data_1AAX # _entry.id 1AAX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AAX pdb_00001aax 10.2210/pdb1aax/pdb WWPDB D_1000170603 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AAX _pdbx_database_status.recvd_initial_deposition_date 1997-01-16 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Puius, Y.A.' 1 'Zhao, Y.' 2 'Sullivan, M.' 3 'Lawrence, D.' 4 'Almo, S.C.' 5 'Zhang, Z.-Y.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Identification of a second aryl phosphate-binding site in protein-tyrosine phosphatase 1B: a paradigm for inhibitor design.' Proc.Natl.Acad.Sci.USA 94 13420 13425 1997 PNASA6 US 0027-8424 0040 ? 9391040 10.1073/pnas.94.25.13420 1 'Potent Low Molecular Weight Substrates for Protein-Tyrosine Phosphatase' J.Biol.Chem. 271 7868 ? 1996 JBCHA3 US 0021-9258 0071 ? ? ? 2 'Structural Basis for Phosphotyrosine Peptide Recognition by Protein Tyrosine Phosphatase 1B' Science 268 1754 ? 1995 SCIEAS US 0036-8075 0038 ? ? ? 3 'Crystal Structure of Human Protein Tyrosine Phosphatase 1B' Science 263 1397 ? 1994 SCIEAS US 0036-8075 0038 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Puius, Y.A.' 1 ? primary 'Zhao, Y.' 2 ? primary 'Sullivan, M.' 3 ? primary 'Lawrence, D.S.' 4 ? primary 'Almo, S.C.' 5 ? primary 'Zhang, Z.Y.' 6 ? 1 'Montserat, J.' 7 ? 1 'Chen, L.' 8 ? 1 'Lawrence, D.S.' 9 ? 1 'Zhang, Z.Y.' 10 ? 2 'Jia, Z.' 11 ? 2 'Barford, D.' 12 ? 2 'Flint, A.J.' 13 ? 2 'Tonks, N.K.' 14 ? 3 'Barford, D.' 15 ? 3 'Flint, A.J.' 16 ? 3 'Tonks, N.K.' 17 ? # _cell.entry_id 1AAX _cell.length_a 88.369 _cell.length_b 88.369 _cell.length_c 104.532 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AAX _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN TYROSINE PHOSPHATASE 1B' 37277.512 1 3.1.3.48 C215S ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn '4-PHOSPHONOOXY-PHENYL-METHYL-[4-PHOSPHONOOXY]BENZEN' 360.193 2 ? ? ? ? 4 water nat water 18.015 233 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRS YILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHSSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPGHIPPPPRPPKRILEPH N ; _entity_poly.pdbx_seq_one_letter_code_can ;MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRS YILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHSSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPGHIPPPPRPPKRILEPH N ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 MET n 1 4 GLU n 1 5 LYS n 1 6 GLU n 1 7 PHE n 1 8 GLU n 1 9 GLN n 1 10 ILE n 1 11 ASP n 1 12 LYS n 1 13 SER n 1 14 GLY n 1 15 SER n 1 16 TRP n 1 17 ALA n 1 18 ALA n 1 19 ILE n 1 20 TYR n 1 21 GLN n 1 22 ASP n 1 23 ILE n 1 24 ARG n 1 25 HIS n 1 26 GLU n 1 27 ALA n 1 28 SER n 1 29 ASP n 1 30 PHE n 1 31 PRO n 1 32 CYS n 1 33 ARG n 1 34 VAL n 1 35 ALA n 1 36 LYS n 1 37 LEU n 1 38 PRO n 1 39 LYS n 1 40 ASN n 1 41 LYS n 1 42 ASN n 1 43 ARG n 1 44 ASN n 1 45 ARG n 1 46 TYR n 1 47 ARG n 1 48 ASP n 1 49 VAL n 1 50 SER n 1 51 PRO n 1 52 PHE n 1 53 ASP n 1 54 HIS n 1 55 SER n 1 56 ARG n 1 57 ILE n 1 58 LYS n 1 59 LEU n 1 60 HIS n 1 61 GLN n 1 62 GLU n 1 63 ASP n 1 64 ASN n 1 65 ASP n 1 66 TYR n 1 67 ILE n 1 68 ASN n 1 69 ALA n 1 70 SER n 1 71 LEU n 1 72 ILE n 1 73 LYS n 1 74 MET n 1 75 GLU n 1 76 GLU n 1 77 ALA n 1 78 GLN n 1 79 ARG n 1 80 SER n 1 81 TYR n 1 82 ILE n 1 83 LEU n 1 84 THR n 1 85 GLN n 1 86 GLY n 1 87 PRO n 1 88 LEU n 1 89 PRO n 1 90 ASN n 1 91 THR n 1 92 CYS n 1 93 GLY n 1 94 HIS n 1 95 PHE n 1 96 TRP n 1 97 GLU n 1 98 MET n 1 99 VAL n 1 100 TRP n 1 101 GLU n 1 102 GLN n 1 103 LYS n 1 104 SER n 1 105 ARG n 1 106 GLY n 1 107 VAL n 1 108 VAL n 1 109 MET n 1 110 LEU n 1 111 ASN n 1 112 ARG n 1 113 VAL n 1 114 MET n 1 115 GLU n 1 116 LYS n 1 117 GLY n 1 118 SER n 1 119 LEU n 1 120 