SER A 25 ? ? -26.11 -48.47 5 1 ASP A 27 ? ? -146.82 -81.50 6 1 SER A 28 ? ? -156.16 -127.73 7 1 SER A 38 ? ? -133.71 -130.38 8 1 ASP A 40 ? ? 92.78 -2.48 9 1 LEU A 47 ? ? -10.76 62.23 10 2 SER A 8 ? ? -19.89 -53.83 11 2 ASN A 16 ? ? -147.86 -76.02 12 2 ABA A 20 ? ? -59.53 95.39 13 2 GLU A 24 ? ? -37.84 -37.65 14 2 ASP A 27 ? ? -149.50 -80.04 15 2 SER A 28 ? ? -153.46 -133.52 16 2 CYS A 33 ? ? -96.59 -117.73 17 2 SER A 38 ? ? -129.74 -148.27 18 2 ASP A 40 ? ? 122.81 8.68 19 2 LEU A 47 ? ? 88.32 -139.03 20 3 ABA A 6 ? ? -145.38 29.06 21 3 PRO A 7 ? ? -76.47 23.09 22 3 ASN A 16 ? ? -146.69 -67.63 23 3 SER A 25 ? ? -29.93 -49.90 24 3 ASP A 27 ? ? -149.89 -79.42 25 3 SER A 28 ? ? -156.05 -131.94 26 3 SER A 38 ? ? -124.14 -144.43 27 3 ASP A 40 ? ? 29.92 8.91 28 3 CYS A 42 ? ? 76.80 40.53 29 3 LEU A 47 ? ? 70.17 -29.46 30 4 PRO A 7 ? ? -81.87 33.99 31 4 LEU A 15 ? ? -94.13 -72.75 32 4 ASN A 16 ? ? -121.81 -56.66 33 4 ABA A 20 ? ? -59.34 99.25 34 4 GLU A 24 ? ? -38.10 -37.31 35 4 ASP A 27 ? ? -147.28 -82.47 36 4 SER A 28 ? ? -154.52 -125.59 37 4 SER A 38 ? ? -139.20 -137.04 38 4 ASP A 40 ? ? 102.06 -15.66 39 4 ARG A 45 ? ? -16.56 90.32 40 4 LEU A 47 ? ? 67.63 -152.05 41 5 SER A 8 ? ? -19.86 -53.70 42 5 ASN A 16 ? ? -144.67 -82.05 43 5 ABA A 20 ? ? -59.10 97.71 44 5 GLU A 24 ? ? -26.26 -50.51 45 5 SER A 25 ? ? -25.90 -49.06 46 5 ASP A 27 ? ? -146.84 -80.24 47 5 SER A 28 ? ? -156.80 -132.13 48 5 CYS A 33 ? ? -94.62 -124.71 49 5 SER A 38 ? ? -138.17 -131.34 50 5 ASP A 40 ? ? 102.14 -12.70 51 5 LEU A 47 ? ? 89.28 -157.71 52 6 SER A 8 ? ? -19.93 -51.42 53 6 ASN A 16 ? ? -147.07 -66.66 54 6 GLU A 24 ? ? -29.58 -49.29 55 6 SER A 25 ? ? -26.88 -48.48 56 6 ASP A 27 ? ? -147.74 -79.87 57 6 SER A 28 ? ? -156.67 -134.48 58 6 ASN A 32 ? ? -104.13 76.81 59 6 SER A 38 ? ? -136.81 -135.46 60 6 ASP A 40 ? ? 94.65 -11.70 61 6 LEU A 47 ? ? 75.64 -145.51 62 7 PRO A 7 ? ? -85.68 36.68 63 7 ASN A 16 ? ? -143.12 -80.57 64 7 ABA A 20 ? ? -59.77 98.78 65 7 GLU A 24 ? ? -22.78 -54.88 66 7 SER A 25 ? ? -26.52 -45.18 67 7 ASP A 27 ? ? -147.96 -81.77 68 7 SER A 28 ? ? -156.87 -133.25 69 7 SER A 38 ? ? -130.10 -142.54 70 7 ASP A 40 ? ? 