data_1ABZ # _entry.id 1ABZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ABZ pdb_00001abz 10.2210/pdb1abz/pdb WWPDB D_1000170637 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ABZ _pdbx_database_status.recvd_initial_deposition_date 1997-01-31 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fezoui, Y.' 1 'Connolly, P.J.' 2 'Osterhout, J.J.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution structure of alpha t alpha, a helical hairpin peptide of de novo design.' 'Protein Sci.' 6 1869 1877 1997 PRCIEI US 0961-8368 0795 ? 9300486 ? 1 ;De Novo Design and Structural Characterization of an Alpha-Helical Hairpin Peptide: A Model System for the Study of Protein Folding Intermediates ; Proc.Natl.Acad.Sci.USA 91 3675 ? 1994 PNASA6 US 0027-8424 0040 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fezoui, Y.' 1 ? primary 'Connolly, P.J.' 2 ? primary 'Osterhout, J.J.' 3 ? 1 'Fezoui, Y.' 4 ? 1 'Weaver, D.L.' 5 ? 1 'Osterhout, J.J.' 6 ? # _cell.entry_id 1ABZ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ABZ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description ALPHA-T-ALPHA _entity.formula_weight 4446.004 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'DE NOVO DESIGNED PEPTIDE' # _entity_name_com.entity_id 1 _entity_name_com.name ATA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(SIN)DWLKARVEQELQALEARGTDSNAELRAMEAKLKAEIQK(NH2)' _entity_poly.pdbx_seq_one_letter_code_can XDWLKARVEQELQALEARGTDSNAELRAMEAKLKAEIQKX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SIN n 1 2 ASP n 1 3 TRP n 1 4 LEU n 1 5 LYS n 1 6 ALA n 1 7 ARG n 1 8 VAL n 1 9 GLU n 1 10 GLN n 1 11 GLU n 1 12 LEU n 1 13 GLN n 1 14 ALA n 1 15 LEU n 1 16 GLU n 1 17 ALA n 1 18 ARG n 1 19 GLY n 1 20 THR n 1 21 ASP n 1 22 SER n 1 23 ASN n 1 24 ALA n 1 25 GLU n 1 26 LEU n 1 27 ARG n 1 28 ALA n 1 29 MET n 1 30 GLU n 1 31 ALA n 1 32 LYS n 1 33 LEU n 1 34 LYS n 1 35 ALA n 1 36 GLU n 1 37 ILE n 1 38 GLN n 1 39 LYS n 1 40 NH2 n # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name PDB _struct_ref.db_code 1ABZ _struct_ref.pdbx_db_accession 1ABZ _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ABZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 1ABZ _struct_ref_seq.db_align_beg 0 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 39 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 39 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SIN non-polymer . 'SUCCINIC ACID' ? 'C4 H6 O4' 118.088 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 COSY 1 3 1 TOCSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 3.