data_1AHR
# 
_entry.id   1AHR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1AHR         pdb_00001ahr 10.2210/pdb1ahr/pdb 
WWPDB D_1000170831 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-06-16 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-12-21 
5 'Structure model' 1 4 2023-08-09 
6 'Structure model' 1 5 2024-05-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' Other                       
6 5 'Structure model' 'Refinement description'    
7 6 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2                    
2 4 'Structure model' pdbx_database_status          
3 4 'Structure model' pdbx_struct_conn_angle        
4 4 'Structure model' struct_conn                   
5 4 'Structure model' struct_ref_seq_dif            
6 4 'Structure model' struct_site                   
7 5 'Structure model' pdbx_initial_refinement_model 
8 6 'Structure model' chem_comp_atom                
9 6 'Structure model' chem_comp_bond                
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                        
2  4 'Structure model' '_database_2.pdbx_database_accession'         
3  4 'Structure model' '_pdbx_database_status.process_site'          
4  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
16 4 'Structure model' '_pdbx_struct_conn_angle.value'               
17 4 'Structure model' '_struct_conn.pdbx_dist_value'                
18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
30 4 'Structure model' '_struct_ref_seq_dif.details'                 
31 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
32 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
33 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AHR 
_pdbx_database_status.recvd_initial_deposition_date   1997-04-10 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tabernero, L.' 1 
'Sack, J.'      2 
# 
_citation.id                        primary 
_citation.title                     
;The structure of a calmodulin mutant with a deletion in the central helix: implications for molecular recognition and protein binding.
;
_citation.journal_abbrev            Structure 
_citation.journal_volume            5 
_citation.page_first                613 
_citation.page_last                 622 
_citation.year                      1997 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9195880 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(97)00217-7' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tabernero, L.'   1 ? 
primary 'Taylor, D.A.'    2 ? 
primary 'Chandross, R.J.' 3 ? 
primary 'VanBerkum, M.F.' 4 ? 
primary 'Means, A.R.'     5 ? 
primary 'Quiocho, F.A.'   6 ? 
primary 'Sack, J.S.'      7 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man CALMODULIN    16478.133 1   ? 'DEL(T79), DEL(D80)' ? ? 
2 non-polymer syn 'CALCIUM ION' 40.078    4   ? ?                    ? ? 
3 water       nat water         18.015    113 ? ?                    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDSE
EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDSE
EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION' CA  
3 water         HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASP n 
1 3   GLN n 
1 4   LEU n 
1 5   THR n 
1 6   GLU n 
1 7   GLU n 
1 8   GLN n 
1 9   ILE n 
1 10  ALA n 
1 11  GLU n 
1 12  PHE n 
1 13  LYS n 
1 14  GLU n 
1 15  ALA n 
1 16  PHE n 
1 17  SER n 
1 18  LEU n 
1 19  PHE n 
1 20  ASP n 
1 21  LYS n 
1 22  ASP n 
1 23  GLY n 
1 24  ASP n 
1 25  GLY n 
1 26  THR n 
1 27  ILE n 
1 28  THR n 
1 29  THR n 
1 30  LYS n 
1 31  GLU n 
1 32  LEU n 
1 33  GLY n 
1 34  THR n 
1 35  VAL n 
1 36  MET n 
1 37  ARG n 
1 38  SER n 
1 39  LEU n 
1 40  GLY n 
1 41  GLN n 
1 42  ASN n 
1 43  PRO n 
1 44  THR n 
1 45  GLU n 
1 46  ALA n 
1 47  GLU n 
1 48  LEU n 
1 49  GLN n 
1 50  ASP n 
1 51  MET n 
1 52  ILE n 
1 53  ASN n 
1 54  GLU n 
1 55  VAL n 
1 56  ASP n 
1 57  ALA n 
1 58  ASP n 
1 59  GLY n 
1 60  ASN n 
1 61  GLY n 
1 62  THR n 
1 63  ILE n 
1 64  ASP n 
1 65  PHE n 
1 66  PRO n 
1 67  GLU n 
1 68  PHE n 
1 69  LEU n 
1 70  THR n 
1 71  MET n 
1 72  MET n 
1 73  ALA n 
1 74  ARG n 
1 75  LYS n 
1 76  MET n 
1 77  LYS n 
1 78  ASP n 
1 79  SER n 
1 80  GLU n 
1 81  GLU n 
1 82  GLU n 
1 83  ILE n 
1 84  ARG n 
1 85  GLU n 
1 86  ALA n 
1 87  PHE n 
1 88  ARG n 
1 89  VAL n 
1 90  PHE n 
1 91  ASP n 
1 92  LYS n 
1 93  ASP n 
1 94  GLY n 
1 95  ASN n 
1 96  GLY n 
1 97  PHE n 
1 98  ILE n 
1 99  SER n 
1 100 ALA n 
1 101 ALA n 
1 102 GLU n 
1 103 LEU n 
1 104 ARG n 
1 105 HIS n 
1 106 VAL n 
1 107 MET n 
1 108 THR n 
1 109 ASN n 
1 110 LEU n 
1 111 GLY n 
1 112 GLU n 
1 113 LYS n 
1 114 LEU n 
1 115 THR n 
1 116 ASP n 
1 117 GLU n 
1 118 GLU n 
1 119 VAL n 
1 120 ASP n 
1 121 GLU n 
1 122 MET n 
1 123 ILE n 
1 124 ARG n 
1 125 GLU n 
1 126 ALA n 
1 127 ASP n 
1 128 ILE n 
1 129 ASP n 
1 130 GLY n 
1 131 ASP n 
1 132 GLY n 
1 133 GLN n 
1 134 VAL n 
1 135 ASN n 
1 136 TYR n 
1 137 GLU n 
1 138 GLU n 
1 139 PHE n 
1 140 VAL n 
1 141 THR n 
1 142 MET n 
1 143 MET n 
1 144 THR n 
1 145 SER n 
1 146 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               chicken 
