data_1ALG # _entry.id 1ALG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ALG pdb_00001alg 10.2210/pdb1alg/pdb WWPDB D_1000170963 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-10-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ALG _pdbx_database_status.recvd_initial_deposition_date 1997-06-03 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schott, M.K.' 1 'Nordhoff, A.' 2 'Becker, K.' 3 'Kalbitzer, H.R.' 4 'Schirmer, R.H.' 5 # _citation.id primary _citation.title 'Denaturation and reactivation of dimeric human glutathione reductase--an assay for folding inhibitors.' _citation.journal_abbrev Eur.J.Biochem. _citation.journal_volume 245 _citation.page_first 273 _citation.page_last 282 _citation.year 1997 _citation.journal_id_ASTM EJBCAI _citation.country IX _citation.journal_id_ISSN 0014-2956 _citation.journal_id_CSD 0262 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9151953 _citation.pdbx_database_id_DOI 10.1111/j.1432-1033.1997.00273.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nordhoff, A.' 1 ? primary 'Tziatzios, C.' 2 ? primary 'van den Broek, J.A.' 3 ? primary 'Schott, M.K.' 4 ? primary 'Kalbitzer, H.R.' 5 ? primary 'Becker, K.' 6 ? primary 'Schubert, D.' 7 ? primary 'Schirmer, R.H.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description P11 _entity.formula_weight 2442.829 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 1.6.4.2 _entity.pdbx_mutation ? _entity.pdbx_fragment 'INTERSUBUNIT-CONTACT HELIX' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code QGLGCDEMLQGFAVAVKMGATKAD _entity_poly.pdbx_seq_one_letter_code_can QGLGCDEMLQGFAVAVKMGATKAD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 GLY n 1 3 LEU n 1 4 GLY n 1 5 CYS n 1 6 ASP n 1 7 GLU n 1 8 MET n 1 9 LEU n 1 10 GLN n 1 11 GLY n 1 12 PHE n 1 13 ALA n 1 14 VAL n 1 15 ALA n 1 16 VAL n 1 17 LYS n 1 18 MET n 1 19 GLY n 1 20 ALA n 1 21 THR n 1 22 LYS n 1 23 ALA n 1 24 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ASP 24 24 24 ASP ASP A . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # _cell.entry_id 1ALG _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ALG _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1ALG _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1ALG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1ALG _struct.title 'SOLUTION STRUCTURE OF AN HGR INHIBITOR, NMR, 10 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ALG _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'HUMAN GLUTATHIONE REDUCTASE, PROTEIN-DIMERIZATION INHIBITOR, OXIDOREDUCTASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GSHR_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00390 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;ACRQEPQPQGPPPAAGAVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMH DHADYGFPSCEGKFNWRVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMP STPHESQIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELEN AGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQTDDKGHIIVDEFQN TNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPPIGTVGLTEDEAIHKYGIENVKTYS TSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ALG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 24 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00390 _struct_ref_seq.db_align_beg 436 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 459 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 24 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id CYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 5 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id MET _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 18 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id CYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 5 _struct_conf.end_auth_comp_id MET _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 18 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 3 ? ? -150.89 56.31 2 1 ALA A 20 ? ? -140.68 -61.65 3 1 THR A 21 ? ? -145.64 -158.95 4 2 ALA A 23 ? ? -77.27 -77.99 5 3 ALA A 23 ? ? -170.25 -93.59 6 4 LYS A 22 ? ? -143.37 -54.40 7 5 ALA A 20 ? ? -166.64 -159.87 8 5 THR A 21 ? ? -108.21 -73.56 9 6 LEU A 3 ? ? -57.96 107.01 10 6 THR A 21 ? ? -124.00 -56.02 11 6 LYS A 22 ? ? -178.97 -50.04 12 7 CYS A 5 ? ? -85.73 -73.91 13 7 ALA A 20 ? ? 178.62 127.81 14 8 THR A 21 ? ? -103.64 -63.17 15 8 LYS A 22 ? ? -145.67 31.59 16 8 ALA A 23 ? ? -160.39 87.68 17 10 ALA A 23 ? ? -179.85 -81.90 # _pdbx_nmr_ensemble.entry_id 1ALG _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'NO VIOLATION, SMALL ENERGY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 283 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 3.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 TOCSY 1 2 1 NOESY 1 3 1 COSY 1 # _pdbx_nmr_refine.entry_id 1ALG _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;SIMULATED-ANNEALING PROTOCOL STARTING WITH 50 RANDOM STRUCTURES. 236 DISTANCE CONSTRAINTS. ENERGY MINIMIZED (2000 CYCLES), SUBJECTED TO ROOM-TEMPERATURE-RESTRAINED MOLECULAR DYNAMICS (20PS) AND ENERGY MINIMIZED AGAIN (2000 CYCLES). AFTER THIS, NO DISTANCE OR DIHEDRAL-ANGLE CONSTRAINTS WERE VIOLATED. FINAL REFINEMENT: ENERGY MINIMIZATION ON THE BASIS OF THE COMPLETE EMPIRICAL-ENERGY FUNCTION (DEFAULT PARAMETERS BUT DIELECTRIC CONSTANT E OF 3) INCLUDING THE ELECTROSTATIC INTERACTIONS. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' XwinNMR ? ? 2 'structure solution' AURELIA ? ? 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 CYS N N N N 30 CYS CA C N R 31 CYS C C N N 32 CYS O O N N 33 CYS CB C N N 34 CYS SG S N N 35 CYS OXT O N N 36 CYS H H N N 37 CYS H2 H N N 38 CYS HA H N N 39 CYS HB2 H N N 40 CYS HB3 H N N 41 CYS HG H N N 42 CYS HXT H N N 43 GLN N N N N 44 GLN CA C N S 45 GLN C C N N 46 GLN O O N N 47 GLN CB C N N 48 GLN CG C N N 49 GLN CD C N N 50 GLN OE1 O N N 51 GLN NE2 N N N 52 GLN OXT O N N 53 GLN H H N N 54 GLN H2 H N N 55 GLN HA H N N 56 GLN HB2 H N N 57 GLN HB3 H N N 58 GLN HG2 H N N 59 GLN HG3 H N N 60 GLN HE21 H N N 61 GLN HE22 H N N 62 GLN HXT H N N 63 GLU N N N N 64 GLU CA C N S 65 GLU C C N N 66 GLU O O N N 67 GLU CB C N N 68 GLU CG C N N 69 GLU CD C N N 70 GLU OE1 O N N 71 GLU OE2 O N N 72 GLU OXT O N N 73 GLU H H N N 74 GLU H2 H N N 75 GLU HA H N N 76 GLU HB2 H N N 77 GLU HB3 H N N 78 GLU HG2 H N N 79 GLU HG3 H N N 80 GLU HE2 H N N 81 GLU HXT H N N 82 GLY N N N N 83 GLY CA C N N 84 GLY C C N N 85 GLY O O N N 86 GLY OXT O N N 87 GLY H H N N 88 GLY H2 H N N 89 GLY HA2 H N N 90 GLY HA3 H N N 91 GLY HXT