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 400 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1ABZ _pdbx_nmr_refine.method 'HYBRID DISTANCE GEOMETRY DYNAMICAL SIMULATED ANNEALING' _pdbx_nmr_refine.details ;THE FAMILY OF 23 STRUCTURES IS SUPERIMPOSED OVER THE WELL-DEFINED HELICAL REGION ENCOMPASSING RESIDUES 4 - 16 AND 24 - 34. THE AVERAGE RMSD'S BETWEEN THE 23 REFINED STRUCTURES AND AVERAGE STRUCTURE ARE AS FOLLOWS: 0.81 (RESIDUES 4 - 16 AND 24 - 34, BACKBONE ATOMS) 1.48 (RESIDUES 4 - 16 AND 24 - 34, HEAVY ATOMS) 1.08 (ALL BACKBONE ATOMS) 1.77 (ALL HEAVY ATOMS). ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1ABZ _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING HOMONUCLEAR TWO-DIMENSIONAL NMR SPECTROSCOPY.' # _pdbx_nmr_ensemble.entry_id 1ABZ _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 23 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR ? BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 1ABZ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ABZ _struct.title 'ALPHA-T-ALPHA, A DE NOVO DESIGNED PEPTIDE, NMR, 23 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ABZ _struct_keywords.pdbx_keywords 'DE NOVO DESIGN' _struct_keywords.text 'DE NOVO DESIGN, HELIX-TURN-HELIX' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? ARG A 18 ? ASP A 1 ARG A 17 1 ? 17 HELX_P HELX_P2 2 GLU A 25 ? GLN A 38 ? GLU A 24 GLN A 37 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A SIN 1 C4 ? ? ? 1_555 A ASP 2 N ? ? A SIN 0 A ASP 1 1_555 ? ? ? ? ? ? ? 1.305 ? ? covale2 covale both ? A LYS 39 C ? ? ? 1_555 A NH2 40 N ? ? A LYS 38 A NH2 39 1_555 ? ? ? ? ? ? ? 1.304 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 39 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 39' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 GLU A 36 ? GLU A 35 . ? 1_555 ? 2 AC1 2 LYS A 39 ? LYS A 38 . ? 1_555 ? # _database_PDB_matrix.entry_id 1ABZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ABZ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SIN 1 0 0 SIN SIN A . n A 1 2 ASP 2 1 1 ASP ASP A . n A 1 3 TRP 3 2 2 TRP TRP A . n A 1 4 LEU 4 3 3 LEU LEU A . n A 1 5 LYS 5 4 4 LYS LYS A . n A 1 6 ALA 6 5 5 ALA ALA A . n A 1 7 ARG 7 6 6 ARG ARG A . n A 1 8 VAL 8 7 7 VAL VAL A . n A 1 9 GLU 9 8 8 GLU GLU A . n A 1 10 GLN 10 9 9 GLN GLN A . n A 1 11 GLU 11 10 10 GLU GLU A . n A 1 12 LEU 12 11 11 LEU LEU A . n A 1 13 GLN 13 12 12 GLN GLN A . n A 1 14 ALA 14 13 13 ALA ALA A . n A 1 15 LEU 15 14 14 LEU LEU A . n A 1 16 GLU 16 15 15 GLU GLU A . n A 1 17 ALA 17 16 16 ALA ALA A . n A 1 18 ARG 18 17 17 ARG ARG A . n A 1 19 GLY 19 18 18 GLY GLY A . n A 1 20 THR 20 19 19 THR THR A . n A 1 21 ASP 21 20 20 ASP ASP A . n A 1 22 SER 22 21 21 SER SER A . n A 1 23 ASN 23 22 22 ASN ASN A . n A 1 24 ALA 24 23 23 ALA ALA A . n A 1 25 GLU 25 24 24 GLU GLU A . n A 1 26 LEU 26 25 25 LEU LEU A . n A 