data_1AHR # _entry.id 1AHR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AHR pdb_00001ahr 10.2210/pdb1ahr/pdb WWPDB D_1000170831 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-06-16 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-12-21 5 'Structure model' 1 4 2023-08-09 6 'Structure model' 1 5 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Refinement description' 7 6 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site 7 5 'Structure model' pdbx_initial_refinement_model 8 6 'Structure model' chem_comp_atom 9 6 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.value' 17 4 'Structure model' '_struct_conn.pdbx_dist_value' 18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 4 'Structure model' '_struct_ref_seq_dif.details' 31 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AHR _pdbx_database_status.recvd_initial_deposition_date 1997-04-10 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tabernero, L.' 1 'Sack, J.' 2 # _citation.id primary _citation.title ;The structure of a calmodulin mutant with a deletion in the central helix: implications for molecular recognition and protein binding. ; _citation.journal_abbrev Structure _citation.journal_volume 5 _citation.page_first 613 _citation.page_last 622 _citation.year 1997 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9195880 _citation.pdbx_database_id_DOI '10.1016/S0969-2126(97)00217-7' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tabernero, L.' 1 ? primary 'Taylor, D.A.' 2 ? primary 'Chandross, R.J.' 3 ? primary 'VanBerkum, M.F.' 4 ? primary 'Means, A.R.' 5 ? primary 'Quiocho, F.A.' 6 ? primary 'Sack, J.S.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man CALMODULIN 16478.133 1 ? 'DEL(T79), DEL(D80)' ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 4 ? ? ? ? 3 water nat water 18.015 113 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDSE EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK ; _entity_poly.pdbx_seq_one_letter_code_can ;ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDSE EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 GLN n 1 4 LEU n 1 5 THR n 1 6 GLU n 1 7 GLU n 1 8 GLN n 1 9 ILE n 1 10 ALA n 1 11 GLU n 1 12 PHE n 1 13 LYS n 1 14 GLU n 1 15 ALA n 1 16 PHE n 1 17 SER n 1 18 LEU n 1 19 PHE n 1 20 ASP n 1 21 LYS n 1 22 ASP n 1 23 GLY n 1 24 ASP n 1 25 GLY n 1 26 THR n 1 27 ILE n 1 28 THR n 1 29 THR n 1 30 LYS n 1 31 GLU n 1 32 LEU n 1 33 GLY n 1 34 THR n 1 35 VAL n 1 36 MET n 1 37 ARG n 1 38 SER n 1 39 LEU n 1 40 GLY n 1 41 GLN n 1 42 ASN n 1 43 PRO n 1 44 THR n 1 45 GLU n 1 46 ALA n 1 47 GLU n 1 48 LEU n 1 49 GLN n 1 50 ASP n 1 51 MET n 1 52 ILE n 1 53 ASN n 1 54 GLU n 1 55 VAL n 1 56 ASP n 1 57 ALA n 1 58 ASP n 1 59 GLY n 1 60 ASN n 1 61 GLY n 1 62 THR n 1 63 ILE n 1 64 ASP n 1 65 PHE n 1 66 PRO n 1 67 GLU n 1 68 PHE n 1 69 LEU n 1 70 THR n 1 71 MET n 1 72 MET n 1 73 ALA n 1 74 ARG n 1 75 LYS n 1 76 MET n 1 77 LYS n 1 78 ASP n 1 79 SER n 1 80 GLU n 1 81 GLU n 1 82 GLU n 1 83 ILE n 1 84 ARG n 1 85 GLU n 1 86 ALA n 1 87 PHE n 1 88 ARG n 1 89 VAL n 1 90 PHE n 1 91 ASP n 1 92 LYS n 1 93 ASP n 1 94 GLY n 1 95 ASN n 1 96 GLY n 1 97 PHE n 1 98 ILE n 1 99 SER n 1 100 ALA n 1 101 ALA n 1 102 GLU n 1 103 LEU n 1 104 ARG n 1 105 HIS n 1 106 VAL n 1 107 MET n 1 108 THR n 1 109 ASN n 1 110 LEU n 1 111 GLY n 1 112 GLU n 1 113 LYS n 1 114 LEU n 1 115 THR n 1 116 ASP n 1 117 GLU n 1 118 GLU n 1 119 VAL n 1 120 ASP n 1 121 GLU n 1 122 MET n 1 123 ILE n 1 124 ARG n 1 125 GLU