LYS n 1 121 CYS n 1 122 ALA n 1 123 GLN n 1 124 TYR n 1 125 TRP n 1 126 PRO n 1 127 GLN n 1 128 LYS n 1 129 GLU n 1 130 GLU n 1 131 LYS n 1 132 GLU n 1 133 MET n 1 134 ILE n 1 135 PHE n 1 136 GLU n 1 137 ASP n 1 138 THR n 1 139 ASN n 1 140 LEU n 1 141 LYS n 1 142 LEU n 1 143 THR n 1 144 LEU n 1 145 ILE n 1 146 SER n 1 147 GLU n 1 148 ASP n 1 149 ILE n 1 150 LYS n 1 151 SER n 1 152 TYR n 1 153 TYR n 1 154 THR n 1 155 VAL n 1 156 ARG n 1 157 GLN n 1 158 LEU n 1 159 GLU n 1 160 LEU n 1 161 GLU n 1 162 ASN n 1 163 LEU n 1 164 THR n 1 165 THR n 1 166 GLN n 1 167 GLU n 1 168 THR n 1 169 ARG n 1 170 GLU n 1 171 ILE n 1 172 LEU n 1 173 HIS n 1 174 PHE n 1 175 HIS n 1 176 TYR n 1 177 THR n 1 178 THR n 1 179 TRP n 1 180 PRO n 1 181 ASP n 1 182 PHE n 1 183 GLY n 1 184 VAL n 1 185 PRO n 1 186 GLU n 1 187 SER n 1 188 PRO n 1 189 ALA n 1 190 SER n 1 191 PHE n 1 192 LEU n 1 193 ASN n 1 194 PHE n 1 195 LEU n 1 196 PHE n 1 197 LYS n 1 198 VAL n 1 199 ARG n 1 200 GLU n 1 201 SER n 1 202 GLY n 1 203 SER n 1 204 LEU n 1 205 SER n 1 206 PRO n 1 207 GLU n 1 208 HIS n 1 209 GLY n 1 210 PRO n 1 211 VAL n 1 212 VAL n 1 213 VAL n 1 214 HIS n 1 215 SER n 1 216 SER n 1 217 ALA n 1 218 GLY n 1 219 ILE n 1 220 GLY n 1 221 ARG n 1 222 SER n 1 223 GLY n 1 224 THR n 1 225 PHE n 1 226 CYS n 1 227 LEU n 1 228 ALA n 1 229 ASP n 1 230 THR n 1 231 CYS n 1 232 LEU n 1 233 LEU n 1 234 LEU n 1 235 MET n 1 236 ASP n 1 237 LYS n 1 238 ARG n 1 239 LYS n 1 240 ASP n 1 241 PRO n 1 242 SER n 1 243 SER n 1 244 VAL n 1 245 ASP n 1 246 ILE n 1 247 LYS n 1 248 LYS n 1 249 VAL n 1 250 LEU n 1 251 LEU n 1 252 GLU n 1 253 MET n 1 254 ARG n 1 255 LYS n 1 256 PHE n 1 257 ARG n 1 258 MET n 1 259 GLY n 1 260 LEU n 1 261 ILE n 1 262 GLN n 1 263 THR n 1 264 ALA n 1 265 ASP n 1 266 GLN n 1 267 LEU n 1 268 ARG n 1 269 PHE n 1 270 SER n 1 271 TYR n 1 272 LEU n 1 273 ALA n 1 274 VAL n 1 275 ILE n 1 276 GLU n 1 277 GLY n 1 278 ALA n 1 279 LYS n 1 280 PHE n 1 281 ILE n 1 282 MET n 1 283 GLY n 1 284 ASP n 1 285 SER n 1 286 SER n 1 287 VAL n 1 288 GLN n 1 289 ASP n 1 290 GLN n 1 291 TRP n 1 292 LYS n 1 293 GLU n 1 294 LEU n 1 295 SER n 1 296 HIS n 1 297 GLU n 1 298 ASP n 1 299 LEU n 1 300 GLU n 1 301 PRO n 1 302 PRO n 1 303 PRO n 1 304 GLY n 1 305 HIS n 1 306 ILE n 1 307 PRO n 1 308 PRO n 1 309 PRO n 1 310 PRO n 1 311 ARG n 1 312 PRO n 1 313 PRO n 1 314 LYS n 1 315 ARG n 1 316 ILE n 1 317 LEU n 1 318 GLU n 1 319 PRO n 1 320 HIS n 1 321 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PUC118-PTP1B/C215S _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTN1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P18031 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRS YILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPH NGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDED HALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AAX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 321 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P18031 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 321 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 321 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1AAX SER A 215 ? UNP P18031 CYS 215 'engineered mutation' 215 1 1 1AAX GLY A 304 ? UNP P18031 GLU 304 conflict 304 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BPM non-polymer . '4-PHOSPHONOOXY-PHENYL-METHYL-[4-PHOSPHONOOXY]BENZEN' 'bis-(para-phosphophenyl)' 'C13 H14 O8 P2' 360.193 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1AAX _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.16 _exptl_crystal.density_percent_sol 61.06 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 7.5' # _diffrn.id 1 _diffrn.ambient_temp 140 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type FUJI _diffrn_detector.pdbx_collection_date 1996-02 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.20 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X9B' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X9B _diffrn_source.pdbx_wavelength 1.20 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1AAX _reflns.observed_criterion_sigma_I 0. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 22.0 _reflns.d_resolution_high 1.9 _reflns.number_obs 31197 _reflns.number_all ? _reflns.percent_possible_obs 82.1 _reflns.pdbx_Rmerge_I_obs 0.0520000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 24.7 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.90 _reflns_shell.d_res_low 1.97 _reflns_shell.percent_possible_all 69.2 _reflns_shell.Rmerge_I_obs 0.2670000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.9 _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1AAX _refine.ls_number_reflns_obs 31197 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 22.0 _refine.ls_d_res_high 1.9 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1820000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1820000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 25.8 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 2HNQ' _refine.pdbx_method_to_determine_struct 'DIFFERENCE FOURIER' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2426 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 47 _refine_hist.number_atoms_solvent 233 _refine_hist.number_atoms_total 2706 _refine_hist.d_res_high 1.9 _refine_hist.d_res_low 22.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.85 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 1.90 _refine_ls_shell.d_res_low 1.97 _refine_ls_shell.number_reflns_R_work 2558 _refine_ls_shell.R_factor_R_work 0.2700000 _refine_ls_shell.percent_reflns_obs 69.2 _refine_ls_shell.R_factor_R_free ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 1AAX _struct.title 'CRYSTAL STRUCTURE OF PROTEIN TYROSINE PHOSPHATASE 1B COMPLEXED WITH TWO BIS(PARA-PHOSPHOPHENYL)METHANE (BPPM) MOLECULES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AAX _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'COMPLEX (HYDROLASE-INHIBITOR), HYDROLASE, PHOSPHORYLATION, NON-PEPTIDE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 3 ? SER A 13 ? MET A 3 SER A 13 1 ? 11 HELX_P HELX_P2 2 TRP A 16 ? GLU A 26 ? TRP A 16 GLU A 26 1 ? 11 HELX_P HELX_P3 3 PRO A 38 ? ARG A 43 ? PRO A 38 ARG A 43 5 ? 6 HELX_P HELX_P4 4 CYS A 92 ? GLU A 101 ? CYS A 92 GLU A 101 1 ? 10 HELX_P HELX_P5 5 PRO A 188 ? SER A 201 ? PRO A 188 SER A 201 1 ? 14 HELX_P HELX_P6 6 GLY A 220 ? ARG A 238 ? GLY A 220 ARG A 238 1 ? 19 HELX_P HELX_P7 7 PRO A 241 ? SER A 243 ? PRO A 241 SER A 243 5 ? 3 HELX_P HELX_P8 8 ILE A 246 ? LYS A 255 ? ILE A 246 LYS A 255 1 ? 10 HELX_P HELX_P9 9 ALA A 264 ? ILE A 281 ? ALA A 264 ILE A 281 1 ? 18 HELX_P HELX_P10 10 SER A 285 ? SER A 295 ? SER A 285 SER A 295 5 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? B MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 401 A HOH 728 1_555 ? ? ? ? ? ? ? 2.059 ? ? metalc2 metalc ? ? B MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 401 A HOH 729 1_555 ? ? ? ? ? ? ? 2.050 ? ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 401 A HOH 730 1_555 ? ? ? ? ? ? ? 2.077 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 401 A HOH 731 1_555 ? ? ? ? ? ? ? 2.046 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 401 A HOH 732 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 E HOH . O ? ? A MG 401 A HOH 733 1_555 ? ? ? ? ? ? ? 