_entity_src_gen.gene_src_genus                     Gallus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Gallus gallus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9031 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            293 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               293 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   GLN 3   3   3   GLN GLN A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   GLU 7   7   7   GLU GLU A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  PHE 12  12  12  PHE PHE A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  PHE 19  19  19  PHE PHE A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  MET 36  36  36  MET MET A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  GLN 41  41  41  GLN GLN A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  THR 44  44  44  THR THR A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  MET 51  51  51  MET MET A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  ASP 56  56  56  ASP ASP A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  PRO 66  66  66  PRO PRO A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  PHE 68  68  68  PHE PHE A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  THR 70  70  70  THR THR A . n 
A 1 71  MET 71  71  71  MET MET A . n 
A 1 72  MET 72  72  72  MET MET A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  MET 76  76  76  MET MET A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  SER 79  81  81  SER SER A . n 
A 1 80  GLU 80  82  82  GLU GLU A . n 
A 1 81  GLU 81  83  83  GLU GLU A . n 
A 1 82  GLU 82  84  84  GLU GLU A . n 
A 1 83  ILE 83  85  85  ILE ILE A . n 
A 1 84  ARG 84  86  86  ARG ARG A . n 
A 1 85  GLU 85  87  87  GLU GLU A . n 
A 1 86  ALA 86  88  88  ALA ALA A . n 
A 1 87  PHE 87  89  89  PHE PHE A . n 
A 1 88  ARG 88  90  90  ARG ARG A . n 
A 1 89  VAL 89  91  91  VAL VAL A . n 
A 1 90  PHE 90  92  92  PHE PHE A . n 
A 1 91  ASP 91  93  93  ASP ASP A . n 
A 1 92  LYS 92  94  94  LYS LYS A . n 
A 1 93  ASP 93  95  95  ASP ASP A . n 
A 1 94  GLY 94  96  96  GLY GLY A . n 
A 1 95  ASN 95  97  97  ASN ASN A . n 
A 1 96  GLY 96  98  98  GLY GLY A . n 
A 1 97  PHE 97  99  99  PHE PHE A . n 
A 1 98  ILE 98  100 100 ILE ILE A . n 
A 1 99  SER 99  101 101 SER SER A . n 
A 1 100 ALA 100 102 102 ALA ALA A . n 
A 1 101 ALA 101 103 103 ALA ALA A . n 
A 1 102 GLU 102 104 104 GLU GLU A . n 
A 1 103 LEU 103 105 105 LEU LEU A . n 
A 1 104 ARG 104 106 106 ARG ARG A . n 
A 1 105 HIS 105 107 107 HIS HIS A . n 
A 1 106 VAL 106 108 108 VAL VAL A . n 
A 1 107 MET 107 109 109 MET MET A . n 
A 1 108 THR 108 110 110 THR THR A . n 
A 1 109 ASN 109 111 111 ASN ASN A . n 
A 1 110 LEU 110 112 112 LEU LEU A . n 
A 1 111 GLY 111 113 113 GLY GLY A . n 
A 1 112 GLU 112 114 114 GLU GLU A . n 
A 1 113 LYS 113 115 115 LYS LYS A . n 
A 1 114 LEU 114 116 116 LEU LEU A . n 
A 1 115 THR 115 117 117 THR THR A . n 
A 1 116 ASP 116 118 118 ASP ASP A . n 
A 1 117 GLU 117 119 119 GLU GLU A . n 
A 1 118 GLU 118 120 120 GLU GLU A . n 
A 1 119 VAL 119 121 121 VAL VAL A . n 
A 1 120 ASP 120 122 122 ASP ASP A . n 
A 1 121 GLU 121 123 123 GLU GLU A . n 
A 1 122 MET 122 124 124 MET MET A . n 
A 1 123 ILE 123 125 125 ILE ILE A . n 
A 1 124 ARG 124 126 126 ARG ARG A . n 
A 1 125 GLU 125 127 127 GLU GLU A . n 
A 1 126 ALA 126 128 128 ALA ALA A . n 
A 1 127 ASP 127 129 129 ASP ASP A . n 
A 1 128 ILE 128 130 130 ILE ILE A . n 
A 1 129 ASP 129 131 131 ASP ASP A . n 
A 1 130 GLY 130 132 132 GLY GLY A . n 
A 1 131 ASP 131 133 133 ASP ASP A . n 
A 1 132 GLY 132 134 134 GLY GLY A . n 
A 1 133 GLN 133 135 135 GLN GLN A . n 
A 1 134 VAL 134 136 136 VAL VAL A . n 
A 1 135 ASN 135 137 137 ASN ASN A . n 
A 1 136 TYR 136 138 138 TYR TYR A . n 
A 1 137 GLU 137 139 139 GLU GLU A . n 
A 1 138 GLU 138 140 140 GLU GLU A . n 
A 1 139 PHE 139 141 141 PHE PHE A . n 
A 1 140 VAL 140 142 142 VAL VAL A . n 
A 1 141 THR 141 143 143 THR THR A . n 
A 1 142 MET 142 144 144 MET MET A . n 
A 1 143 MET 143 145 145 MET MET A . n 
A 1 144 THR 144 146 146 THR THR A . n 
A 1 145 SER 145 147 147 SER SER A . n 
A 1 146 LYS 146 148 148 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1   149 149 CA  CA  A . 
C 2 CA  1   150 150 CA  CA  A . 
D 2 CA  1   151 151 CA  CA  A . 
E 2 CA  1   152 152 CA  CA  A . 
F 3 HOH 1   201 201 HOH HOH A . 
F 3 HOH 2   202 202 HOH HOH A . 
F 3 HOH 3   203 203 HOH HOH A . 
F 3 HOH 4   204 204 HOH HOH A . 
F 3 HOH 5   205 205 HOH HOH A . 
F 3 HOH 6   206 206 HOH HOH A . 
F 3 HOH 7   207 207 HOH HOH A . 
F 3 HOH 8   208 208 HOH HOH A . 
F 3 HOH 9   209 209 HOH HOH A . 
F 3 HOH 10  210 210 HOH HOH A . 
F 3 HOH 11  211 211 HOH HOH A . 
F 3 HOH 12  212 212 HOH HOH A . 
F 3 HOH 13  213 213 HOH HOH A . 
F 3 HOH 14  214 214 HOH HOH A . 
F 3 HOH 15  215 215 HOH HOH A . 
F 3 HOH 16  216 216 HOH HOH A . 
F 3 HOH 17  217 217 HOH HOH A . 
F 3 HOH 18  218 218 HOH HOH A . 
F 3 HOH 19  219 219 HOH HOH A . 
F 3 HOH 20  220 220 HOH HOH A . 
F 3 HOH 21  221 221 HOH HOH A . 
F 3 HOH 22  222 222 HOH HOH A . 
F 3 HOH 23  223 223 HOH HOH A . 
F 3 HOH 24  224 224 HOH HOH A . 
F 3 HOH 25  225 225 HOH HOH A . 
F 3 HOH 26  226 226 HOH HOH A . 
F 3 HOH 27  227 227 HOH HOH A . 
F 3 HOH 28  228 228 HOH HOH A . 
F 3 HOH 29  229 229 HOH HOH A . 
F 3 HOH 30  230 230 HOH HOH A . 
F 3 HOH 31  231 231 HOH HOH A . 
F 3 HOH 32  232 232 HOH HOH A . 
F 3 HOH 33  233 233 HOH HOH A . 
F 3 HOH 34  234 234 HOH HOH A . 
F 3 HOH 35  235 235 HOH HOH A . 
F 3 HOH 36  236 236 HOH HOH A . 
F 3 HOH 37  237 237 HOH HOH A . 
F 3 HOH 38  238 238 HOH HOH A . 
F 3 HOH 39  239 239 HOH HOH A . 
F 3 HOH 40  240 240 HOH HOH A . 
F 3 HOH 41  241 241 HOH HOH A . 
F 3 HOH 42  242 242 HOH HOH A . 
F 3 HOH 43  243 243 HOH HOH A . 
F 3 HOH 44  244 244 HOH HOH A . 
F 3 HOH 45  245 245 HOH HOH A . 
F 3 HOH 46  246 246 HOH HOH A . 
F 3 HOH 47  247 247 HOH HOH A . 
F 3 HOH 48  248 248 HOH HOH A . 
F 3 HOH 49  249 249 HOH HOH A . 
F 3 HOH 50  250 250 HOH HOH A . 
F 3 HOH 51  251 251 HOH HOH A . 
F 3 HOH 52  252 252 HOH HOH A . 
F 3 HOH 53  253 253 HOH HOH A . 
F 3 HOH 54  254 254 HOH HOH A . 
F 3 HOH 55  255 255 HOH HOH A . 