n 1 126 ALA n 1 127 ASP n 1 128 ILE n 1 129 ASP n 1 130 GLY n 1 131 ASP n 1 132 GLY n 1 133 GLN n 1 134 VAL n 1 135 ASN n 1 136 TYR n 1 137 GLU n 1 138 GLU n 1 139 PHE n 1 140 VAL n 1 141 THR n 1 142 MET n 1 143 MET n 1 144 THR n 1 145 SER n 1 146 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name chicken _entity_src_gen.gene_src_genus Gallus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line 293 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 293 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 SER 79 81 81 SER SER A . n A 1 80 GLU 80 82 82 GLU GLU A . n A 1 81 GLU 81 83 83 GLU GLU A . n A 1 82 GLU 82 84 84 GLU GLU A . n A 1 83 ILE 83 85 85 ILE ILE A . n A 1 84 ARG 84 86 86 ARG ARG A . n A 1 85 GLU 85 87 87 GLU GLU A . n A 1 86 ALA 86 88 88 ALA ALA A . n A 1 87 PHE 87 89 89 PHE PHE A . n A 1 88 ARG 88 90 90 ARG ARG A . n A 1 89 VAL 89 91 91 VAL VAL A . n A 1 90 PHE 90 92 92 PHE PHE A . n A 1 91 ASP 91 93 93 ASP ASP A . n A 1 92 LYS 92 94 94 LYS LYS A . n A 1 93 ASP 93 95 95 ASP ASP A . n A 1 94 GLY 94 96 96 GLY GLY A . n A 1 95 ASN 95 97 97 ASN ASN A . n A 1 96 GLY 96 98 98 GLY GLY A . n A 1 97 PHE 97 99 99 PHE PHE A . n A 1 98 ILE 98 100 100 ILE ILE A . n A 1 99 SER 99 101 101 SER SER A . n A 1 100 ALA 100 102 102 ALA ALA A . n A 1 101 ALA 101 103 103 ALA ALA A . n A 1 102 GLU 102 104 104 GLU GLU A . n A 1 103 LEU 103 105 105 LEU LEU A . n A 1 104 ARG 104 106 106 ARG ARG A . n A 1 105 HIS 105 107 107 HIS HIS A . n A 1 106 VAL 106 108 108 VAL VAL A . n A 1 107 MET 107 109 109 MET MET A . n A 1 108 THR 108 110 110 THR THR A . n A 1 109 ASN 109 111 111 ASN ASN A . n A 1 110 LEU 110 112 112 LEU LEU A . n A 1 111 GLY 111 113 113 GLY GLY A . n A 1 112 GLU 112 114 114 GLU GLU A . n A 1 113 LYS 113 115 115 LYS LYS A . n A 1 114 LEU 114 116 116 LEU LEU A . n A 1 115 THR 115 117 117 THR THR A . n A 1 116 ASP 116 118 118 ASP ASP A . n A 1 117 GLU 117 119 119 GLU GLU A . n A 1 118 GLU 118 120 120 GLU GLU A . n A 1 119 VAL 119 121 121 VAL VAL A . n A 1 120 ASP 120 122 122 ASP ASP A . n A 1 121 GLU 121 123 123 GLU GLU A . n A 1 122 MET 122 124 124 MET MET A . n A 1 123 ILE 123 125 125 ILE ILE A . n A 1 124 ARG 124 126 126 ARG ARG A . n A 1 125 GLU 125 127 127 GLU GLU A . n A 1 126 ALA 126 128 128 ALA ALA A . n A 1 127 ASP 127 129 129 ASP ASP A . n A 1 128 ILE 128 130 130 ILE ILE A . n A 1 129 ASP 129 131 131 ASP ASP A . n A 1 130 GLY 130 132 132 GLY GLY A . n A 1 131 ASP 131 133 133 ASP ASP A . n A 1 132 GLY 132 134 134 GLY GLY A . n A 1 133 GLN 133 135 135 GLN GLN A . n A 1 134 VAL 134 136 136 VAL VAL A . n A 1 135 ASN 135 137 137 ASN ASN A . n A 1 136 TYR 136 138 138 TYR TYR A . n A 1 137 GLU 137 139 139 GLU GLU A . n A 1 138 GLU 138 140 140 GLU GLU A . n A 1 139 PHE 139 141 141 PHE PHE A . n A 1 140 VAL 140 142 142 VAL VAL A . n A 1 141 THR 141 143 143 THR THR A . n A 1 142 MET 142 144 144 MET MET A . n A 1 143 MET 143 145 145 MET MET A . n A 1 144 THR 144 146 146 THR THR A . n A 1 145 SER 145 147 147 SER SER A . n A 1 146 LYS 146 148 148 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 149 149 CA CA A . C 2 CA 1 150 150 CA CA A . D 2 CA 1 151 151 CA CA A . E 2 CA 1 152 152 CA CA A . F 3 HOH 1 201 201 HOH HOH A . F 3 HOH 2 202 202 HOH HOH A . F 3 HOH 3 203 203 HOH HOH A . F 3 HOH 4 204 204 HOH HOH A . F 3 HOH 5 205 205 HOH HOH A . F 3 HOH 6 206 206 HOH HOH A . F 3 HOH 7 207 207 HOH HOH A . F 3 HOH 8 208 208 HOH HOH A . F 3 HOH 9 209 209 HOH HOH A . F 3 HOH 10 210 210 HOH HOH A . F 3 HOH 