139.31 -6.68 71 7 LEU A 47 ? ? 96.64 -147.28 72 8 ABA A 6 ? ? -142.45 42.82 73 8 SER A 8 ? ? -21.27 -41.58 74 8 ASN A 16 ? ? -149.08 -85.96 75 8 ABA A 20 ? ? -59.37 98.27 76 8 GLU A 24 ? ? -36.30 -37.55 77 8 ASP A 27 ? ? -149.67 -79.97 78 8 SER A 28 ? ? -156.65 -135.47 79 8 SER A 38 ? ? -130.91 -135.54 80 8 ASP A 40 ? ? 100.11 -2.83 81 8 LEU A 47 ? ? -2.64 31.02 82 9 SER A 8 ? ? -20.15 -50.52 83 9 ASN A 16 ? ? -139.19 -83.21 84 9 ABA A 20 ? ? -59.02 95.62 85 9 ASP A 27 ? ? -146.71 -82.82 86 9 SER A 28 ? ? -153.11 -131.39 87 9 SER A 38 ? ? -132.32 -134.59 88 9 ASP A 40 ? ? 104.62 -7.57 89 9 CYS A 42 ? ? 70.27 31.20 90 10 ASN A 16 ? ? -149.82 -59.91 91 10 ABA A 20 ? ? -59.95 91.48 92 10 GLU A 24 ? ? -38.84 -37.18 93 10 ASP A 27 ? ? -144.49 -84.60 94 10 SER A 28 ? ? -149.80 -131.56 95 10 SER A 38 ? ? -125.29 -159.46 96 10 ASP A 40 ? ? 124.28 -0.42 97 10 CYS A 42 ? ? 82.70 37.86 98 11 ASN A 16 ? ? -140.58 -77.84 99 11 GLU A 24 ? ? -29.11 -49.87 100 11 ASP A 27 ? ? -149.61 -80.14 101 11 SER A 28 ? ? -158.33 -133.20 102 11 SER A 38 ? ? -142.07 -136.24 103 11 ASP A 40 ? ? 137.68 -2.03 104 11 ARG A 41 ? ? -140.93 -7.06 105 11 CYS A 42 ? ? 73.79 35.07 106 12 ASN A 16 ? ? -146.22 -69.98 107 12 ABA A 20 ? ? -63.72 95.82 108 12 GLU A 24 ? ? -37.63 -38.94 109 12 ASP A 27 ? ? -145.98 -82.44 110 12 SER A 28 ? ? -150.95 -139.63 111 12 CYS A 33 ? ? -84.27 -119.86 112 12 SER A 38 ? ? -132.73 -147.57 113 12 ASP A 40 ? ? 136.59 -9.53 114 12 CYS A 42 ? ? 79.82 35.88 115 13 ASN A 16 ? ? -146.77 -77.05 116 13 ABA A 20 ? ? -60.98 97.46 117 13 GLU A 24 ? ? -29.07 -49.25 118 13 SER A 25 ? ? -26.12 -49.29 119 13 ASP A 27 ? ? -146.95 -81.12 120 13 SER A 28 ? ? -156.15 -132.07 121 13 CYS A 33 ? ? -96.06 -111.89 122 13 SER A 38 ? ? -131.77 -150.41 123 13 ASP A 40 ? ? 122.59 4.23 124 13 CYS A 42 ? ? 77.00 35.79 125 13 LEU A 47 ? ? 91.48 64.16 126 14 SER A 8 ? ? -19.82 -54.81 127 14 ASN A 16 ? ? -141.35 -83.09 128 14 GLU A 24 ? ? -20.12 -56.93 129 14 SER A 25 ? ? -26.26 -49.14 130 14 ASP A 27 ? ? -146.53 -81.14 131 14 SER A 28 ? ? -157.32 -132.70 132 14 SER A 38 ? ? -132.44 -134.16 133 14 ASP A 40 ? ? 