2.065 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 69 ? MET A 74 ? ALA A 69 MET A 74 A 2 ARG A 79 ? THR A 84 ? ARG A 79 THR A 84 A 3 VAL A 211 ? HIS A 214 ? VAL A 211 HIS A 214 A 4 GLY A 106 ? MET A 109 ? GLY A 106 MET A 109 A 5 GLU A 167 ? TYR A 176 ? GLU A 167 TYR A 176 A 6 TYR A 153 ? ASN A 162 ? TYR A 153 ASN A 162 A 7 LEU A 140 ? ILE A 149 ? LEU A 140 ILE A 149 A 8 MET A 133 ? PHE A 135 ? MET A 133 PHE A 135 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O SER A 70 ? O SER A 70 N LEU A 83 ? N LEU A 83 A 2 3 O ILE A 82 ? O ILE A 82 N VAL A 211 ? N VAL A 211 A 3 4 O VAL A 212 ? O VAL A 212 N VAL A 108 ? N VAL A 108 A 4 5 O VAL A 107 ? O VAL A 107 N LEU A 172 ? N LEU A 172 A 5 6 O GLU A 167 ? O GLU A 167 N ASN A 162 ? N ASN A 162 A 6 7 O VAL A 155 ? O VAL A 155 N ASP A 148 ? N ASP A 148 A 7 8 O LEU A 140 ? O LEU A 140 N PHE A 135 ? N PHE A 135 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 401 ? 6 'BINDING SITE FOR RESIDUE MG A 401' AC2 Software A BPM 402 ? 14 'BINDING SITE FOR RESIDUE BPM A 402' AC3 Software A BPM 403 ? 9 'BINDING SITE FOR RESIDUE BPM A 403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 HOH E . ? HOH A 728 . ? 1_555 ? 2 AC1 6 HOH E . ? HOH A 729 . ? 1_555 ? 3 AC1 6 HOH E . ? HOH A 730 . ? 1_555 ? 4 AC1 6 HOH E . ? HOH A 731 . ? 1_555 ? 5 AC1 6 HOH E . ? HOH A 732 . ? 1_555 ? 6 AC1 6 HOH E . ? HOH A 733 . ? 1_555 ? 7 AC2 14 TYR A 46 ? TYR A 46 . ? 1_555 ? 8 AC2 14 PHE A 182 ? PHE A 182 . ? 1_555 ? 9 AC2 14 SER A 215 ? SER A 215 . ? 1_555 ? 10 AC2 14 SER A 216 ? SER A 216 . ? 1_555 ? 11 AC2 14 ALA A 217 ? ALA A 217 . ? 1_555 ? 12 AC2 14 GLY A 218 ? GLY A 218 . ? 1_555 ? 13 AC2 14 ILE A 219 ? ILE A 219 . ? 1_555 ? 14 AC2 14 GLY A 220 ? GLY A 220 . ? 1_555 ? 15 AC2 14 ARG A 221 ? ARG A 221 . ? 1_555 ? 16 AC2 14 SER A 285 ? SER A 285 . ? 3_664 ? 17 AC2 14 SER A 286 ? SER A 286 . ? 3_664 ? 18 AC2 14 ASP A 289 ? ASP A 289 . ? 3_664 ? 19 AC2 14 HOH E . ? HOH A 528 . ? 1_555 ? 20 AC2 14 HOH E . ? HOH A 708 . ? 1_555 ? 21 AC3 9 ARG A 24 ? ARG A 24 . ? 1_555 ? 22 AC3 9 ASP A 48 ? ASP A 48 . ? 1_555 ? 23 AC3 9 VAL A 49 ? VAL A 49 . ? 1_555 ? 24 AC3 9 ARG A 254 ? ARG A 254 . ? 1_555 ? 25 AC3 9 GLY A 259 ? GLY A 259 . ? 1_555 ? 26 AC3 9 GLN A 262 ? GLN A 262 . ? 1_555 ? 27 AC3 9 HOH E . ? HOH A 520 . ? 1_555 ? 28 AC3 9 HOH E . ? HOH A 529 . ? 1_555 ? 29 AC3 9 HOH E . ? HOH A 652 . ? 1_555 ? # _database_PDB_matrix.entry_id 1AAX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1AAX _atom_sites.fract_transf_matrix[1][1] 0.011316 _atom_sites.fract_transf_matrix[1][2] 0.006533 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013067 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009566 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 CYS 92 92 92 CYS CYS A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 TRP 100 100 100 TRP TRP A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 GLN 102 102 102 GLN GLN A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 MET 114 114 114 MET MET A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 CYS 121 121 121 CYS CYS A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 TRP 125 125 125 TRP TRP A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 GLN 127 127 127 GLN GLN A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 MET 133 133 133 MET MET A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 TYR 153 153 153 TYR TYR A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 ARG 169 169 169 ARG ARG A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 HIS 175 175 175 HIS HIS A . n A 1 176 TYR 176 176 176 TYR TYR A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 TRP 179 179 179 TRP TRP A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 ASN 193 193 193 ASN ASN A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 