F 3 HOH 56  256 256 HOH HOH A . 
F 3 HOH 57  257 257 HOH HOH A . 
F 3 HOH 58  258 258 HOH HOH A . 
F 3 HOH 59  259 259 HOH HOH A . 
F 3 HOH 60  260 260 HOH HOH A . 
F 3 HOH 61  261 261 HOH HOH A . 
F 3 HOH 62  262 262 HOH HOH A . 
F 3 HOH 63  263 263 HOH HOH A . 
F 3 HOH 64  264 264 HOH HOH A . 
F 3 HOH 65  265 265 HOH HOH A . 
F 3 HOH 66  266 266 HOH HOH A . 
F 3 HOH 67  267 267 HOH HOH A . 
F 3 HOH 68  268 268 HOH HOH A . 
F 3 HOH 69  269 269 HOH HOH A . 
F 3 HOH 70  270 270 HOH HOH A . 
F 3 HOH 71  271 271 HOH HOH A . 
F 3 HOH 72  272 272 HOH HOH A . 
F 3 HOH 73  273 273 HOH HOH A . 
F 3 HOH 74  274 274 HOH HOH A . 
F 3 HOH 75  275 275 HOH HOH A . 
F 3 HOH 76  276 276 HOH HOH A . 
F 3 HOH 77  277 277 HOH HOH A . 
F 3 HOH 78  278 278 HOH HOH A . 
F 3 HOH 79  279 279 HOH HOH A . 
F 3 HOH 80  280 280 HOH HOH A . 
F 3 HOH 81  281 281 HOH HOH A . 
F 3 HOH 82  282 282 HOH HOH A . 
F 3 HOH 83  283 283 HOH HOH A . 
F 3 HOH 84  284 284 HOH HOH A . 
F 3 HOH 85  285 285 HOH HOH A . 
F 3 HOH 86  286 286 HOH HOH A . 
F 3 HOH 87  287 287 HOH HOH A . 
F 3 HOH 88  288 288 HOH HOH A . 
F 3 HOH 89  289 289 HOH HOH A . 
F 3 HOH 90  290 290 HOH HOH A . 
F 3 HOH 91  291 291 HOH HOH A . 
F 3 HOH 92  292 292 HOH HOH A . 
F 3 HOH 93  293 293 HOH HOH A . 
F 3 HOH 94  294 294 HOH HOH A . 
F 3 HOH 95  295 295 HOH HOH A . 
F 3 HOH 96  296 296 HOH HOH A . 
F 3 HOH 97  297 297 HOH HOH A . 
F 3 HOH 98  298 298 HOH HOH A . 
F 3 HOH 99  299 299 HOH HOH A . 
F 3 HOH 100 300 300 HOH HOH A . 
F 3 HOH 101 301 301 HOH HOH A . 
F 3 HOH 102 302 302 HOH HOH A . 
F 3 HOH 103 303 303 HOH HOH A . 
F 3 HOH 104 304 304 HOH HOH A . 
F 3 HOH 105 305 305 HOH HOH A . 
F 3 HOH 106 306 306 HOH HOH A . 
F 3 HOH 107 307 307 HOH HOH A . 
F 3 HOH 108 308 308 HOH HOH A . 
F 3 HOH 109 309 309 HOH HOH A . 
F 3 HOH 110 310 310 HOH HOH A . 
F 3 HOH 111 311 311 HOH HOH A . 
F 3 HOH 112 312 312 HOH HOH A . 
F 3 HOH 113 313 313 HOH HOH A . 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.1 ? 1 
X-PLOR refinement       3.1 ? 2 
UCSD   'data reduction' .   ? 3 
ROCKS  'data scaling'   .   ? 4 
X-PLOR phasing          3.1 ? 5 
# 
_cell.entry_id           1AHR 
_cell.length_a           27.090 
_cell.length_b           55.510 
_cell.length_c           100.890 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1AHR 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
_exptl.entry_id          1AHR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.32 
_exptl_crystal.density_percent_sol   46.56 
_exptl_crystal.description           'SEPARATE ROTATION SEARCH FOR EACH DOMAIN' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.25 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '28-33% MPD, 15% ETHANOL, 5MM CACL, 20MM NA ACETATE, PH 4.25' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           300 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   1988-12 
_diffrn_detector.details                COLLIMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AHR 
_reflns.observed_criterion_sigma_I   2. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   14407 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         67.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.5010000 
_reflns.pdbx_netI_over_sigmaI        8.68 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.4 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1AHR 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2110000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2110000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 4CLN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1149 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             113 
_refine_hist.number_atoms_total               1266 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.8   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_database_PDB_matrix.entry_id          1AHR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1AHR 
_struct.title                     'CALMODULIN MUTANT WITH A TWO RESIDUE DELETION IN THE CENTRAL HELIX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AHR 
_struct_keywords.pdbx_keywords   'CALCIUM-BINDING PROTEIN' 
_struct_keywords.text            'CALMODULIN, CALCIUM-BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CALM_CHICK 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P62149 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTD
SEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMMTSK
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1AHR 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 146 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P62149 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  148 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       148 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1AHR ? A ? ? UNP P62149 THR 79 deletion ? 1 
1 1AHR ? A ? ? UNP P62149 ASP 80 deletion ? 2 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 8   ? PHE A 19  ? GLN A 8   PHE A 19  1 ? 12 
HELX_P HELX_P2 2 THR A 29  ? SER A 38  ? THR A 29  SER A 38  1 ? 10 
HELX_P HELX_P3 3 GLU A 45  ? VAL A 55  ? GLU A 45  VAL A 55  1 ? 11 
HELX_P HELX_P4 4 PHE A 65  ? PHE A 90  ? PHE A 65  PHE A 92  1 ? 26 
HELX_P HELX_P5 5 ALA A 100 ? LEU A 110 ? ALA A 102 LEU A 112 1 ? 11 
HELX_P HELX_P6 6 ASP A 116 ? GLU A 125 ? ASP A 118 GLU A 127 1 ? 10 
HELX_P HELX_P7 7 TYR A 136 ? MET A 142 ? TYR A 138 MET A 144 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A ASP 20  OD1 ? ? ? 1_555 B CA  . CA ? ? A ASP 20  A CA  149 1_555 ? ? ? ? ? ? ? 2.115 ? ? 
metalc2  metalc ? ? A ASP 22  OD1 ? ? ? 1_555 B CA  . CA ? ? A ASP 22  A CA  149 1_555 ? ? ? ? ? ? ? 2.728 ? ? 
metalc3  metalc ? ? A ASP 24  OD1 ? ? ? 1_555 B CA  . CA ? ? A ASP 24  A CA  149 1_555 ? ? ? ? ? ? ? 2.501 ? ? 
metalc4  metalc ? ? A THR 26  O   ? ? ? 1_555 B CA  . CA ? ? A THR 26  A CA  149 1_555 ? ? ? ? ? ? ? 2.074 ? ? 
metalc5  metalc ? ? A GLU 31  OE1 ? ? ? 1_555 B CA  . CA ? ? A GLU 31  A CA  149 1_555 ? ? ? ? ? ? ? 2.356 ? ? 
metalc6  metalc ? ? A GLU 31  OE2 ? ? ? 1_555 B CA  . CA ? ? A GLU 31  A CA  149 1_555 ? ? ? ? ? ? ? 2.523 ? ? 