105.00 -8.24 134 14 LEU A 47 ? ? 76.81 117.59 135 15 ASN A 16 ? ? -149.46 -67.71 136 15 ABA A 20 ? ? -59.87 92.77 137 15 GLU A 24 ? ? -25.94 -52.41 138 15 SER A 25 ? ? -25.83 -49.37 139 15 ASP A 27 ? ? -147.20 -80.84 140 15 SER A 28 ? ? -159.34 -130.98 141 15 CYS A 33 ? ? -90.95 -114.50 142 15 SER A 38 ? ? -130.77 -146.66 143 15 ASP A 40 ? ? 128.32 4.97 144 15 CYS A 42 ? ? 85.54 37.73 145 15 LEU A 47 ? ? 80.58 -148.50 146 16 ASN A 16 ? ? -142.07 -82.21 147 16 GLU A 24 ? ? -23.05 -56.81 148 16 SER A 25 ? ? -28.03 -44.22 149 16 ASP A 27 ? ? -145.19 -82.63 150 16 SER A 28 ? ? -156.30 -138.87 151 16 SER A 38 ? ? -142.73 -137.18 152 16 ASP A 40 ? ? 106.94 -6.83 153 16 LEU A 47 ? ? -46.72 70.78 154 17 ASN A 16 ? ? -134.72 -52.62 155 17 GLU A 24 ? ? -29.16 -50.91 156 17 ASP A 27 ? ? -148.20 -83.55 157 17 SER A 28 ? ? -148.92 -136.04 158 17 SER A 38 ? ? -129.06 -161.23 159 17 ASP A 40 ? ? 43.71 -13.78 160 17 CYS A 42 ? ? 82.01 43.86 161 17 LEU A 47 ? ? 57.91 12.96 162 18 SER A 8 ? ? -19.91 -49.84 163 18 ASN A 16 ? ? -141.51 -85.54 164 18 ABA A 20 ? ? -59.06 95.92 165 18 GLU A 24 ? ? -34.77 -39.89 166 18 ASP A 27 ? ? -148.09 -81.98 167 18 SER A 28 ? ? -152.76 -131.54 168 18 SER A 38 ? ? -132.54 -133.65 169 18 ASP A 40 ? ? 104.57 -5.24 170 18 CYS A 42 ? ? 71.17 30.90 171 18 LEU A 47 ? ? 78.55 47.86 172 19 SER A 8 ? ? -20.14 -51.91 173 19 ASN A 16 ? ? -140.58 -82.52 174 19 ABA A 20 ? ? -59.79 92.55 175 19 GLU A 24 ? ? -27.47 -52.96 176 19 SER A 25 ? ? -25.08 -46.98 177 19 ASP A 27 ? ? -147.03 -81.62 178 19 SER A 28 ? ? -157.44 -131.77 179 19 SER A 38 ? ? -131.70 -137.98 180 19 ASP A 40 ? ? 105.07 -8.88 181 19 LEU A 47 ? ? 80.61 -144.35 182 20 SER A 8 ? ? -19.81 -54.21 183 20 ASN A 16 ? ? -144.12 -83.23 184 20 ABA A 20 ? ? -59.09 96.78 185 20 ASP A 27 ? ? -149.32 -80.67 186 20 SER A 28 ? ? -153.86 -131.11 187 20 SER A 38 ? ? -131.62 -139.92 188 20 ASP A 40 ? ? 105.63 -6.11 189 20 CYS A 42 ? ? 72.20 32.40 190 20 ASP A 46 ? ? -83.41 46.22 191 20 LEU A 47 ? ? 13.10 25.27 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 41 ? ? 0.299 'SIDE CHAIN' 2 1 ARG A 45 ? ? 0.274 'SIDE CHAIN' 3 1 ARG A 48 ? ? 