ARG 199 199 199 ARG ARG A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 HIS 208 208 208 HIS HIS A . n A 1 209 GLY 209 209 209 GLY GLY A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 HIS 214 214 214 HIS HIS A . n A 1 215 SER 215 215 215 SER SER A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 ALA 217 217 217 ALA ALA A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 ARG 221 221 221 ARG ARG A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 THR 224 224 224 THR THR A . n A 1 225 PHE 225 225 225 PHE PHE A . n A 1 226 CYS 226 226 226 CYS CYS A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ASP 229 229 229 ASP ASP A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 CYS 231 231 231 CYS CYS A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 LEU 234 234 234 LEU LEU A . n A 1 235 MET 235 235 235 MET MET A . n A 1 236 ASP 236 236 236 ASP ASP A . n A 1 237 LYS 237 237 237 LYS LYS A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 ASP 240 240 240 ASP ASP A . n A 1 241 PRO 241 241 241 PRO PRO A . n A 1 242 SER 242 242 242 SER SER A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 VAL 244 244 244 VAL VAL A . n A 1 245 ASP 245 245 245 ASP ASP A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 LYS 247 247 247 LYS LYS A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 MET 253 253 253 MET MET A . n A 1 254 ARG 254 254 254 ARG ARG A . n A 1 255 LYS 255 255 255 LYS LYS A . n A 1 256 PHE 256 256 256 PHE PHE A . n A 1 257 ARG 257 257 257 ARG ARG A . n A 1 258 MET 258 258 258 MET MET A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 LEU 260 260 260 LEU LEU A . n A 1 261 ILE 261 261 261 ILE ILE A . n A 1 262 GLN 262 262 262 GLN GLN A . n A 1 263 THR 263 263 263 THR THR A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 ASP 265 265 265 ASP ASP A . n A 1 266 GLN 266 266 266 GLN GLN A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 ARG 268 268 268 ARG ARG A . n A 1 269 PHE 269 269 269 PHE PHE A . n A 1 270 SER 270 270 270 SER SER A . n A 1 271 TYR 271 271 271 TYR TYR A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 ALA 273 273 273 ALA ALA A . n A 1 274 VAL 274 274 274 VAL VAL A . n A 1 275 ILE 275 275 275 ILE ILE A . n A 1 276 GLU 276 276 276 GLU GLU A . n A 1 277 GLY 277 277 277 GLY GLY A . n A 1 278 ALA 278 278 278 ALA ALA A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 PHE 280 280 280 PHE PHE A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 MET 282 282 282 MET MET A . n A 1 283 GLY 283 283 283 GLY GLY A . n A 1 284 ASP 284 284 284 ASP ASP A . n A 1 285 SER 285 285 285 SER SER A . n A 1 286 SER 286 286 286 SER SER A . n A 1 287 VAL 287 287 287 VAL VAL A . n A 1 288 GLN 288 288 288 GLN GLN A . n A 1 289 ASP 289 289 289 ASP ASP A . n A 1 290 GLN 290 290 290 GLN GLN A . n A 1 291 TRP 291 291 291 TRP TRP A . n A 1 292 LYS 292 292 292 LYS LYS A . n A 1 293 GLU 293 293 293 GLU GLU A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 SER 295 295 295 SER SER A . n A 1 296 HIS 296 296 296 HIS HIS A . n A 1 297 GLU 297 297 297 GLU GLU A . n A 1 298 ASP 298 298 298 ASP ASP A . n A 1 299 LEU 299 299 ? ? ? A . n A 1 300 GLU 300 300 ? ? ? A . n A 1 301 PRO 301 301 ? ? ? A . n A 1 302 PRO 302 302 ? ? ? A . n A 1 303 PRO 303 303 ? ? ? A . n A 1 304 GLY 304 304 ? ? ? A . n A 1 305 HIS 305 305 ? ? ? A . n A 1 306 ILE 306 306 ? ? ? A . n A 1 307 PRO 307 307 ? ? ? A . n A 1 308 PRO 308 308 ? ? ? A . n A 1 309 PRO 309 309 ? ? ? A . n A 1 310 PRO 310 310 ? ? ? A . n A 1 311 ARG 311 311 ? ? ? A . n A 1 312 PRO 312 312 ? ? ? A . n A 1 313 PRO 313 313 ? ? ? A . n A 1 314 LYS 314 314 ? ? ? A . n A 1 315 ARG 315 315 ? ? ? A . n A 1 316 ILE 316 316 ? ? ? A . n A 1 317 LEU 317 317 ? ? ? A . n