11 211 211 HOH HOH A . F 3 HOH 12 212 212 HOH HOH A . F 3 HOH 13 213 213 HOH HOH A . F 3 HOH 14 214 214 HOH HOH A . F 3 HOH 15 215 215 HOH HOH A . F 3 HOH 16 216 216 HOH HOH A . F 3 HOH 17 217 217 HOH HOH A . F 3 HOH 18 218 218 HOH HOH A . F 3 HOH 19 219 219 HOH HOH A . F 3 HOH 20 220 220 HOH HOH A . F 3 HOH 21 221 221 HOH HOH A . F 3 HOH 22 222 222 HOH HOH A . F 3 HOH 23 223 223 HOH HOH A . F 3 HOH 24 224 224 HOH HOH A . F 3 HOH 25 225 225 HOH HOH A . F 3 HOH 26 226 226 HOH HOH A . F 3 HOH 27 227 227 HOH HOH A . F 3 HOH 28 228 228 HOH HOH A . F 3 HOH 29 229 229 HOH HOH A . F 3 HOH 30 230 230 HOH HOH A . F 3 HOH 31 231 231 HOH HOH A . F 3 HOH 32 232 232 HOH HOH A . F 3 HOH 33 233 233 HOH HOH A . F 3 HOH 34 234 234 HOH HOH A . F 3 HOH 35 235 235 HOH HOH A . F 3 HOH 36 236 236 HOH HOH A . F 3 HOH 37 237 237 HOH HOH A . F 3 HOH 38 238 238 HOH HOH A . F 3 HOH 39 239 239 HOH HOH A . F 3 HOH 40 240 240 HOH HOH A . F 3 HOH 41 241 241 HOH HOH A . F 3 HOH 42 242 242 HOH HOH A . F 3 HOH 43 243 243 HOH HOH A . F 3 HOH 44 244 244 HOH HOH A . F 3 HOH 45 245 245 HOH HOH A . F 3 HOH 46 246 246 HOH HOH A . F 3 HOH 47 247 247 HOH HOH A . F 3 HOH 48 248 248 HOH HOH A . F 3 HOH 49 249 249 HOH HOH A . F 3 HOH 50 250 250 HOH HOH A . F 3 HOH 51 251 251 HOH HOH A . F 3 HOH 52 252 252 HOH HOH A . F 3 HOH 53 253 253 HOH HOH A . F 3 HOH 54 254 254 HOH HOH A . F 3 HOH 55 255 255 HOH HOH A . F 3 HOH 56 256 256 HOH HOH A . F 3 HOH 57 257 257 HOH HOH A . F 3 HOH 58 258 258 HOH HOH A . F 3 HOH 59 259 259 HOH HOH A . F 3 HOH 60 260 260 HOH HOH A . F 3 HOH 61 261 261 HOH HOH A . F 3 HOH 62 262 262 HOH HOH A . F 3 HOH 63 263 263 HOH HOH A . F 3 HOH 64 264 264 HOH HOH A . F 3 HOH 65 265 265 HOH HOH A . F 3 HOH 66 266 266 HOH HOH A . F 3 HOH 67 267 267 HOH HOH A . F 3 HOH 68 268 268 HOH HOH A . F 3 HOH 69 269 269 HOH HOH A . F 3 HOH 70 270 270 HOH HOH A . F 3 HOH 71 271 271 HOH HOH A . F 3 HOH 72 272 272 HOH HOH A . F 3 HOH 73 273 273 HOH HOH A . F 3 HOH 74 274 274 HOH HOH A . F 3 HOH 75 275 275 HOH HOH A . F 3 HOH 76 276 276 HOH HOH A . F 3 HOH 77 277 277 HOH HOH A . F 3 HOH 78 278 278 HOH HOH A . F 3 HOH 79 279 279 HOH HOH A . F 3 HOH 80 280 280 HOH HOH A . F 3 HOH 81 281 281 HOH HOH A . F 3 HOH 82 282 282 HOH HOH A . F 3 HOH 83 283 283 HOH HOH A . F 3 HOH 84 284 284 HOH HOH A . F 3 HOH 85 285 285 HOH HOH A . F 3 HOH 86 286 286 HOH HOH A . F 3 HOH 87 287 287 HOH HOH A . F 3 HOH 88 288 288 HOH HOH A . F 3 HOH 89 289 289 HOH HOH A . F 3 HOH 90 290 290 HOH HOH A . F 3 HOH 91 291 291 HOH HOH A . F 3 HOH 92 292 292 HOH HOH A . F 3 HOH 93 293 293 HOH HOH A . F 3 HOH 94 294 294 HOH HOH A . F 3 HOH 95 295 295 HOH HOH A . F 3 HOH 96 296 296 HOH HOH A . F 3 HOH 97 297 297 HOH HOH A . F 3 HOH 98 298 298 HOH HOH A . F 3 HOH 99 299 299 HOH HOH A . F 3 HOH 100 300 300 HOH HOH A . F 3 HOH 101 301 301 HOH HOH A . F 3 HOH 102 302 302 HOH HOH A . F 3 HOH 103 303 303 HOH HOH A . F 3 HOH 104 304 304 HOH HOH A . F 3 HOH 105 305 305 HOH HOH A . F 3 HOH 106 306 306 HOH HOH A . F 3 HOH 107 307 307 HOH HOH A . F 3 HOH 108 308 308 HOH HOH A . F 3 HOH 109 309 309 HOH HOH A . F 3 HOH 110 310 310 HOH HOH A . F 3 HOH 111 311 311 HOH HOH A . F 3 HOH 112 312 312 HOH HOH A . F 3 HOH 113 313 313 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 UCSD 'data reduction' . ? 3 ROCKS 'data scaling' . ? 4 X-PLOR phasing 3.1 ? 