1 27 ARG 27 26 26 ARG ARG A . n A 1 28 ALA 28 27 27 ALA ALA A . n A 1 29 MET 29 28 28 MET MET A . n A 1 30 GLU 30 29 29 GLU GLU A . n A 1 31 ALA 31 30 30 ALA ALA A . n A 1 32 LYS 32 31 31 LYS LYS A . n A 1 33 LEU 33 32 32 LEU LEU A . n A 1 34 LYS 34 33 33 LYS LYS A . n A 1 35 ALA 35 34 34 ALA ALA A . n A 1 36 GLU 36 35 35 GLU GLU A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 GLN 38 37 37 GLN GLN A . n A 1 39 LYS 39 38 38 LYS LYS A . n A 1 40 NH2 40 39 39 NH2 NH2 A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-02-04 2 'Structure model' 1 1 2008-03-21 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 15 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 16 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 17 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 19 ? ? -101.42 44.75 2 1 ASP A 20 ? ? -161.44 55.97 3 1 SER A 21 ? ? -165.45 36.21 4 1 LEU A 32 ? ? -48.09 -70.80 5 1 GLN A 37 ? ? -85.39 42.15 6 2 ARG A 17 ? ? -143.54 22.73 7 2 SER A 21 ? ? -165.95 -157.09 8 2 ALA A 23 ? ? -143.11 -53.75 9 3 ARG A 17 ? ? -87.45 41.47 10 4 ARG A 17 ? ? -153.25 67.33 11 4 THR A 19 ? ? 72.80 81.36 12 5 SER A 21 ? ? -177.40 30.90 13 6 ALA A 23 ? ? -130.95 -43.55 14 7 THR A 19 ? ? 170.15 89.81 15 7 ASP A 20 ? ? 62.65 63.85 16 7 SER A 21 ? ? -177.67 41.86 17 8 VAL A 7 ? ? -90.39 -72.31 18 8 ALA A 16 ? ? -53.45 -80.57 19 8 ARG A 17 ? ? 48.50 27.59 20 8 THR A 19 ? ? -108.50 61.36 21 8 SER A 21 ? ? 167.36 38.40 22 9 THR A 19 ? ? 76.63 51.13 23 9 GLN A 37 ? ? -54.07 -72.07 24 10 ARG A 17 ? ? -156.77 65.77 25 10 THR A 19 ? ? 47.64 75.66 26 10 ASP A 20 ? ? 75.91 52.84 27 11 ARG A 17 ? ? 176.00 77.78 28 11 THR A 19 ? ? 179.50 93.73 29 12 ARG A 17 ? ? -101.05 51.04 30 12 ASP A 20 ? ? -165.04 51.88 31 12 SER A 21 ? ? -68.93 -169.75 32 12 ASN A 22 ? ? 54.80 19.35 33 12 ALA A 23 ? ? -136.85 -43.57 34 13 SER A 21 ? ? -171.86 27.98 35 14 ARG A 17 ? ? -170.86 53.97 36 14 THR A 19 ? ? 48.52 22.99 37 14 ASP A 20 ? ? -143.06 48.11 38 14 SER A 21 ? ? 174.64 34.20 39 14 LEU A 32 ? ? -58.89 -70.42 40 14 GLN A 37 ? ? -55.43 -76.13 41 15 THR A 19 ? ? 39.64 74.04 42 15 ASP A 20 ? ? 75.63 54.23 43 15 LEU A 32 ? ? -74.84 -73.32 44 16 ARG A 17 ? ? -145.38 58.54 45 16 ASP A 20 ? ? -156.77 65.59 46 16 SER A 21 ? ? 179.61 32.28 47 16 GLU A 35 ? ? -90.14 -64.62 48 17 SER A 21 ? ? -148.14 -148.86 49 17 ALA A 23 ? ? -145.02 -50.94 50 18 LEU A 14 ? ? -75.37 -75.09 51 18 ARG A 17 ? ? -103.65 44.81 52 18 ASP A 20 ? ? -116.02 62.38 53 18 SER A 21 ? ? 177.34 37.09 54 19 ARG A 17 ? ? -167.49 54.03 55 19 ASP A 20 ? ? -173.27 51.00 56 19 ASN A 22 ? ? 57.57 17.17 57 19 ALA A 23 ? ? -140.18 -45.65 58 19 LEU A 25 ? ? -71.33 -72.99 59 20 ARG A 17 ? ? -173.71 81.42 60 20 THR A 19 ? ? -90.41 -104.52 61 20 ASP A 20 ? ? -90.36 53.31 62 20 LEU A 32 ? ? -54.97 -72.77 63 21 ASP A 20 ? ? -154.76 74.54 64 21 SER A 21 ? ? 