metalc7  metalc ? ? A ASP 56  OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 56  A CA  150 1_555 ? ? ? ? ? ? ? 2.386 ? ? 
metalc8  metalc ? ? A ASP 58  OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 58  A CA  150 1_555 ? ? ? ? ? ? ? 2.426 ? ? 
metalc9  metalc ? ? A ASN 60  OD1 ? ? ? 1_555 C CA  . CA ? ? A ASN 60  A CA  150 1_555 ? ? ? ? ? ? ? 2.168 ? ? 
metalc10 metalc ? ? A THR 62  O   ? ? ? 1_555 C CA  . CA ? ? A THR 62  A CA  150 1_555 ? ? ? ? ? ? ? 2.372 ? ? 
metalc11 metalc ? ? A GLU 67  OE2 ? ? ? 1_555 C CA  . CA ? ? A GLU 67  A CA  150 1_555 ? ? ? ? ? ? ? 2.303 ? ? 
metalc12 metalc ? ? A GLU 67  OE1 ? ? ? 1_555 C CA  . CA ? ? A GLU 67  A CA  150 1_555 ? ? ? ? ? ? ? 2.576 ? ? 
metalc13 metalc ? ? A ASP 91  OD1 ? ? ? 1_555 D CA  . CA ? ? A ASP 93  A CA  151 1_555 ? ? ? ? ? ? ? 2.292 ? ? 
metalc14 metalc ? ? A ASP 93  OD1 ? ? ? 1_555 D CA  . CA ? ? A ASP 95  A CA  151 1_555 ? ? ? ? ? ? ? 2.489 ? ? 
metalc15 metalc ? ? A ASN 95  OD1 ? ? ? 1_555 D CA  . CA ? ? A ASN 97  A CA  151 1_555 ? ? ? ? ? ? ? 1.928 ? ? 
metalc16 metalc ? ? A PHE 97  O   ? ? ? 1_555 D CA  . CA ? ? A PHE 99  A CA  151 1_555 ? ? ? ? ? ? ? 2.137 ? ? 
metalc17 metalc ? ? A GLU 102 OE2 ? ? ? 1_555 D CA  . CA ? ? A GLU 104 A CA  151 1_555 ? ? ? ? ? ? ? 2.620 ? ? 
metalc18 metalc ? ? A GLU 102 OE1 ? ? ? 1_555 D CA  . CA ? ? A GLU 104 A CA  151 1_555 ? ? ? ? ? ? ? 2.530 ? ? 
metalc19 metalc ? ? A ASP 127 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASP 129 A CA  152 1_555 ? ? ? ? ? ? ? 2.183 ? ? 
metalc20 metalc ? ? A ASP 129 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASP 131 A CA  152 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc21 metalc ? ? A ASP 131 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASP 133 A CA  152 1_555 ? ? ? ? ? ? ? 2.172 ? ? 
metalc22 metalc ? ? A ASP 131 OD2 ? ? ? 1_555 E CA  . CA ? ? A ASP 133 A CA  152 1_555 ? ? ? ? ? ? ? 3.114 ? ? 
metalc23 metalc ? ? A GLN 133 O   ? ? ? 1_555 E CA  . CA ? ? A GLN 135 A CA  152 1_555 ? ? ? ? ? ? ? 2.004 ? ? 
metalc24 metalc ? ? A GLU 138 OE2 ? ? ? 1_555 E CA  . CA ? ? A GLU 140 A CA  152 1_555 ? ? ? ? ? ? ? 2.290 ? ? 
metalc25 metalc ? ? A GLU 138 OE1 ? ? ? 1_555 E CA  . CA ? ? A GLU 140 A CA  152 1_555 ? ? ? ? ? ? ? 2.478 ? ? 
metalc26 metalc ? ? C CA  .   CA  ? ? ? 1_555 F HOH . O  ? ? A CA  150 A HOH 202 1_555 ? ? ? ? ? ? ? 2.011 ? ? 
metalc27 metalc ? ? D CA  .   CA  ? ? ? 1_555 F HOH . O  ? ? A CA  151 A HOH 254 1_555 ? ? ? ? ? ? ? 2.760 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASP 20  ? A ASP 20  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OD1 ? A ASP 22  ? A ASP 22  ? 1_555 79.7  ? 
2  OD1 ? A ASP 20  ? A ASP 20  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OD1 ? A ASP 24  ? A ASP 24  ? 1_555 84.7  ? 
3  OD1 ? A ASP 22  ? A ASP 22  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OD1 ? A ASP 24  ? A ASP 24  ? 1_555 82.3  ? 
4  OD1 ? A ASP 20  ? A ASP 20  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O   ? A THR 26  ? A THR 26  ? 1_555 85.5  ? 
5  OD1 ? A ASP 22  ? A ASP 22  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O   ? A THR 26  ? A THR 26  ? 1_555 161.0 ? 
6  OD1 ? A ASP 24  ? A ASP 24  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 O   ? A THR 26  ? A THR 26  ? 1_555 84.5  ? 
7  OD1 ? A ASP 20  ? A ASP 20  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE1 ? A GLU 31  ? A GLU 31  ? 1_555 105.4 ? 
8  OD1 ? A ASP 22  ? A ASP 22  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE1 ? A GLU 31  ? A GLU 31  ? 1_555 113.3 ? 
9  OD1 ? A ASP 24  ? A ASP 24  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE1 ? A GLU 31  ? A GLU 31  ? 1_555 162.4 ? 
10 O   ? A THR 26  ? A THR 26  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE1 ? A GLU 31  ? A GLU 31  ? 1_555 82.0  ? 
11 OD1 ? A ASP 20  ? A ASP 20  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31  ? A GLU 31  ? 1_555 91.6  ? 
12 OD1 ? A ASP 22  ? A ASP 22  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31  ? A GLU 31  ? 1_555 60.4  ? 
13 OD1 ? A ASP 24  ? A ASP 24  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31  ? A GLU 31  ? 1_555 142.5 ? 
14 O   ? A THR 26  ? A THR 26  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31  ? A GLU 31  ? 1_555 132.5 ? 
15 OE1 ? A GLU 31  ? A GLU 31  ? 1_555 CA ? B CA . ? A CA 149 ? 1_555 OE2 ? A GLU 31  ? A GLU 31  ? 1_555 53.2  ? 
16 OD1 ? A ASP 56  ? A ASP 56  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OD1 ? A ASP 58  ? A ASP 58  ? 1_555 74.9  ? 
17 OD1 ? A ASP 56  ? A ASP 56  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OD1 ? A ASN 60  ? A ASN 60  ? 1_555 78.4  ? 
18 OD1 ? A ASP 58  ? A ASP 58  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OD1 ? A ASN 60  ? A ASN 60  ? 1_555 72.1  ? 
19 OD1 ? A ASP 56  ? A ASP 56  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? A THR 62  ? A THR 62  ? 1_555 84.9  ? 
20 OD1 ? A ASP 58  ? A ASP 58  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? A THR 62  ? A THR 62  ? 1_555 146.3 ? 
21 OD1 ? A ASN 60  ? A ASN 60  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? A THR 62  ? A THR 62  ? 1_555 77.7  ? 
22 OD1 ? A ASP 56  ? A ASP 56  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE2 ? A GLU 67  ? A GLU 67  ? 1_555 89.3  ? 