5 # _cell.entry_id 1AHR _cell.length_a 27.090 _cell.length_b 55.510 _cell.length_c 100.890 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AHR _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # _exptl.entry_id 1AHR _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_percent_sol 46.56 _exptl_crystal.description 'SEPARATE ROTATION SEARCH FOR EACH DOMAIN' # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.25 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '28-33% MPD, 15% ETHANOL, 5MM CACL, 20MM NA ACETATE, PH 4.25' # _diffrn.id 1 _diffrn.ambient_temp 300 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'AREA DETECTOR' _diffrn_detector.type ADSC _diffrn_detector.pdbx_collection_date 1988-12 _diffrn_detector.details COLLIMATOR # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'GRAPHITE(002)' _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RUH2R' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1AHR _reflns.observed_criterion_sigma_I 2. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low ? _reflns.d_resolution_high 1.8 _reflns.number_obs 14407 _reflns.number_all ? _reflns.percent_possible_obs 67.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.5010000 _reflns.pdbx_netI_over_sigmaI 8.68 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.4 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1AHR _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.0 _refine.ls_d_res_high 1.8 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.2110000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2110000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 4CLN' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1149 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 113 _refine_hist.number_atoms_total 1266 _refine_hist.d_res_high 1.8 _refine_hist.d_res_low 8.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.015 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.8 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _database_PDB_matrix.entry_id 1AHR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1AHR _struct.title 'CALMODULIN MUTANT WITH A TWO RESIDUE DELETION IN THE CENTRAL HELIX' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AHR _struct_keywords.pdbx_keywords 'CALCIUM-BINDING PROTEIN' _struct_keywords.text 'CALMODULIN, CALCIUM-BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CALM_CHICK _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P62149 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTD SEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AHR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 146 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62149 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 148 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1AHR ? A ? ? UNP P62149 THR 79 deletion ? 1 1 1AHR ? A ? ? UNP P62149 ASP 80 deletion ? 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 8 ? PHE A 19 ? GLN A 8 PHE A 19 1 ? 12 HELX_P HELX_P2 2 THR A 29 ? SER A 38 ? THR A 29 SER A 38 1 ? 10 HELX_P HELX_P3 3 GLU A 45 ? VAL A 55 ? GLU A 45 VAL A 55 1 ? 11 HELX_P HELX_P4 4 PHE A 65 ? PHE A 90 ? PHE A 65 PHE A 92 1 ? 26 HELX_P HELX_P5 5 ALA A 100 ? LEU A 110 ? ALA A 102 LEU A 112 1 ? 11 HELX_P HELX_P6 6 ASP A 116 ? GLU A 125 ? ASP A 118 GLU A 127 1 ? 10 HELX_P HELX_P7 7 TYR A 136 ? MET A 142 ? TYR A 138 MET A 144 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 20 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 20 A CA 149 1_555 ? ? ? ? ? ? ? 2.115 ? ? metalc2 metalc ? ? A ASP 22 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 22 A CA 149 1_555 ? ? ? ? ? ? ? 