A 1 318 GLU 318 318 ? ? ? A . n A 1 319 PRO 319 319 ? ? ? A . n A 1 320 HIS 320 320 ? ? ? A . n A 1 321 ASN 321 321 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 401 1 MG MO6 A . C 3 BPM 1 402 1 BPM BPM A . D 3 BPM 1 403 2 BPM BPM A . E 4 HOH 1 501 1 HOH HOH A . E 4 HOH 2 502 2 HOH HOH A . E 4 HOH 3 503 3 HOH HOH A . E 4 HOH 4 504 4 HOH HOH A . E 4 HOH 5 505 5 HOH HOH A . E 4 HOH 6 506 6 HOH HOH A . E 4 HOH 7 507 7 HOH HOH A . E 4 HOH 8 508 8 HOH HOH A . E 4 HOH 9 509 9 HOH HOH A . E 4 HOH 10 510 10 HOH HOH A . E 4 HOH 11 511 11 HOH HOH A . E 4 HOH 12 512 12 HOH HOH A . E 4 HOH 13 513 13 HOH HOH A . E 4 HOH 14 514 14 HOH HOH A . E 4 HOH 15 515 15 HOH HOH A . E 4 HOH 16 516 16 HOH HOH A . E 4 HOH 17 517 17 HOH HOH A . E 4 HOH 18 518 18 HOH HOH A . E 4 HOH 19 519 19 HOH HOH A . E 4 HOH 20 520 20 HOH HOH A . E 4 HOH 21 521 21 HOH HOH A . E 4 HOH 22 522 22 HOH HOH A . E 4 HOH 23 523 23 HOH HOH A . E 4 HOH 24 524 24 HOH HOH A . E 4 HOH 25 525 25 HOH HOH A . E 4 HOH 26 526 26 HOH HOH A . E 4 HOH 27 527 27 HOH HOH A . E 4 HOH 28 528 28 HOH HOH A . E 4 HOH 29 529 29 HOH HOH A . E 4 HOH 30 530 30 HOH HOH A . E 4 HOH 31 531 31 HOH HOH A . E 4 HOH 32 532 32 HOH HOH A . E 4 HOH 33 533 33 HOH HOH A . E 4 HOH 34 534 34 HOH HOH A . E 4 HOH 35 535 35 HOH HOH A . E 4 HOH 36 536 36 HOH HOH A . E 4 HOH 37 537 37 HOH HOH A . E 4 HOH 38 538 38 HOH HOH A . E 4 HOH 39 539 39 HOH HOH A . E 4 HOH 40 540 40 HOH HOH A . E 4 HOH 41 541 41 HOH HOH A . E 4 HOH 42 542 42 HOH HOH A . E 4 HOH 43 543 43 HOH HOH A . E 4 HOH 44 544 44 HOH HOH A . E 4 HOH 45 545 45 HOH HOH A . E 4 HOH 46 546 46 HOH HOH A . E 4 HOH 47 547 47 HOH HOH A . E 4 HOH 48 548 48 HOH HOH A . E 4 HOH 49 549 49 HOH HOH A . E 4 HOH 50 550 50 HOH HOH A . E 4 HOH 51 551 51 HOH HOH A . E 4 HOH 52 552 52 HOH HOH A . E 4 HOH 53 553 53 HOH HOH A . E 4 HOH 54 554 54 HOH HOH A . E 4 HOH 55 555 55 HOH HOH A . E 4 HOH 56 556 56 HOH HOH A . E 4 HOH 57 557 57 HOH HOH A . E 4 HOH 58 558 58 HOH HOH A . E 4 HOH 59 559 59 HOH HOH A . E 4 HOH 60 560 60 HOH HOH A . E 4 HOH 61 561 61 HOH HOH A . E 4 HOH 62 562 62 HOH HOH A . E 4 HOH 63 563 63 HOH HOH A . E 4 HOH 64 564 64 HOH HOH A . E 4 HOH 65 565 65 HOH HOH A . E 4 HOH 66 566 66 HOH HOH A . E 4 HOH 67 567 67 HOH HOH A . E 4 HOH 68 568 68 HOH HOH A . E 4 HOH 69 569 69 HOH HOH A . E 4 HOH 70 570 70 HOH HOH A . E 4 HOH 71 571 71 HOH HOH A . E 4 HOH 72 572 72 HOH HOH A . E 4 HOH 73 573 73 HOH HOH A . E 4 HOH 74 574 74 HOH HOH A . E 4 HOH 75 575 75 HOH HOH A . E 4 HOH 76 576 76 HOH HOH A . E 4 HOH 77 577 77 HOH HOH A . E 4 HOH 78 578 78 HOH HOH A . E 4 HOH 79 579 79 HOH HOH A . E 4 HOH 80 580 80 HOH HOH A . E 4 HOH 81 581 81 HOH HOH A . E 4 HOH 82 582 82 HOH HOH A . E 4 HOH 83 583 83 HOH HOH A . E 4 HOH 84 584 84 HOH HOH A . E 4 HOH 85 585 85 HOH HOH A . E 4 HOH 86 586 86 HOH HOH A . E 4 HOH 87 587 87 HOH HOH A . E 4 HOH 88 588 88 HOH HOH A . E 4 HOH 89 589 89 HOH HOH A . E 4 HOH 90 590 90 HOH HOH A . E 4 HOH 91 591 91 HOH HOH A . E 4 HOH 92 592 92 HOH HOH A . E 4 HOH 93 593 93 HOH HOH A . E 4 HOH 94 594 94 HOH HOH A . E 4 HOH 95 595 95 HOH HOH A . E 4 HOH 96 596 96 HOH HOH A . E 4 HOH 97 597 97 HOH HOH A . E 4 HOH 98 598 98 HOH HOH A . E 4 HOH 99 599 99 HOH HOH A . E 4 HOH 100 600 100 HOH HOH A . E 4 HOH 101 601 101 HOH HOH A . E 4 HOH 102 602 102 HOH HOH A . E 4 HOH 103 603 103 HOH HOH A . E 4 HOH 104 604 104 HOH HOH A . E 4 HOH 105 605 105 HOH HOH A . E 4 HOH 106 606 106 HOH HOH A . E 4 HOH 107 607 107 HOH HOH A . E 4 HOH 108 608 108 HOH HOH A . E 4 HOH 109 609 109 HOH HOH A . E 4 HOH 110 610 110 HOH HOH A . E 4 HOH 111 611 111 HOH HOH A . E 4 HOH 112 612 112 HOH HOH A . E 4 HOH 113 613 113 HOH HOH A . E 4 HOH 114 614 114 HOH HOH A . E 4 HOH 115 615 