23 OD1 ? A ASP 58  ? A ASP 58  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE2 ? A GLU 67  ? A GLU 67  ? 1_555 78.9  ? 
24 OD1 ? A ASN 60  ? A ASN 60  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE2 ? A GLU 67  ? A GLU 67  ? 1_555 150.5 ? 
25 O   ? A THR 62  ? A THR 62  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE2 ? A GLU 67  ? A GLU 67  ? 1_555 128.3 ? 
26 OD1 ? A ASP 56  ? A ASP 56  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 1_555 114.0 ? 
27 OD1 ? A ASP 58  ? A ASP 58  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 1_555 128.8 ? 
28 OD1 ? A ASN 60  ? A ASN 60  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 1_555 157.0 ? 
29 O   ? A THR 62  ? A THR 62  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 1_555 84.0  ? 
30 OE2 ? A GLU 67  ? A GLU 67  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 OE1 ? A GLU 67  ? A GLU 67  ? 1_555 52.2  ? 
31 OD1 ? A ASP 56  ? A ASP 56  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? F HOH .   ? A HOH 202 ? 1_555 158.9 ? 
32 OD1 ? A ASP 58  ? A ASP 58  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? F HOH .   ? A HOH 202 ? 1_555 84.0  ? 
33 OD1 ? A ASN 60  ? A ASN 60  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? F HOH .   ? A HOH 202 ? 1_555 96.3  ? 
34 O   ? A THR 62  ? A THR 62  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? F HOH .   ? A HOH 202 ? 1_555 114.2 ? 
35 OE2 ? A GLU 67  ? A GLU 67  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? F HOH .   ? A HOH 202 ? 1_555 85.6  ? 
36 OE1 ? A GLU 67  ? A GLU 67  ? 1_555 CA ? C CA . ? A CA 150 ? 1_555 O   ? F HOH .   ? A HOH 202 ? 1_555 78.6  ? 
37 OD1 ? A ASP 91  ? A ASP 93  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OD1 ? A ASP 93  ? A ASP 95  ? 1_555 94.0  ? 
38 OD1 ? A ASP 91  ? A ASP 93  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OD1 ? A ASN 95  ? A ASN 97  ? 1_555 92.7  ? 
39 OD1 ? A ASP 93  ? A ASP 95  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OD1 ? A ASN 95  ? A ASN 97  ? 1_555 80.7  ? 
40 OD1 ? A ASP 91  ? A ASP 93  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? A PHE 97  ? A PHE 99  ? 1_555 78.1  ? 
41 OD1 ? A ASP 93  ? A ASP 95  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? A PHE 97  ? A PHE 99  ? 1_555 162.5 ? 
42 OD1 ? A ASN 95  ? A ASN 97  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? A PHE 97  ? A PHE 99  ? 1_555 84.1  ? 
43 OD1 ? A ASP 91  ? A ASP 93  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE2 ? A GLU 102 ? A GLU 104 ? 1_555 89.0  ? 
44 OD1 ? A ASP 93  ? A ASP 95  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE2 ? A GLU 102 ? A GLU 104 ? 1_555 80.8  ? 
45 OD1 ? A ASN 95  ? A ASN 97  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE2 ? A GLU 102 ? A GLU 104 ? 1_555 161.4 ? 
46 O   ? A PHE 97  ? A PHE 99  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE2 ? A GLU 102 ? A GLU 104 ? 1_555 114.3 ? 
47 OD1 ? A ASP 91  ? A ASP 93  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 102 ? A GLU 104 ? 1_555 102.0 ? 
48 OD1 ? A ASP 93  ? A ASP 95  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 102 ? A GLU 104 ? 1_555 127.6 ? 
49 OD1 ? A ASN 95  ? A ASN 97  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 102 ? A GLU 104 ? 1_555 146.2 ? 
50 O   ? A PHE 97  ? A PHE 99  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 102 ? A GLU 104 ? 1_555 69.7  ? 
51 OE2 ? A GLU 102 ? A GLU 104 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 OE1 ? A GLU 102 ? A GLU 104 ? 1_555 50.4  ? 
52 OD1 ? A ASP 91  ? A ASP 93  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? F HOH .   ? A HOH 254 ? 1_555 163.3 ? 
53 OD1 ? A ASP 93  ? A ASP 95  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? F HOH .   ? A HOH 254 ? 1_555 90.9  ? 
54 OD1 ? A ASN 95  ? A ASN 97  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? F HOH .   ? A HOH 254 ? 1_555 72.3  ? 
55 O   ? A PHE 97  ? A PHE 99  ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? F HOH .   ? A HOH 254 ? 1_555 92.7  ? 
56 OE2 ? A GLU 102 ? A GLU 104 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? F HOH .   ? A HOH 254 ? 1_555 107.5 ? 
57 OE1 ? A GLU 102 ? A GLU 104 ? 1_555 CA ? D CA . ? A CA 151 ? 1_555 O   ? F HOH .   ? A HOH 254 ? 1_555 87.5  ? 
58 OD1 ? A ASP 127 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD1 ? A ASP 129 ? A ASP 131 ? 1_555 82.3  ? 
59 OD1 ? A ASP 127 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD1 ? A ASP 131 ? A ASP 133 ? 1_555 81.7  ? 
60 OD1 ? A ASP 129 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD1 ? A ASP 131 ? A ASP 133 ? 1_555 85.5  ? 
61 OD1 ? A ASP 127 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD2 ? A ASP 131 ? A ASP 133 ? 1_555 116.4 ? 
62 OD1 ? A ASP 129 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD2 ? A ASP 131 ? A ASP 133 ? 1_555 65.2  ? 
63 OD1 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OD2 ? A ASP 131 ? A ASP 133 ? 1_555 44.8  ? 
64 OD1 ? A ASP 127 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O   ? A GLN 133 ? A GLN 135 ? 1_555 83.6  ? 
65 OD1 ? A ASP 129 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O   ? A GLN 133 ? A GLN 135 ? 1_555 163.8 ? 
66 OD1 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O   ? A GLN 133 ? A GLN 135 ? 1_555 84.5  ? 
67 OD2 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 O   ? A GLN 133 ? A GLN 135 ? 1_555 114.8 ? 
68 OD1 ? A ASP 127 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 138 ? A GLU 140 ? 1_555 79.4  ? 
69 OD1 ? A ASP 129 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 138 ? A GLU 140 ? 1_555 76.0  ? 
70 OD1 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 138 ? A GLU 140 ? 1_555 155.1 ? 
71 OD2 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 138 ? A GLU 140 ? 1_555 134.3 ? 
72 O   ? A GLN 133 ? A GLN 135 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE2 ? A GLU 138 ? A GLU 140 ? 1_555 109.2 ? 