H N N 92 LEU N N N N 93 LEU CA C N S 94 LEU C C N N 95 LEU O O N N 96 LEU CB C N N 97 LEU CG C N N 98 LEU CD1 C N N 99 LEU CD2 C N N 100 LEU OXT O N N 101 LEU H H N N 102 LEU H2 H N N 103 LEU HA H N N 104 LEU HB2 H N N 105 LEU HB3 H N N 106 LEU HG H N N 107 LEU HD11 H N N 108 LEU HD12 H N N 109 LEU HD13 H N N 110 LEU HD21 H N N 111 LEU HD22 H N N 112 LEU HD23 H N N 113 LEU HXT H N N 114 LYS N N N N 115 LYS CA C N S 116 LYS C C N N 117 LYS O O N N 118 LYS CB C N N 119 LYS CG C N N 120 LYS CD C N N 121 LYS CE C N N 122 LYS NZ N N N 123 LYS OXT O N N 124 LYS H H N N 125 LYS H2 H N N 126 LYS HA H N N 127 LYS HB2 H N N 128 LYS HB3 H N N 129 LYS HG2 H N N 130 LYS HG3 H N N 131 LYS HD2 H N N 132 LYS HD3 H N N 133 LYS HE2 H N N 134 LYS HE3 H N N 135 LYS HZ1 H N N 136 LYS HZ2 H N N 137 LYS HZ3 H N N 138 LYS HXT H N N 139 MET N N N N 140 MET CA C N S 141 MET C C N N 142 MET O O N N 143 MET CB C N N 144 MET CG C N N 145 MET SD S N N 146 MET CE C N N 147 MET OXT O N N 148 MET H H N N 149 MET H2 H N N 150 MET HA H N N 151 MET HB2 H N N 152 MET HB3 H N N 153 MET HG2 H N N 154 MET HG3 H N N 155 MET HE1 H N N 156 MET HE2 H N N 157 MET HE3 H N N 158 MET HXT H N N 159 PHE N N N N 160 PHE CA C N S 161 PHE C C N N 162 PHE O O N N 163 PHE CB C N N 164 PHE CG C Y N 165 PHE CD1 C Y N 166 PHE CD2 C Y N 167 PHE CE1 C Y N 168 PHE CE2 C Y N 169 PHE CZ C Y N 170 PHE OXT O N N 171 PHE H H N N 172 PHE H2 H N N 173 PHE HA H N N 174 PHE HB2 H N N 175 PHE HB3 H N N 176 PHE HD1 H N N 177 PHE HD2 H N N 178 PHE HE1 H N N 179 PHE HE2 H N N 180 PHE HZ H N N 181 PHE HXT H N N 182 THR N N N N 183 THR CA C N S 184 THR C C N N 185 THR O O N N 186 THR CB C N R 187 THR OG1 O N N 188 THR CG2 C N N 189 THR OXT O N N 190 THR H H N N 191 THR H2 H N N 192 THR HA H N N 193 THR HB H N N 194 THR HG1 H N N 195 THR HG21 H N N 196 THR HG22 H N N 197 THR HG23 H N N 198 THR HXT H N N 199 VAL N N N N 200 VAL CA C N S 201 VAL C C N N 202 VAL O O N N 203 VAL CB C N N 204 VAL CG1 C N N 205 VAL CG2 C N N 206 VAL OXT O N N 207 VAL H H N N 208 VAL H2 H N N 209 VAL HA H N N 210 VAL HB H N N 211 VAL HG11 H N N 212 VAL HG12 H N N 213 VAL HG13 H N N 214 VAL HG21 H N N 215 VAL HG22 H N N 216 VAL HG23 H N N 217 VAL HXT H N N 218 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 CYS N CA sing N N 28 CYS N H sing N N 29 CYS N H2 sing N N 30 CYS CA C sing N N 31 CYS CA CB sing N N 32 CYS CA HA sing N N 33 CYS C O doub N N 34 CYS C OXT sing N N 35 CYS CB SG sing N N 36 CYS CB HB2 sing N N 37 CYS CB HB3 sing N N 38 CYS SG HG sing N N 39 CYS OXT HXT sing N N 40 GLN N CA sing N N 41 GLN N H sing N N 42 GLN N H2 sing N N 43 GLN CA C sing N N 44 GLN CA CB sing N N 45 GLN CA HA sing N N 46 GLN C O doub N N 47 GLN C OXT sing N N 48 GLN CB CG sing N N 49 GLN CB HB2 sing N N 50 GLN CB HB3 sing N N 51 GLN CG CD sing N N 52 GLN CG HG2 sing N N 53 GLN CG HG3 sing N N 54 GLN CD OE1 doub N N 55 GLN CD NE2 sing N N 56 GLN NE2 HE21 sing N N 57 GLN NE2 HE22 sing N N 58 GLN OXT HXT sing N N 59 GLU N CA sing N N 60 GLU N H sing N N 61 GLU N H2 sing N N 62 GLU CA C sing N N 63 GLU CA CB sing N N 64 GLU CA HA sing N N 65 GLU C O doub N N 66 GLU C OXT sing N N 67 GLU CB CG sing N N 68 GLU CB HB2 sing N N 69 GLU CB HB3 sing N N 70 GLU CG CD sing N N 71 GLU CG HG2 sing N N 72 GLU CG