2.728 ? ? metalc3 metalc ? ? A ASP 24 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 24 A CA 149 1_555 ? ? ? ? ? ? ? 2.501 ? ? metalc4 metalc ? ? A THR 26 O ? ? ? 1_555 B CA . CA ? ? A THR 26 A CA 149 1_555 ? ? ? ? ? ? ? 2.074 ? ? metalc5 metalc ? ? A GLU 31 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 149 1_555 ? ? ? ? ? ? ? 2.356 ? ? metalc6 metalc ? ? A GLU 31 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 149 1_555 ? ? ? ? ? ? ? 2.523 ? ? metalc7 metalc ? ? A ASP 56 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 56 A CA 150 1_555 ? ? ? ? ? ? ? 2.386 ? ? metalc8 metalc ? ? A ASP 58 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 58 A CA 150 1_555 ? ? ? ? ? ? ? 2.426 ? ? metalc9 metalc ? ? A ASN 60 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 60 A CA 150 1_555 ? ? ? ? ? ? ? 2.168 ? ? metalc10 metalc ? ? A THR 62 O ? ? ? 1_555 C CA . CA ? ? A THR 62 A CA 150 1_555 ? ? ? ? ? ? ? 2.372 ? ? metalc11 metalc ? ? A GLU 67 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 150 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc12 metalc ? ? A GLU 67 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 150 1_555 ? ? ? ? ? ? ? 2.576 ? ? metalc13 metalc ? ? A ASP 91 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 93 A CA 151 1_555 ? ? ? ? ? ? ? 2.292 ? ? metalc14 metalc ? ? A ASP 93 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 95 A CA 151 1_555 ? ? ? ? ? ? ? 2.489 ? ? metalc15 metalc ? ? A ASN 95 OD1 ? ? ? 1_555 D CA . CA ? ? A ASN 97 A CA 151 1_555 ? ? ? ? ? ? ? 1.928 ? ? metalc16 metalc ? ? A PHE 97 O ? ? ? 1_555 D CA . CA ? ? A PHE 99 A CA 151 1_555 ? ? ? ? ? ? ? 2.137 ? ? metalc17 metalc ? ? A GLU 102 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 104 A CA 151 1_555 ? ? ? ? ? ? ? 2.620 ? ? metalc18 metalc ? ? A GLU 102 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 104 A CA 151 1_555 ? ? ? ? ? ? ? 2.530 ? ? metalc19 metalc ? ? A ASP 127 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 129 A CA 152 1_555 ? ? ? ? ? ? ? 2.183 ? ? metalc20 metalc ? ? A ASP 129 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 131 A CA 152 1_555 ? ? ? ? ? ? ? 2.282 ? ? metalc21 metalc ? ? A ASP 131 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 133 A CA 152 1_555 ? ? ? ? ? ? ? 2.172 ? ? metalc22 metalc ? ? A ASP 131 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 133 A CA 152 1_555 ? ? ? ? ? ? ? 3.114 ? ? metalc23 metalc ? ? A GLN 133 O ? ? ? 1_555 E CA . CA ? ? A GLN 135 A CA 152 1_555 ? ? ? ? ? ? ? 2.004 ? ? metalc24 metalc ? ? A GLU 138 OE2 ? ? ? 1_555 E CA . CA ? ? A GLU 140 A CA 152 1_555 ? ? ? ? ? ? ? 2.290 ? ? metalc25 metalc ? ? A GLU 138 OE1 ? ? ? 1_555 E CA . CA ? ? A GLU 140 A CA 152 1_555 ? ? ? ? ? ? ? 2.478 ? ? metalc26 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 150 A HOH 202 1_555 ? ? ? ? ? ? ? 2.011 ? ? metalc27 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 151 A HOH 254 1_555 ? ? ? ? ? ? ? 2.760 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 79.7 ? 2 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 84.7 ? 3 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 82.3 ? 4 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 85.5 ? 5 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 161.0 ? 6 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O ? A THR 26 ? A THR 26 ? 1_555 84.5 ? 7 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 105.4 ? 