0.299 'SIDE CHAIN' 4 2 ARG A 41 ? ? 0.294 'SIDE CHAIN' 5 2 ARG A 45 ? ? 0.263 'SIDE CHAIN' 6 2 ARG A 48 ? ? 0.305 'SIDE CHAIN' 7 3 ARG A 41 ? ? 0.207 'SIDE CHAIN' 8 3 ARG A 45 ? ? 0.268 'SIDE CHAIN' 9 3 ARG A 48 ? ? 0.319 'SIDE CHAIN' 10 4 ARG A 41 ? ? 0.280 'SIDE CHAIN' 11 4 ARG A 45 ? ? 0.303 'SIDE CHAIN' 12 4 ARG A 48 ? ? 0.298 'SIDE CHAIN' 13 5 ARG A 41 ? ? 0.297 'SIDE CHAIN' 14 5 ARG A 45 ? ? 0.313 'SIDE CHAIN' 15 5 ARG A 48 ? ? 0.277 'SIDE CHAIN' 16 6 ARG A 41 ? ? 0.137 'SIDE CHAIN' 17 6 ARG A 45 ? ? 0.312 'SIDE CHAIN' 18 6 ARG A 48 ? ? 0.308 'SIDE CHAIN' 19 7 ARG A 41 ? ? 0.251 'SIDE CHAIN' 20 7 ARG A 45 ? ? 0.316 'SIDE CHAIN' 21 7 ARG A 48 ? ? 0.278 'SIDE CHAIN' 22 8 ARG A 41 ? ? 0.135 'SIDE CHAIN' 23 8 ARG A 45 ? ? 0.103 'SIDE CHAIN' 24 8 ARG A 48 ? ? 0.292 'SIDE CHAIN' 25 9 ARG A 41 ? ? 0.224 'SIDE CHAIN' 26 9 ARG A 45 ? ? 0.253 'SIDE CHAIN' 27 9 ARG A 48 ? ? 0.303 'SIDE CHAIN' 28 10 ARG A 45 ? ? 0.279 'SIDE CHAIN' 29 10 ARG A 48 ? ? 0.294 'SIDE CHAIN' 30 11 ARG A 41 ? ? 0.258 'SIDE CHAIN' 31 11 ARG A 45 ? ? 0.268 'SIDE CHAIN' 32 11 ARG A 48 ? ? 0.267 'SIDE CHAIN' 33 12 ARG A 41 ? ? 0.177 'SIDE CHAIN' 34 12 ARG A 45 ? ? 0.260 'SIDE CHAIN' 35 12 ARG A 48 ? ? 0.319 'SIDE CHAIN' 36 13 ARG A 41 ? ? 0.231 'SIDE CHAIN' 37 13 ARG A 45 ? ? 0.313 'SIDE CHAIN' 38 13 ARG A 48 ? ? 0.304 'SIDE CHAIN' 39 14 ARG A 41 ? ? 0.245 'SIDE CHAIN' 40 14 ARG A 45 ? ? 0.292 'SIDE CHAIN' 41 14 ARG A 48 ? ? 0.247 'SIDE CHAIN' 42 15 ARG A 41 ? ? 0.284 'SIDE CHAIN' 43 15 ARG A 45 ? ? 0.302 'SIDE CHAIN' 44 15 ARG A 48 ? ? 0.186 'SIDE CHAIN' 45 16 ARG A 41 ? ? 0.245 'SIDE CHAIN' 46 16 ARG A 45 ? ? 0.312 'SIDE CHAIN' 47 16 ARG A 48 ? ? 0.303 'SIDE CHAIN' 48 17 ARG A 41 ? ? 0.147 'SIDE CHAIN' 49 17 ARG A 45 ? ? 0.222 'SIDE CHAIN' 50 17 ARG A 48 ? ? 0.292 'SIDE CHAIN' 51 18 ARG A 41 ? ? 0.235 'SIDE CHAIN' 52 18 ARG A 45 ? ? 0.286 'SIDE CHAIN' 53 18 ARG A 48 ? ? 0.304 'SIDE CHAIN' 54 19 ARG A 41 ? ? 0.236 'SIDE CHAIN' 55 19 ARG A 45 ? ? 0.313 'SIDE CHAIN' 56 19 ARG A 48 ? ? 0.322 'SIDE CHAIN' 57 20 ARG A 41 ? ? 0.243 'SIDE CHAIN' 58 20 ARG A 45 ? ? 0.290 'SIDE CHAIN' 59 20 ARG A 48 ? ? 0.315 'SIDE CHAIN' #