HG3 sing N N 73 GLU CD OE1 doub N N 74 GLU CD OE2 sing N N 75 GLU OE2 HE2 sing N N 76 GLU OXT HXT sing N N 77 GLY N CA sing N N 78 GLY N H sing N N 79 GLY N H2 sing N N 80 GLY CA C sing N N 81 GLY CA HA2 sing N N 82 GLY CA HA3 sing N N 83 GLY C O doub N N 84 GLY C OXT sing N N 85 GLY OXT HXT sing N N 86 LEU N CA sing N N 87 LEU N H sing N N 88 LEU N H2 sing N N 89 LEU CA C sing N N 90 LEU CA CB sing N N 91 LEU CA HA sing N N 92 LEU C O doub N N 93 LEU C OXT sing N N 94 LEU CB CG sing N N 95 LEU CB HB2 sing N N 96 LEU CB HB3 sing N N 97 LEU CG CD1 sing N N 98 LEU CG CD2 sing N N 99 LEU CG HG sing N N 100 LEU CD1 HD11 sing N N 101 LEU CD1 HD12 sing N N 102 LEU CD1 HD13 sing N N 103 LEU CD2 HD21 sing N N 104 LEU CD2 HD22 sing N N 105 LEU CD2 HD23 sing N N 106 LEU OXT HXT sing N N 107 LYS N CA sing N N 108 LYS N H sing N N 109 LYS N H2 sing N N 110 LYS CA C sing N N 111 LYS CA CB sing N N 112 LYS CA HA sing N N 113 LYS C O doub N N 114 LYS C OXT sing N N 115 LYS CB CG sing N N 116 LYS CB HB2 sing N N 117 LYS CB HB3 sing N N 118 LYS CG CD sing N N 119 LYS CG HG2 sing N N 120 LYS CG HG3 sing N N 121 LYS CD CE sing N N 122 LYS CD HD2 sing N N 123 LYS CD HD3 sing N N 124 LYS CE NZ sing N N 125 LYS CE HE2 sing N N 126 LYS CE HE3 sing N N 127 LYS NZ HZ1 sing N N 128 LYS NZ HZ2 sing N N 129 LYS NZ HZ3 sing N N 130 LYS OXT HXT sing N N 131 MET N CA sing N N 132 MET N H sing N N 133 MET N H2 sing N N 134 MET CA C sing N N 135 MET CA CB sing N N 136 MET CA HA sing N N 137 MET C O doub N N 138 MET C OXT sing N N 139 MET CB CG sing N N 140 MET CB HB2 sing N N 141 MET CB HB3 sing N N 142 MET CG SD sing N N 143 MET CG HG2 sing N N 144 MET CG HG3 sing N N 145 MET SD CE sing N N 146 MET CE HE1 sing N N 147 MET CE HE2 sing N N 148 MET CE HE3 sing N N 149 MET OXT HXT sing N N 150 PHE N CA sing N N 151 PHE N H sing N N 152 PHE N H2 sing N N 153 PHE CA C sing N N 154 PHE CA CB sing N N 155 PHE CA HA sing N N 156 PHE C O doub N N 157 PHE C OXT sing N N 158 PHE CB CG sing N N 159 PHE CB HB2 sing N N 160 PHE CB HB3 sing N N 161 PHE CG CD1 doub Y N 162 PHE CG CD2 sing Y N 163 PHE CD1 CE1 sing Y N 164 PHE CD1 HD1 sing N N 165 PHE CD2 CE2 doub Y N 166 PHE CD2 HD2 sing N N 167 PHE CE1 CZ doub Y N 168 PHE CE1 HE1 sing N N 169 PHE CE2 CZ sing Y N 170 PHE CE2 HE2 sing N N 171 PHE CZ HZ sing N N 172 PHE OXT HXT sing N N 173 THR N CA sing N N 174 THR N H sing N N 175 THR N H2 sing N N 176 THR CA C sing N N 177 THR CA CB sing N N 178 THR CA HA sing N N 179 THR C O doub N N 180 THR C OXT sing N N 181 THR CB OG1 sing N N 182 THR CB CG2 sing N N 183 THR CB HB sing N N 184 THR OG1 HG1 sing N N 185 THR CG2 HG21 sing N N 186 THR CG2 HG22 sing N N 187 THR CG2 HG23 sing N N 188 THR OXT HXT sing N N 189 VAL N CA sing N N 190 VAL N H sing N N 191 VAL N H2 sing N N 192 VAL CA C sing N N 193 VAL CA CB sing N N 194 VAL CA HA sing N N 195 VAL C O doub N N 196 VAL C OXT sing N N 197 VAL CB CG1 sing N N 198 VAL CB CG2 sing N N 199 VAL CB HB sing N N 200 VAL CG1 HG11 sing N N 201 VAL CG1 HG12 sing N N 202 VAL CG1 HG13 sing N N 203 VAL CG2 HG21 sing N N 204 VAL CG2 HG22 sing N N 205 VAL CG2 HG23 sing N N 206 VAL OXT HXT sing N N 207 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1ALG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_