73 OD1 ? A ASP 127 ? A ASP 129 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 138 ? A GLU 140 ? 1_555 119.1 ? 
74 OD1 ? A ASP 129 ? A ASP 131 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 138 ? A GLU 140 ? 1_555 115.8 ? 
75 OD1 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 138 ? A GLU 140 ? 1_555 150.8 ? 
76 OD2 ? A ASP 131 ? A ASP 133 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 138 ? A GLU 140 ? 1_555 124.1 ? 
77 O   ? A GLN 133 ? A GLN 135 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 138 ? A GLU 140 ? 1_555 78.3  ? 
78 OE2 ? A GLU 138 ? A GLU 140 ? 1_555 CA ? E CA . ? A CA 152 ? 1_555 OE1 ? A GLU 138 ? A GLU 140 ? 1_555 54.2  ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 97  ? SER A 99  ? PHE A 99  SER A 101 
A 2 GLN A 133 ? ASN A 135 ? GLN A 135 ASN A 137 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    98 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     100 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    134 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     136 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA 149 ? 5 'BINDING SITE FOR RESIDUE CA A 149' 
AC2 Software A CA 150 ? 6 'BINDING SITE FOR RESIDUE CA A 150' 
AC3 Software A CA 151 ? 6 'BINDING SITE FOR RESIDUE CA A 151' 
AC4 Software A CA 152 ? 5 'BINDING SITE FOR RESIDUE CA A 152' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASP A 20  ? ASP A 20  . ? 1_555 ? 
2  AC1 5 ASP A 22  ? ASP A 22  . ? 1_555 ? 
3  AC1 5 ASP A 24  ? ASP A 24  . ? 1_555 ? 
4  AC1 5 THR A 26  ? THR A 26  . ? 1_555 ? 
5  AC1 5 GLU A 31  ? GLU A 31  . ? 1_555 ? 
6  AC2 6 ASP A 56  ? ASP A 56  . ? 1_555 ? 
7  AC2 6 ASP A 58  ? ASP A 58  . ? 1_555 ? 
8  AC2 6 ASN A 60  ? ASN A 60  . ? 1_555 ? 
9  AC2 6 THR A 62  ? THR A 62  . ? 1_555 ? 
10 AC2 6 GLU A 67  ? GLU A 67  . ? 1_555 ? 
11 AC2 6 HOH F .   ? HOH A 202 . ? 1_555 ? 
12 AC3 6 ASP A 91  ? ASP A 93  . ? 1_555 ? 
13 AC3 6 ASP A 93  ? ASP A 95  . ? 1_555 ? 
14 AC3 6 ASN A 95  ? ASN A 97  . ? 1_555 ? 
15 AC3 6 PHE A 97  ? PHE A 99  . ? 1_555 ? 
16 AC3 6 GLU A 102 ? GLU A 104 . ? 1_555 ? 
17 AC3 6 HOH F .   ? HOH A 254 . ? 1_555 ? 
18 AC4 5 ASP A 127 ? ASP A 129 . ? 1_555 ? 
19 AC4 5 ASP A 129 ? ASP A 131 . ? 1_555 ? 
20 AC4 5 ASP A 131 ? ASP A 133 . ? 1_555 ? 
21 AC4 5 GLN A 133 ? GLN A 135 . ? 1_555 ? 
22 AC4 5 GLU A 138 ? GLU A 140 . ? 1_555 ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              39 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              39 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              39 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.79 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            14.49 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 2   ? ? -48.59  100.24  
2 1 LEU A 4   ? ? 6.62    132.37  
3 1 THR A 5   ? ? -67.85  -175.51 
4 1 ASN A 97  ? ? -58.29  0.53    
5 1 ILE A 125 ? ? -72.53  27.33   
6 1 ARG A 126 ? ? -140.63 -10.88  
7 1 SER A 147 ? ? -21.21  136.37  
# 
_pdbx_entry_details.entry_id                 1AHR 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         
;SEQUENCE AND NUMBERING IS AS IN WILD TYPE CALMODULIN
(PDB ENTRY 4CLN) WITH RESIDUES THR 79 AND ASP 80 DELETED.
;
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CA  CA   CA N N 74  
GLN N    N  N N 75  
GLN CA   C  N S 76  
GLN C    C  N N 77  
GLN O    O  N N 78  
GLN CB   C  N N 79  
GLN CG   C  N N 80  
GLN CD   C  N N 81  
GLN OE1  O  N N 82  
GLN NE2  N  N N 83  
GLN OXT  O  N N 84  
GLN H    H  N N 85  
GLN H2   H  N N 86  
GLN HA   H  N N 87  
GLN HB2  H  N N 88  
GLN HB3  H  N N 89  
GLN HG2  H  N N 90  
GLN HG3  H  N N 91  
GLN HE21 H  N N 92  
GLN HE22 H  N N 93  
GLN HXT  H  N N 94  
GLU N    N  N N 95  
GLU CA   C  N S 96  
GLU C    C  N N 97  
GLU O    O  N N 98  
GLU CB   C  N N 99  
GLU CG   C  N N 100 
GLU CD   C  N N 101 
GLU OE1  O  N N 102 
GLU OE2  O  N N 103 
GLU OXT  O  N N 104 
GLU H    H  N N 105 
GLU H2   H  N N 106 
GLU HA   H  N N 107 
GLU HB2  H  N N 108 
GLU HB3  H  N N 109 
GLU HG2  H  N N 110 
GLU HG3  H  N N 111 
GLU HE2  H  N N 112 
GLU HXT  H  N N 113 
GLY N    N  N N 114 
GLY CA   C  N N 115 
GLY C    C  N N 116 
GLY O    O  N N 117 
GLY OXT  O  N N 118 
GLY H    H  N N 119 
GLY H2   H  N N 120 
GLY HA2  H  N N 121 
GLY HA3  H  N N 122 
GLY HXT  H  N N 123 
HIS N    N  N N 124 
HIS CA   C  N S 125 
HIS C    C  N N 126 
HIS O    O  N N 127 
HIS CB   C  N N 128 
HIS CG   C  Y N 129 
HIS ND1  N  Y N 130 
HIS CD2  C  Y N 131 
HIS CE1  C  Y N 132 
HIS NE2  N  Y N 133 
HIS OXT  O  N N 134 
HIS H    H  N N 135 
HIS H2   H  N N 136 
HIS HA   H  N N 137 
HIS HB2  H  N N 138 
HIS HB3  H  N N 139 
HIS HD1  H  N N 140 
HIS HD2  H  N N 141 
HIS HE1  H  N N 142 
HIS HE2  H  N N 143 
HIS HXT  H  N N 144 
HOH O    O  N N 145 
HOH H1   H  N N 146 
HOH H2   H  N N 147 
ILE N    N  N N 148 
ILE CA   C  N S 149 
ILE C    C  N N 150 
ILE O    O  N N 151 
ILE CB   C  N S 152 
ILE CG1  C  N N 153 
ILE CG2  C  N N 154 