8 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 113.3 ? 9 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 162.4 ? 10 O ? A THR 26 ? A THR 26 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 82.0 ? 11 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 91.6 ? 12 OD1 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 60.4 ? 13 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 142.5 ? 14 O ? A THR 26 ? A THR 26 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 132.5 ? 15 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 53.2 ? 16 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 74.9 ? 17 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 78.4 ? 18 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 72.1 ? 19 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 84.9 ? 20 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 146.3 ? 21 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 77.7 ? 22 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 89.3 ? 23 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 78.9 ? 24 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 150.5 ? 25 O ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 128.3 ? 26 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 114.0 ? 27 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 128.8 ? 28 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 157.0 ? 29 O ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 84.0 ? 30 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 52.2 ? 31 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O ? F HOH . ? A HOH 202 ? 1_555 158.9 ? 32 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O ? F HOH . ? A HOH 202 ? 1_555 84.0 ? 33 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O ? F HOH . ? A HOH 202 ? 1_555 96.3 ? 34 O ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O ? F HOH . ? A HOH 202 ? 1_555 114.2 ? 35 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O ? F HOH . ? A HOH 202 ? 1_555 85.6 ? 36 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O ? F HOH . ? A HOH 202 ? 1_555 78.6 ? 37 OD1 ? A ASP 91 ? A ASP 93 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OD1 ? A ASP 93 ? A ASP 95 ? 1_555 94.0 ? 38 OD1 ? A ASP 91 ? A ASP 93 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OD1 ? A ASN 95 ? A ASN 97 ? 1_555 92.7 ? 39 OD1 ? A ASP 93 ? A ASP 95 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OD1 ? A ASN 95 ? A ASN 97 ? 1_555 80.7 ? 40 OD1 ? A ASP 91 ? A ASP 93 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O ? A PHE 97 ? A PHE 99 ? 1_555 78.1 ? 41 OD1 ? A ASP 93 ? A ASP 95 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O ? A PHE 97 ? A PHE 99 ? 1_555 162.5 ? 42 OD1 ? A ASN 95 ? A ASN 97 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O ? A PHE 97 ? A PHE 99 ? 1_555 84.1 ? 43 OD1 ? A ASP 91 ? A ASP 93 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE2 ? A GLU 102 ? A GLU 104 ? 1_555 89.0 ? 44 OD1 ? A ASP 93 ? A ASP 95 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE2 ? A GLU 102 ? A GLU 104 ? 1_555 80.8 ? 45 OD1 ? A ASN 95 ? A ASN 97 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE2 ? A GLU 102 ? A GLU 104 ? 1_555 161.4 ? 46 O ? A PHE 97 ? A PHE 99 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE2 ? A GLU 102 ? A GLU 104 ? 1_555 114.3 ? 47 OD1 ? A ASP 91 ? A ASP 93 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 102 ? A GLU 104 ? 1_555 102.0 ? 