179.61 35.15 65 22 VAL A 7 ? ? -90.29 -66.42 66 22 ARG A 17 ? ? -103.15 51.74 67 22 ASP A 20 ? ? -107.20 52.77 68 22 SER A 21 ? ? -177.79 35.15 69 23 THR A 19 ? ? 67.19 73.06 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 6 ? ? 0.299 'SIDE CHAIN' 2 1 ARG A 17 ? ? 0.270 'SIDE CHAIN' 3 1 ARG A 26 ? ? 0.317 'SIDE CHAIN' 4 2 ARG A 6 ? ? 0.310 'SIDE CHAIN' 5 2 ARG A 17 ? ? 0.280 'SIDE CHAIN' 6 2 ARG A 26 ? ? 0.158 'SIDE CHAIN' 7 3 ARG A 6 ? ? 0.220 'SIDE CHAIN' 8 3 ARG A 17 ? ? 0.304 'SIDE CHAIN' 9 3 ARG A 26 ? ? 0.302 'SIDE CHAIN' 10 4 ARG A 6 ? ? 0.236 'SIDE CHAIN' 11 4 ARG A 17 ? ? 0.257 'SIDE CHAIN' 12 4 ARG A 26 ? ? 0.182 'SIDE CHAIN' 13 5 ARG A 6 ? ? 0.241 'SIDE CHAIN' 14 5 ARG A 17 ? ? 0.172 'SIDE CHAIN' 15 5 ARG A 26 ? ? 0.208 'SIDE CHAIN' 16 6 ARG A 6 ? ? 0.197 'SIDE CHAIN' 17 6 ARG A 17 ? ? 0.317 'SIDE CHAIN' 18 6 ARG A 26 ? ? 0.136 'SIDE CHAIN' 19 7 ARG A 6 ? ? 0.271 'SIDE CHAIN' 20 7 ARG A 17 ? ? 0.160 'SIDE CHAIN' 21 7 ARG A 26 ? ? 0.291 'SIDE CHAIN' 22 8 ARG A 6 ? ? 0.212 'SIDE CHAIN' 23 8 ARG A 17 ? ? 0.244 'SIDE CHAIN' 24 8 ARG A 26 ? ? 0.194 'SIDE CHAIN' 25 9 ARG A 6 ? ? 0.102 'SIDE CHAIN' 26 9 ARG A 17 ? ? 0.183 'SIDE CHAIN' 27 9 ARG A 26 ? ? 0.094 'SIDE CHAIN' 28 10 ARG A 6 ? ? 0.271 'SIDE CHAIN' 29 10 ARG A 17 ? ? 0.273 'SIDE CHAIN' 30 11 ARG A 6 ? ? 0.253 'SIDE CHAIN' 31 11 ARG A 17 ? ? 0.306 'SIDE CHAIN' 32 12 ARG A 6 ? ? 0.281 'SIDE CHAIN' 33 12 ARG A 17 ? ? 0.239 'SIDE CHAIN' 34 12 ARG A 26 ? ? 0.317 'SIDE CHAIN' 35 13 ARG A 17 ? ? 0.094 'SIDE CHAIN' 36 13 ARG A 26 ? ? 0.310 'SIDE CHAIN' 37 14 ARG A 6 ? ? 0.288 'SIDE CHAIN' 38 14 ARG A 17 ? ? 0.090 'SIDE CHAIN' 39 14 ARG A 26 ? ? 0.218 'SIDE CHAIN' 40 15 ARG A 6 ? ? 0.259 'SIDE CHAIN' 41 15 ARG A 17 ? ? 0.188 'SIDE CHAIN' 42 15 ARG A 26 ? ? 0.142 'SIDE CHAIN' 43 16 ARG A 6 ? ? 0.315 'SIDE CHAIN' 44 16 ARG A 17 ? ? 0.220 'SIDE CHAIN' 45 16 ARG A 26 ? ? 0.311 'SIDE CHAIN' 46 17 ARG A 6 ? ? 0.218 'SIDE CHAIN' 47 17 ARG A 17 ? ? 0.277 'SIDE CHAIN' 48 17 ARG A 26 ? ? 0.222 'SIDE CHAIN' 49 18 ARG A 6 ? ? 0.299 'SIDE CHAIN' 50 18 ARG A 17 ? ? 0.233 'SIDE CHAIN' 51 18 ARG A 26 ? ? 0.176 'SIDE CHAIN' 52 19 ARG A 6 ? ? 0.201 'SIDE CHAIN' 53 19 ARG A 17 ? ? 0.213 'SIDE CHAIN' 54 19 ARG A 26 ? ? 0.301 'SIDE CHAIN' 55 20 ARG A 6 ? ? 0.113 'SIDE CHAIN' 56 20 ARG A 17 ? ? 0.289 'SIDE CHAIN' 57 21 ARG A 17 ? ? 0.148 'SIDE CHAIN' 58 21 ARG A 26 ? ? 0.130 'SIDE CHAIN' 59 22 ARG A 6 ? ? 0.222 'SIDE CHAIN' 60 22 ARG A 17 ? ? 0.286 'SIDE CHAIN' 61 22 ARG A 26 ? ? 0.142 'SIDE CHAIN' 62 23 ARG A 6 ? ? 0.276 'SIDE CHAIN' 63 23 ARG A 17 ? ? 0.258 'SIDE CHAIN' 64 23 ARG A 26 ? ? 0.225 'SIDE CHAIN' #