ILE CD1  C  N N 155 
ILE OXT  O  N N 156 
ILE H    H  N N 157 
ILE H2   H  N N 158 
ILE HA   H  N N 159 
ILE HB   H  N N 160 
ILE HG12 H  N N 161 
ILE HG13 H  N N 162 
ILE HG21 H  N N 163 
ILE HG22 H  N N 164 
ILE HG23 H  N N 165 
ILE HD11 H  N N 166 
ILE HD12 H  N N 167 
ILE HD13 H  N N 168 
ILE HXT  H  N N 169 
LEU N    N  N N 170 
LEU CA   C  N S 171 
LEU C    C  N N 172 
LEU O    O  N N 173 
LEU CB   C  N N 174 
LEU CG   C  N N 175 
LEU CD1  C  N N 176 
LEU CD2  C  N N 177 
LEU OXT  O  N N 178 
LEU H    H  N N 179 
LEU H2   H  N N 180 
LEU HA   H  N N 181 
LEU HB2  H  N N 182 
LEU HB3  H  N N 183 
LEU HG   H  N N 184 
LEU HD11 H  N N 185 
LEU HD12 H  N N 186 
LEU HD13 H  N N 187 
LEU HD21 H  N N 188 
LEU HD22 H  N N 189 
LEU HD23 H  N N 190 
LEU HXT  H  N N 191 
LYS N    N  N N 192 
LYS CA   C  N S 193 
LYS C    C  N N 194 
LYS O    O  N N 195 
LYS CB   C  N N 196 
LYS CG   C  N N 197 
LYS CD   C  N N 198 
LYS CE   C  N N 199 
LYS NZ   N  N N 200 
LYS OXT  O  N N 201 
LYS H    H  N N 202 
LYS H2   H  N N 203 
LYS HA   H  N N 204 
LYS HB2  H  N N 205 
LYS HB3  H  N N 206 
LYS HG2  H  N N 207 
LYS HG3  H  N N 208 
LYS HD2  H  N N 209 
LYS HD3  H  N N 210 
LYS HE2  H  N N 211 
LYS HE3  H  N N 212 
LYS HZ1  H  N N 213 
LYS HZ2  H  N N 214 
LYS HZ3  H  N N 215 
LYS HXT  H  N N 216 
MET N    N  N N 217 
MET CA   C  N S 218 
MET C    C  N N 219 
MET O    O  N N 220 
MET CB   C  N N 221 
MET CG   C  N N 222 
MET SD   S  N N 223 
MET CE   C  N N 224 
MET OXT  O  N N 225 
MET H    H  N N 226 
MET H2   H  N N 227 
MET HA   H  N N 228 
MET HB2  H  N N 229 
MET HB3  H  N N 230 
MET HG2  H  N N 231 
MET HG3  H  N N 232 
MET HE1  H  N N 233 
MET HE2  H  N N 234 
MET HE3  H  N N 235 
MET HXT  H  N N 236 
PHE N    N  N N 237 
PHE CA   C  N S 238 
PHE C    C  N N 239 
PHE O    O  N N 240 
PHE CB   C  N N 241 
PHE CG   C  Y N 242 
PHE CD1  C  Y N 243 
PHE CD2  C  Y N 244 
PHE CE1  C  Y N 245 
PHE CE2  C  Y N 246 
PHE CZ   C  Y N 247 
PHE OXT  O  N N 248 
PHE H    H  N N 249 
PHE H2   H  N N 250 
PHE HA   H  N N 251 
PHE HB2  H  N N 252 
PHE HB3  H  N N 253 
PHE HD1  H  N N 254 
PHE HD2  H  N N 255 
PHE HE1  H  N N 256 
PHE HE2  H  N N 257 
PHE HZ   H  N N 258 
PHE HXT  H  N N 259 
PRO N    N  N N 260 
PRO CA   C  N S 261 
PRO C    C  N N 262 
PRO O    O  N N 263 
PRO CB   C  N N 264 
PRO CG   C  N N 265 
PRO CD   C  N N 266 
PRO OXT  O  N N 267 
PRO H    H  N N 268 
PRO HA   H  N N 269 
PRO HB2  H  N N 270 
PRO HB3  H  N N 271 
PRO HG2  H  N N 272 
PRO HG3  H  N N 273 
PRO HD2  H  N N 274 
PRO HD3  H  N N 275 
PRO HXT  H  N N 276 
SER N    N  N N 277 
SER CA   C  N S 278 
SER C    C  N N 279 
SER O    O  N N 280 
SER CB   C  N N 281 
SER OG   O  N N 282 
SER OXT  O  N N 283 
SER H    H  N N 284 
SER H2   H  N N 285 
SER HA   H  N N 286 
SER HB2  H  N N 287 
SER HB3  H  N N 288 
SER HG   H  N N 289 
SER HXT  H  N N 290 
THR N    N  N N 291 
THR CA   C  N S 292 
THR C    C  N N 293 
THR O    O  N N 294 
THR CB   C  N R 295 
THR OG1  O  N N 296 
THR CG2  C  N N 297 
THR OXT  O  N N 298 
THR H    H  N N 299 
THR H2   H  N N 300 
THR HA   H  N N 301 
THR HB   H  N N 302 
THR HG1  H  N N 303 
THR HG21 H  N N 304 
THR HG22 H  N N 305 
THR HG23 H  N N 306 
THR HXT  H  N N 307 
TYR N    N  N N 308 
TYR CA   C  N S 309 
TYR C    C  N N 310 
TYR O    O  N N 311 
TYR CB   C  N N 312 
TYR CG   C  Y N 313 
TYR CD1  C  Y N 314 
TYR CD2  C  Y N 315 
TYR CE1  C  Y N 316 
TYR CE2  C  Y N 317 
TYR CZ   C  Y N 318 
TYR OH   O  N N 319 
TYR OXT  O  N N 320 
TYR H    H  N N 321 
TYR H2   H  N N 322 
TYR HA   H  N N 323 
TYR HB2  H  N N 324 
TYR HB3  H  N N 325 
TYR HD1  H  N N 326 
TYR HD2  H  N N 327 
TYR HE1  H  N N 328 
TYR HE2  H  N N 329 
TYR HH   H  N N 330 
TYR HXT  H  N N 331 
VAL N    N  N N 332 
VAL CA   C  N S 333 
VAL C    C  N N 334 
VAL O    O  N N 335 
VAL CB   C  N N 336 
VAL CG1  C  N N 337 
VAL CG2  C  N N 338 
VAL OXT  O  N N 339 
VAL H    H  N N 340 
VAL H2   H  N N 341 
VAL HA   H  N N 342 
VAL HB   H  N N 343 
VAL HG11 H  N N 344 
VAL HG12 H  N N 345 
VAL HG13 H  N N 346 
VAL HG21 H  N N 347 
VAL HG22 H  N N 348 
VAL HG23 H  N N 349 
VAL HXT  H  N N 350 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
HOH O   H1   sing N N 137 
HOH O   H2   sing N N 138 
ILE N   CA   sing N N 139 
ILE N   H    sing N N 140 
ILE N   H2   sing N N 141 
ILE CA  C    sing N N 142 
ILE CA  CB   sing N N 143 
ILE CA  HA   sing N N 144 
ILE C   O    doub N N 145 
ILE C   OXT  sing N N 146 
ILE CB  CG1  sing N N 147 
ILE CB  CG2  sing N N 148 
ILE CB  HB   sing N N 149 
ILE CG1 CD1  sing N N 150 
ILE CG1 HG12 sing N N 151 
ILE CG1 HG13 sing N N 152 
ILE CG2 HG21 sing N N 153 
ILE CG2 HG22 sing N N 154 
ILE CG2 HG23 sing N N 155 
ILE CD1 HD11 sing N N 156 
ILE CD1 HD12 sing N N 157 
ILE CD1 HD13 sing N N 158 
ILE OXT HXT  sing N N 159 
LEU N   CA   sing N N 160 
LEU N   H    sing N N 161 
LEU N   H2   sing N N 162 
LEU CA  C    sing N N 163 
LEU CA  CB   sing N N 164 
LEU CA  HA   sing N N 165 