48 OD1 ? A ASP 93 ? A ASP 95 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 102 ? A GLU 104 ? 1_555 127.6 ? 49 OD1 ? A ASN 95 ? A ASN 97 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 102 ? A GLU 104 ? 1_555 146.2 ? 50 O ? A PHE 97 ? A PHE 99 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 102 ? A GLU 104 ? 1_555 69.7 ? 51 OE2 ? A GLU 102 ? A GLU 104 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 102 ? A GLU 104 ? 1_555 50.4 ? 52 OD1 ? A ASP 91 ? A ASP 93 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O ? F HOH . ? A HOH 254 ? 1_555 163.3 ? 53 OD1 ? A ASP 93 ? A ASP 95 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O ? F HOH . ? A HOH 254 ? 1_555 90.9 ? 54 OD1 ? A ASN 95 ? A ASN 97 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O ? F HOH . ? A HOH 254 ? 1_555 72.3 ? 55 O ? A PHE 97 ? A PHE 99 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O ? F HOH . ? A HOH 254 ? 1_555 92.7 ? 56 OE2 ? A GLU 102 ? A GLU 104 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O ? F HOH . ? A HOH 254 ? 1_555 107.5 ? 57 OE1 ? A GLU 102 ? A GLU 104 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O ? F HOH . ? A HOH 254 ? 1_555 87.5 ? 58 OD1 ? A ASP 127 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD1 ? A ASP 129 ? A ASP 131 ? 1_555 82.3 ? 59 OD1 ? A ASP 127 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD1 ? A ASP 131 ? A ASP 133 ? 1_555 81.7 ? 60 OD1 ? A ASP 129 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD1 ? A ASP 131 ? A ASP 133 ? 1_555 85.5 ? 61 OD1 ? A ASP 127 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD2 ? A ASP 131 ? A ASP 133 ? 1_555 116.4 ? 62 OD1 ? A ASP 129 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD2 ? A ASP 131 ? A ASP 133 ? 1_555 65.2 ? 63 OD1 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD2 ? A ASP 131 ? A ASP 133 ? 1_555 44.8 ? 64 OD1 ? A ASP 127 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O ? A GLN 133 ? A GLN 135 ? 1_555 83.6 ? 65 OD1 ? A ASP 129 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O ? A GLN 133 ? A GLN 135 ? 1_555 163.8 ? 66 OD1 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O ? A GLN 133 ? A GLN 135 ? 1_555 84.5 ? 67 OD2 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O ? A GLN 133 ? A GLN 135 ? 1_555 114.8 ? 68 OD1 ? A ASP 127 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 138 ? A GLU 140 ? 1_555 79.4 ? 69 OD1 ? A ASP 129 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 138 ? A GLU 140 ? 1_555 76.0 ? 70 OD1 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 138 ? A GLU 140 ? 1_555 155.1 ? 71 OD2 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 138 ? A GLU 140 ? 1_555 134.3 ? 72 O ? A GLN 133 ? A GLN 135 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 138 ? A GLU 140 ? 1_555 109.2 ? 73 OD1 ? A ASP 127 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 138 ? A GLU 140 ? 1_555 119.1 ? 74 OD1 ? A ASP 129 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 138 ? A GLU 140 ? 1_555 115.8 ? 75 OD1 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 138 ? A GLU 140 ? 1_555 150.8 ? 76 OD2 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 138 ? A GLU 140 ? 1_555 124.1 ? 77 O ? A GLN 133 ? A GLN 135 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 138 ? A GLU 140 ? 1_555 78.3 ? 78 OE2 ? A GLU 138 ? A GLU 140 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 138 ? A GLU 140 ? 