115 HOH HOH A . E 4 HOH 116 616 116 HOH HOH A . E 4 HOH 117 617 117 HOH HOH A . E 4 HOH 118 618 118 HOH HOH A . E 4 HOH 119 619 119 HOH HOH A . E 4 HOH 120 620 120 HOH HOH A . E 4 HOH 121 621 121 HOH HOH A . E 4 HOH 122 622 122 HOH HOH A . E 4 HOH 123 623 123 HOH HOH A . E 4 HOH 124 624 124 HOH HOH A . E 4 HOH 125 625 125 HOH HOH A . E 4 HOH 126 626 126 HOH HOH A . E 4 HOH 127 627 127 HOH HOH A . E 4 HOH 128 628 128 HOH HOH A . E 4 HOH 129 629 129 HOH HOH A . E 4 HOH 130 630 130 HOH HOH A . E 4 HOH 131 631 131 HOH HOH A . E 4 HOH 132 632 132 HOH HOH A . E 4 HOH 133 633 133 HOH HOH A . E 4 HOH 134 634 134 HOH HOH A . E 4 HOH 135 635 135 HOH HOH A . E 4 HOH 136 636 136 HOH HOH A . E 4 HOH 137 637 137 HOH HOH A . E 4 HOH 138 638 138 HOH HOH A . E 4 HOH 139 639 139 HOH HOH A . E 4 HOH 140 640 140 HOH HOH A . E 4 HOH 141 641 141 HOH HOH A . E 4 HOH 142 642 142 HOH HOH A . E 4 HOH 143 643 143 HOH HOH A . E 4 HOH 144 644 144 HOH HOH A . E 4 HOH 145 645 145 HOH HOH A . E 4 HOH 146 646 146 HOH HOH A . E 4 HOH 147 647 147 HOH HOH A . E 4 HOH 148 648 148 HOH HOH A . E 4 HOH 149 649 149 HOH HOH A . E 4 HOH 150 650 150 HOH HOH A . E 4 HOH 151 651 151 HOH HOH A . E 4 HOH 152 652 152 HOH HOH A . E 4 HOH 153 653 153 HOH HOH A . E 4 HOH 154 654 154 HOH HOH A . E 4 HOH 155 655 155 HOH HOH A . E 4 HOH 156 656 156 HOH HOH A . E 4 HOH 157 657 157 HOH HOH A . E 4 HOH 158 658 158 HOH HOH A . E 4 HOH 159 659 159 HOH HOH A . E 4 HOH 160 660 160 HOH HOH A . E 4 HOH 161 661 161 HOH HOH A . E 4 HOH 162 662 162 HOH HOH A . E 4 HOH 163 663 163 HOH HOH A . E 4 HOH 164 664 164 HOH HOH A . E 4 HOH 165 665 165 HOH HOH A . E 4 HOH 166 666 166 HOH HOH A . E 4 HOH 167 667 167 HOH HOH A . E 4 HOH 168 668 168 HOH HOH A . E 4 HOH 169 669 169 HOH HOH A . E 4 HOH 170 670 170 HOH HOH A . E 4 HOH 171 671 171 HOH HOH A . E 4 HOH 172 672 172 HOH HOH A . E 4 HOH 173 673 173 HOH HOH A . E 4 HOH 174 674 174 HOH HOH A . E 4 HOH 175 675 175 HOH HOH A . E 4 HOH 176 676 176 HOH HOH A . E 4 HOH 177 677 177 HOH HOH A . E 4 HOH 178 678 178 HOH HOH A . E 4 HOH 179 679 179 HOH HOH A . E 4 HOH 180 680 180 HOH HOH A . E 4 HOH 181 681 181 HOH HOH A . E 4 HOH 182 682 182 HOH HOH A . E 4 HOH 183 683 183 HOH HOH A . E 4 HOH 184 684 184 HOH HOH A . E 4 HOH 185 685 185 HOH HOH A . E 4 HOH 186 686 186 HOH HOH A . E 4 HOH 187 687 187 HOH HOH A . E 4 HOH 188 688 188 HOH HOH A . E 4 HOH 189 689 189 HOH HOH A . E 4 HOH 190 690 190 HOH HOH A . E 4 HOH 191 691 191 HOH HOH A . E 4 HOH 192 692 192 HOH HOH A . E 4 HOH 193 693 193 HOH HOH A . E 4 HOH 194 694 194 HOH HOH A . E 4 HOH 195 695 195 HOH HOH A . E 4 HOH 196 696 196 HOH HOH A . E 4 HOH 197 697 197 HOH HOH A . E 4 HOH 198 698 198 HOH HOH A . E 4 HOH 199 699 199 HOH HOH A . E 4 HOH 200 700 200 HOH HOH A . E 4 HOH 201 701 201 HOH HOH A . E 4 HOH 202 702 202 HOH HOH A . E 4 HOH 203 703 203 HOH HOH A . E 4 HOH 204 704 204 HOH HOH A . E 4 HOH 205 705 205 HOH HOH A . E 4 HOH 206 706 206 HOH HOH A . E 4 HOH 207 707 207 HOH HOH A . E 4 HOH 208 708 208 HOH HOH A . E 4 HOH 209 709 209 HOH HOH A . E 4 HOH 210 710 210 HOH HOH A . E 4 HOH 211 711 211 HOH HOH A . E 4 HOH 212 712 212 HOH HOH A . E 4 HOH 213 713 213 HOH HOH A . E 4 HOH 214 714 214 HOH HOH A . E 4 HOH 215 715 215 HOH HOH A . E 4 HOH 216 716 216 HOH HOH A . E 4 HOH 217 717 217 HOH HOH A . E 4 HOH 218 718 218 HOH HOH A . E 4 HOH 219 719 219 HOH HOH A . E 4 HOH 220 720 220 HOH HOH A . E 4 HOH 221 721 221 HOH HOH A . E 4 HOH 222 722 222 HOH HOH A . E 4 HOH 223 723 223 HOH HOH A . E 4 HOH 224 724 224 HOH HOH A . E 4 HOH 225 725 225 HOH HOH A . E 4 HOH 226 726 226 HOH HOH A . E 4 HOH 227 727 227 HOH HOH A . E 4 HOH 228 728 1 HOH MO6 A . E 4 HOH 229 729 1 HOH MO6 A . E 4 HOH 230 730 1 HOH MO6 A . E 4 HOH 231 731 1 HOH MO6 A . E 4 HOH 232 732 1 HOH MO6 A . E 4 HOH 233 733 1 HOH MO6 A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? E HOH . ? A HOH 728 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 729 ? 