LEU C   O    doub N N 166 
LEU C   OXT  sing N N 167 
LEU CB  CG   sing N N 168 
LEU CB  HB2  sing N N 169 
LEU CB  HB3  sing N N 170 
LEU CG  CD1  sing N N 171 
LEU CG  CD2  sing N N 172 
LEU CG  HG   sing N N 173 
LEU CD1 HD11 sing N N 174 
LEU CD1 HD12 sing N N 175 
LEU CD1 HD13 sing N N 176 
LEU CD2 HD21 sing N N 177 
LEU CD2 HD22 sing N N 178 
LEU CD2 HD23 sing N N 179 
LEU OXT HXT  sing N N 180 
LYS N   CA   sing N N 181 
LYS N   H    sing N N 182 
LYS N   H2   sing N N 183 
LYS CA  C    sing N N 184 
LYS CA  CB   sing N N 185 
LYS CA  HA   sing N N 186 
LYS C   O    doub N N 187 
LYS C   OXT  sing N N 188 
LYS CB  CG   sing N N 189 
LYS CB  HB2  sing N N 190 
LYS CB  HB3  sing N N 191 
LYS CG  CD   sing N N 192 
LYS CG  HG2  sing N N 193 
LYS CG  HG3  sing N N 194 
LYS CD  CE   sing N N 195 
LYS CD  HD2  sing N N 196 
LYS CD  HD3  sing N N 197 
LYS CE  NZ   sing N N 198 
LYS CE  HE2  sing N N 199 
LYS CE  HE3  sing N N 200 
LYS NZ  HZ1  sing N N 201 
LYS NZ  HZ2  sing N N 202 
LYS NZ  HZ3  sing N N 203 
LYS OXT HXT  sing N N 204 
MET N   CA   sing N N 205 
MET N   H    sing N N 206 
MET N   H2   sing N N 207 
MET CA  C    sing N N 208 
MET CA  CB   sing N N 209 
MET CA  HA   sing N N 210 
MET C   O    doub N N 211 
MET C   OXT  sing N N 212 
MET CB  CG   sing N N 213 
MET CB  HB2  sing N N 214 
MET CB  HB3  sing N N 215 
MET CG  SD   sing N N 216 
MET CG  HG2  sing N N 217 
MET CG  HG3  sing N N 218 
MET SD  CE   sing N N 219 
MET CE  HE1  sing N N 220 
MET CE  HE2  sing N N 221 
MET CE  HE3  sing N N 222 
MET OXT HXT  sing N N 223 
PHE N   CA   sing N N 224 
PHE N   H    sing N N 225 
PHE N   H2   sing N N 226 
PHE CA  C    sing N N 227 
PHE CA  CB   sing N N 228 
PHE CA  HA   sing N N 229 
PHE C   O    doub N N 230 
PHE C   OXT  sing N N 231 
PHE CB  CG   sing N N 232 
PHE CB  HB2  sing N N 233 
PHE CB  HB3  sing N N 234 
PHE CG  CD1  doub Y N 235 
PHE CG  CD2  sing Y N 236 
PHE CD1 CE1  sing Y N 237 
PHE CD1 HD1  sing N N 238 
PHE CD2 CE2  doub Y N 239 
PHE CD2 HD2  sing N N 240 
PHE CE1 CZ   doub Y N 241 
PHE CE1 HE1  sing N N 242 
PHE CE2 CZ   sing Y N 243 
PHE CE2 HE2  sing N N 244 
PHE CZ  HZ   sing N N 245 
PHE OXT HXT  sing N N 246 
PRO N   CA   sing N N 247 
PRO N   CD   sing N N 248 
PRO N   H    sing N N 249 
PRO CA  C    sing N N 250 
PRO CA  CB   sing N N 251 
PRO CA  HA   sing N N 252 
PRO C   O    doub N N 253 
PRO C   OXT  sing N N 254 
PRO CB  CG   sing N N 255 
PRO CB  HB2  sing N N 256 
PRO CB  HB3  sing N N 257 
PRO CG  CD   sing N N 258 
PRO CG  HG2  sing N N 259 
PRO CG  HG3  sing N N 260 
PRO CD  HD2  sing N N 261 
PRO CD  HD3  sing N N 262 
PRO OXT HXT  sing N N 263 
SER N   CA   sing N N 264 
SER N   H    sing N N 265 
SER N   H2   sing N N 266 
SER CA  C    sing N N 267 
SER CA  CB   sing N N 268 
SER CA  HA   sing N N 269 
SER C   O    doub N N 270 
SER C   OXT  sing N N 271 
SER CB  OG   sing N N 272 
SER CB  HB2  sing N N 273 
SER CB  HB3  sing N N 274 
SER OG  HG   sing N N 275 
SER OXT HXT  sing N N 276 
THR N   CA   sing N N 277 
THR N   H    sing N N 278 
THR N   H2   sing N N 279 
THR CA  C    sing N N 280 
THR CA  CB   sing N N 281 
THR CA  HA   sing N N 282 
THR C   O    doub N N 283 
THR C   OXT  sing N N 284 
THR CB  OG1  sing N N 285 
THR CB  CG2  sing N N 286 
THR CB  HB   sing N N 287 
THR OG1 HG1  sing N N 288 
THR CG2 HG21 sing N N 289 
THR CG2 HG22 sing N N 290 
THR CG2 HG23 sing N N 291 
THR OXT HXT  sing N N 292 
TYR N   CA   sing N N 293 
TYR N   H    sing N N 294 
TYR N   H2   sing N N 295 
TYR CA  C    sing N N 296 
TYR CA  CB   sing N N 297 
TYR CA  HA   sing N N 298 
TYR C   O    doub N N 299 
TYR C   OXT  sing N N 300 
TYR CB  CG   sing N N 301 
TYR CB  HB2  sing N N 302 
TYR CB  HB3  sing N N 303 
TYR CG  CD1  doub Y N 304 
TYR CG  CD2  sing Y N 305 
TYR CD1 CE1  sing Y N 306 
TYR CD1 HD1  sing N N 307 
TYR CD2 CE2  doub Y N 308 
TYR CD2 HD2  sing N N 309 
TYR CE1 CZ   doub Y N 310 
TYR CE1 HE1  sing N N 311 
TYR CE2 CZ   sing Y N 312 
TYR CE2 HE2  sing N N 313 
TYR CZ  OH   sing N N 314 
TYR OH  HH   sing N N 315 
TYR OXT HXT  sing N N 316 
VAL N   CA   sing N N 317 
VAL N   H    sing N N 318 
VAL N   H2   sing N N 319 
VAL CA  C    sing N N 320 
VAL CA  CB   sing N N 321 
VAL CA  HA   sing N N 322 
VAL C   O    doub N N 323 
VAL C   OXT  sing N N 324 
VAL CB  CG1  sing N N 325 
VAL CB  CG2  sing N N 326 
VAL CB  HB   sing N N 327 
VAL CG1 HG11 sing N N 328 
VAL CG1 HG12 sing N N 329 
VAL CG1 HG13 sing N N 330 
VAL CG2 HG21 sing N N 331 
VAL CG2 HG22 sing N N 332 
VAL CG2 HG23 sing N N 333 
VAL OXT HXT  sing N N 334 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   4CLN 
_pdbx_initial_refinement_model.details          'PDB ENTRY 4CLN' 
# 
_atom_sites.entry_id                    1AHR 
_atom_sites.fract_transf_matrix[1][1]   0.036914 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018015 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009912 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_