data_1AQG # _entry.id 1AQG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AQG pdb_00001aqg 10.2210/pdb1aqg/pdb WWPDB D_1000171130 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-07-29 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Experimental preparation' 7 4 'Structure model' Other 8 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_ensemble 4 4 'Structure model' pdbx_nmr_exptl_sample 5 4 'Structure model' pdbx_nmr_sample_details 6 4 'Structure model' pdbx_nmr_software 7 4 'Structure model' pdbx_nmr_spectrometer 8 4 'Structure model' pdbx_struct_assembly 9 4 'Structure model' pdbx_struct_oper_list 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_ensemble.conformer_selection_criteria' 5 4 'Structure model' '_pdbx_nmr_sample_details.contents' 6 4 'Structure model' '_pdbx_nmr_sample_details.label' 7 4 'Structure model' '_pdbx_nmr_sample_details.solvent_system' 8 4 'Structure model' '_pdbx_nmr_sample_details.type' 9 4 'Structure model' '_pdbx_nmr_software.authors' 10 4 'Structure model' '_pdbx_nmr_software.classification' 11 4 'Structure model' '_pdbx_nmr_software.name' 12 4 'Structure model' '_pdbx_nmr_spectrometer.manufacturer' 13 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AQG _pdbx_database_status.recvd_initial_deposition_date 1997-07-29 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kisselev, O.G.' 1 'Marshall, G.R.' 2 # _citation.id primary _citation.title 'Light-activated rhodopsin induces structural binding motif in G protein alpha subunit.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 95 _citation.page_first 4270 _citation.page_last 4275 _citation.year 1998 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9539726 _citation.pdbx_database_id_DOI 10.1073/pnas.95.8.4270 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kisselev, O.G.' 1 ? primary 'Kao, J.' 2 ? primary 'Ponder, J.W.' 3 ? primary 'Fann, Y.C.' 4 ? primary 'Gautam, N.' 5 ? primary 'Marshall, G.R.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'TRANSDUCIN ALPHA-1 SUBUNIT' _entity.formula_weight 1281.521 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RHODOPSIN BINDING DOMAIN, RESIDUES 340-350' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GT(ALPHA)(340-350)' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code IKENLKDCGLF _entity_poly.pdbx_seq_one_letter_code_can IKENLKDCGLF _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 LYS n 1 3 GLU n 1 4 ASN n 1 5 LEU n 1 6 LYS n 1 7 ASP n 1 8 CYS n 1 9 GLY n 1 10 LEU n 1 11 PHE n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name cattle _entity_src_nat.pdbx_organism_scientific 'Bos taurus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9913 _entity_src_nat.genus Bos _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue RETINA _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location 'ROD OUTER SEGMENT DISKS' _entity_src_nat.pdbx_organ EYE _entity_src_nat.pdbx_organelle 'ROD OUTER SEGMENT' _entity_src_nat.pdbx_cell 'PHOTORECEPTOR ROD CELL' _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 340 340 ILE ILE A . n A 1 2 LYS 2 341 341 LYS LYS A . n A 1 3 GLU 3 342 342 GLU GLU A . n A 1 4 ASN 4 343 343 ASN ASN A . n A 1 5 LEU 5 344 344 LEU LEU A . n A 1 6 LYS 6 345 345 LYS LYS A . n A 1 7 ASP 7 346 346 ASP ASP A . n A 1 8 CYS 8 347 347 CYS CYS A . n A 1 9 GLY 9 348 348 GLY GLY A . n A 1 10 LEU 10 349 349 LEU LEU A . n A 1 11 PHE 11 350 350 PHE PHE A . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal VNMR 'model building' . ? 1 VNMR phasing . ? 2 # _cell.entry_id 1AQG _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AQG _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1AQG _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1AQG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1AQG _struct.title 'NMR STRUCTURE OF THE RHODOPSIN-BOUND C-TERMINAL PEPTIDE OF THE TRANSDUCIN ALPHA-SUBUNIT, 20 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AQG _struct_keywords.pdbx_keywords TRANSDUCER _struct_keywords.text 'TRANSDUCER, TRANSDUCIN, RHODOPSIN, GTP-BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GNAT1_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04695 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;GAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIV RAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTP GYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMHE SLHLFNSICNHRYFATTSIVLFLNKKDVFSEKIKKAHLSICFPDYNGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHMTC ATDTQNVKFVFDAVTDIIIKENLKDCGLF ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AQG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 11 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04695 _struct_ref_seq.db_align_beg 339 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 349 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 340 _struct_ref_seq.pdbx_auth_seq_align_end 350 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id H1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 3 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 7 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 342 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 346 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HZ3 A LYS 345 ? ? OD1 A ASP 346 ? ? 