1_555 89.5 ? 2 O ? E HOH . ? A HOH 728 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 730 ? 1_555 90.2 ? 3 O ? E HOH . ? A HOH 729 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 730 ? 1_555 89.9 ? 4 O ? E HOH . ? A HOH 728 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 731 ? 1_555 89.7 ? 5 O ? E HOH . ? A HOH 729 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 731 ? 1_555 90.2 ? 6 O ? E HOH . ? A HOH 730 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 731 ? 1_555 179.9 ? 7 O ? E HOH . ? A HOH 728 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 732 ? 1_555 90.2 ? 8 O ? E HOH . ? A HOH 729 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 732 ? 1_555 179.6 ? 9 O ? E HOH . ? A HOH 730 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 732 ? 1_555 90.3 ? 10 O ? E HOH . ? A HOH 731 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 732 ? 1_555 89.6 ? 11 O ? E HOH . ? A HOH 728 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 733 ? 1_555 179.2 ? 12 O ? E HOH . ? A HOH 729 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 733 ? 1_555 89.7 ? 13 O ? E HOH . ? A HOH 730 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 733 ? 1_555 89.7 ? 14 O ? E HOH . ? A HOH 731 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 733 ? 1_555 90.4 ? 15 O ? E HOH . ? A HOH 732 ? 1_555 MG ? B MG . ? A MG 401 ? 1_555 O ? E HOH . ? A HOH 733 ? 1_555 90.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-03-04 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-07-18 5 'Structure model' 1 4 2021-11-03 6 'Structure model' 1 5 2023-08-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Non-polymer description' 4 5 'Structure model' 'Database references' 5 5 'Structure model' 'Derived calculations' 6 5 'Structure model' Other 7 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_database_status 3 5 'Structure model' struct_ref_seq_dif 4 5 'Structure model' struct_site 5 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.process_site' 4 5 'Structure model' '_struct_ref_seq_dif.details' 5 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 X-PLOR phasing 3.1 ? 5 # _pdbx_entry_details.entry_id 1AAX _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ;BPPM MOLECULES A AND B BIND PTP1B IN MUTUALLY EXCLUSIVE MODES. ; _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 121 ? ? -172.07 145.38 2 1 LYS A 131 ? ? -117.92 72.70 3 1 SER A 215 ? ? -136.71 -145.30 4 1 ILE A 219 ? ? -138.65 -41.15 5 1 ILE A 261 ? ? 81.05 111.57 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LEU 299 ? A LEU 299 3 1 Y 1 A GLU 300 ? A GLU 300 4 1 Y 1 A PRO 301 ? A PRO 301 5 1 Y 1 A PRO 302 ? A PRO 302 6 1 Y 1 A PRO 303 ? A PRO 303 7 1 Y 1 A GLY 304 ? A GLY 304 8 1 Y 1 A HIS 305 ? A HIS 305 9 1 Y 1 A ILE 306 ? A ILE 306 10 1 Y 1 A PRO 307 ? A PRO 307 11 1 Y 1 A PRO 308 ? A PRO 308 12 1 Y 1 A PRO 309 ? A PRO 309 13 1 Y 1 A PRO 310 ? A PRO 310 14 1 Y 1 A ARG 311 ? A ARG 311 15 1 Y 1 A PRO 312 ? A PRO 312 16 1 Y 1 A PRO 313 ? A PRO 313 17 1 Y 1 A LYS 314 ? A LYS 314 18 1 Y 1 A ARG 315 ? A ARG 315 19 1 Y 1 A ILE 316 ? A ILE 316 20 1 Y 1 A LEU 317 ? A LEU 317 21 1 Y 1 A GLU 318 ? A GLU 318 22 1 Y 1 A PRO 319 ? A PRO 319 23 1 Y 1 A HIS 320 ? A HIS 320 24 1 Y 1 A ASN 321 ? A ASN 321 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 '4-PHOSPHONOOXY-PHENYL-METHYL-[4-PHOSPHONOOXY]BENZEN' BPM 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2HNQ _pdbx_initial_refinement_model.details 'PDB ENTRY 2HNQ' #