1_555 54.2 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 97 ? SER A 99 ? PHE A 99 SER A 101 A 2 GLN A 133 ? ASN A 135 ? GLN A 135 ASN A 137 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 98 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 100 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 134 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 136 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 149 ? 5 'BINDING SITE FOR RESIDUE CA A 149' AC2 Software A CA 150 ? 6 'BINDING SITE FOR RESIDUE CA A 150' AC3 Software A CA 151 ? 6 'BINDING SITE FOR RESIDUE CA A 151' AC4 Software A CA 152 ? 5 'BINDING SITE FOR RESIDUE CA A 152' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 20 ? ASP A 20 . ? 1_555 ? 2 AC1 5 ASP A 22 ? ASP A 22 . ? 1_555 ? 3 AC1 5 ASP A 24 ? ASP A 24 . ? 1_555 ? 4 AC1 5 THR A 26 ? THR A 26 . ? 1_555 ? 5 AC1 5 GLU A 31 ? GLU A 31 . ? 1_555 ? 6 AC2 6 ASP A 56 ? ASP A 56 . ? 1_555 ? 7 AC2 6 ASP A 58 ? ASP A 58 . ? 1_555 ? 8 AC2 6 ASN A 60 ? ASN A 60 . ? 1_555 ? 9 AC2 6 THR A 62 ? THR A 62 . ? 1_555 ? 10 AC2 6 GLU A 67 ? GLU A 67 . ? 1_555 ? 11 AC2 6 HOH F . ? HOH A 202 . ? 1_555 ? 12 AC3 6 ASP A 91 ? ASP A 93 . ? 1_555 ? 13 AC3 6 ASP A 93 ? ASP A 95 . ? 1_555 ? 14 AC3 6 ASN A 95 ? ASN A 97 . ? 1_555 ? 15 AC3 6 PHE A 97 ? PHE A 99 . ? 1_555 ? 16 AC3 6 GLU A 102 ? GLU A 104 . ? 1_555 ? 17 AC3 6 HOH F . ? HOH A 254 . ? 1_555 ? 18 AC4 5 ASP A 127 ? ASP A 129 . ? 1_555 ? 19 AC4 5 ASP A 129 ? ASP A 131 . ? 1_555 ? 20 AC4 5 ASP A 131 ? ASP A 133 . ? 1_555 ? 21 AC4 5 GLN A 133 ? GLN A 135 . ? 1_555 ? 22 AC4 5 GLU A 138 ? GLU A 140 . ? 1_555 ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 39 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 39 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 39 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.79 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation 14.49 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -48.59 100.24 2 1 LEU A 4 ? ? 6.62 132.37 3 1 THR A 5 ? ? -67.85 -175.51 4 1 ASN A 97 ? ? -58.29 0.53 5 1 ILE A 125 ? ? -72.53 27.33 6 1 ARG A 126 ? ? -140.63 -10.88 7 1 SER A 147 ? ? -21.21 136.37 # _pdbx_entry_details.entry_id 1AHR _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;SEQUENCE AND NUMBERING IS AS IN WILD TYPE CALMODULIN (PDB ENTRY 4CLN) WITH RESIDUES THR 79 AND ASP 80 DELETED. ; _pdbx_entry_details.has_ligand_of_interest ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TYR N N N N 308 TYR CA C N S 309 TYR C C N N 310 TYR O O N N 311 TYR CB C N N 312 TYR CG C Y N 313 TYR CD1 C Y N 314 TYR CD2 C Y N 315 TYR CE1 C Y N 316 TYR CE2 C Y N 317 TYR CZ C Y N 318 TYR OH O N N 319 TYR OXT O N N 320 TYR H H N N 321 TYR H2 H N N 322 TYR HA H N N 323 TYR HB2 H N N 324 TYR HB3 H N N 325 TYR HD1 H N N 326 TYR HD2 H N N 327 TYR HE1 H N N 328 TYR HE2 H N N 329 TYR HH H N N 330 TYR HXT H N N 331 VAL N N N N 332 VAL CA C N S 333 VAL C C N N 334 VAL O O N N 335 VAL CB C N N 336 VAL CG1 C N N 337 VAL CG2 C N N 338 VAL OXT O N N 339 VAL H H N N 340 VAL H2 H N N 341 VAL HA H N N 342 VAL HB H N N 343 VAL HG11 H N N 344 VAL HG12 H N N 345 VAL HG13 H N N 346 VAL HG21 H N N 347 VAL HG22 H N N 348 VAL HG23 H N N 349 VAL HXT H N N 350 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4CLN _pdbx_initial_refinement_model.details 'PDB ENTRY 4CLN' # _atom_sites.entry_id 1AHR _atom_sites.fract_transf_matrix[1][1] 0.036914 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018015 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009912 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_