1.54 2 5 HZ3 A LYS 345 ? ? OD1 A ASP 346 ? ? 1.56 3 14 HZ3 A LYS 345 ? ? OD1 A ASP 346 ? ? 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 343 ? ? -57.40 -8.46 2 1 CYS A 347 ? ? -135.91 -62.25 3 1 LEU A 349 ? ? -135.48 -83.80 4 2 CYS A 347 ? ? -103.13 -61.15 5 2 LEU A 349 ? ? -118.55 -81.33 6 3 ASN A 343 ? ? -56.99 -9.42 7 3 CYS A 347 ? ? -138.68 -63.86 8 3 LEU A 349 ? ? -138.94 -82.67 9 4 LEU A 349 ? ? -134.96 -82.62 10 5 LEU A 349 ? ? -101.20 -63.61 11 6 ASN A 343 ? ? -57.87 -8.92 12 6 LEU A 344 ? ? -131.42 -44.49 13 6 LEU A 349 ? ? -140.14 -88.36 14 7 LEU A 344 ? ? -132.25 -44.36 15 7 LEU A 349 ? ? -137.88 -93.42 16 8 CYS A 347 ? ? -107.46 -61.64 17 8 LEU A 349 ? ? -118.94 -74.24 18 9 LEU A 344 ? ? -132.56 -43.46 19 9 LEU A 349 ? ? -138.26 -88.56 20 10 ASN A 343 ? ? -57.92 -9.11 21 10 LEU A 344 ? ? -131.06 -42.74 22 10 CYS A 347 ? ? -122.91 -61.77 23 10 LEU A 349 ? ? -138.67 -85.31 24 11 LEU A 344 ? ? -134.35 -43.35 25 11 LEU A 349 ? ? -139.18 -90.63 26 12 LEU A 349 ? ? -121.14 -77.52 27 13 ASN A 343 ? ? -57.32 -5.50 28 13 CYS A 347 ? ? -137.32 -64.54 29 13 LEU A 349 ? ? -138.13 -84.05 30 14 CYS A 347 ? ? -107.08 -61.40 31 14 LEU A 349 ? ? -118.08 -77.35 32 15 ASN A 343 ? ? -58.10 -7.17 33 15 LEU A 344 ? ? -132.78 -43.48 34 15 LEU A 349 ? ? -139.44 -88.58 35 16 ASN A 343 ? ? -57.52 -8.17 36 16 LEU A 344 ? ? -131.95 -40.17 37 16 CYS A 347 ? ? -120.92 -61.46 38 16 LEU A 349 ? ? -130.37 -82.83 39 17 LEU A 349 ? ? -112.55 -72.19 40 18 LEU A 349 ? ? -111.91 -70.17 41 19 CYS A 347 ? ? -105.20 -61.04 42 19 LEU A 349 ? ? -120.86 -82.57 43 20 LEU A 349 ? ? -120.19 -86.32 # _pdbx_nmr_ensemble.entry_id 1AQG _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20 mM sodium phosphate, 100 mM KCl, 0.1 mM EDTA, 1 mM DTT, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample_1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate' 20 ? mM 'natural abundance' 1 KCl 100 ? mM 'natural abundance' 1 EDTA 0.1 ? mM 'natural abundance' 1 DTT 1 ? mM 'natural abundance' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 274 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? _pdbx_nmr_exptl_sample_conditions.pH_units ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type TRNOESY _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_refine.entry_id 1AQG _pdbx_nmr_refine.method 'DISTANCE GEOMETRY/ CONSTRAINED MOLECULAR DYNAMICS/SIMULATED ANNEALING' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Tinker ? PONDER 1 'structure calculation' Tinker ? PONDER 2 'structure calculation' SYBYL ? Tripos 3 'structure calculation' MOLMOL ? 'Koradi, Billeter and Wuthrich' 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ASN N N N N 1 ASN CA C N S 2 ASN C C N N 3 ASN O O N N 4 ASN CB C N N 5 ASN CG C N N 6 ASN OD1 O N N 7 ASN ND2 N N N 8 ASN OXT O N N 9 ASN H H N N 10 ASN H2 H N N 11 ASN HA H N N 12 ASN HB2 H N N 13 ASN HB3 H N N 14 ASN HD21 H N N 15 ASN HD22 H N N 16 ASN HXT H N N 17 ASP N N N N 18 ASP CA C N S 19 ASP C C N N 20 ASP O O N N 21 ASP CB C N N 22 ASP CG C N N 23 ASP OD1 O N N 24 ASP OD2 O N N 25 ASP OXT O N N 26 ASP H H N N 27 ASP H2 H N N 28 ASP HA H N N 29 ASP HB2 H N N 30 ASP HB3 H N N 31 ASP HD2 H N N 32 ASP HXT H N N 33 CYS N N N N 34 CYS CA C N R 35 CYS C C N N 36 CYS O O N N 37 CYS CB C N N 38 CYS SG S N N 39 CYS OXT O N N 40 CYS H H N N 41 CYS H2 H N N 42 CYS HA H N N 43 CYS HB2 H N N 44 CYS HB3 H N N 45 CYS HG H N N 46 CYS HXT H N N 47 GLU N N N N 48 GLU CA C N S 49 GLU C C N N 50 GLU O O N N 51 GLU CB C N N 52 GLU CG C N N 53 GLU CD C N N 54 GLU OE1 O N N 55 GLU OE2 O N N 56 GLU OXT O N N 57 GLU H H N N 58 GLU H2 H N N 59 GLU HA H N N 60 GLU HB2 H N N 61 GLU HB3 H N N 62 GLU HG2 H N N 63 GLU HG3 H N N 64 GLU HE2 H N N 65 GLU HXT H N N 66 GLY N N N N 67 GLY CA C N N 68 GLY C C N N 69 GLY O O N N 70 GLY OXT O N N 71 GLY H H N N 72 GLY H2 H N N 73 GLY HA2 H N N 74 GLY HA3 H N N 75 GLY HXT H N N 76 ILE N N N N 77 ILE CA C N S 78 ILE C C N N 79 ILE O O N N 80 ILE CB C N S 81 ILE CG1 C N N 82 ILE CG2 C N N 83 ILE CD1 C N N 84 ILE OXT O N N 85 ILE H H N N 86 ILE H2 H N N 87 ILE HA H N N 88 ILE HB H N N 89 ILE HG12 H N N 90 ILE HG13 H N N 91 ILE HG21 H N N 92 ILE HG22 H N N 93 ILE HG23 H N N 94 ILE HD11 H N N 95 ILE HD12 H N N 96 ILE HD13 H N N 97 ILE HXT H N N 98 LEU N N N N 99 LEU CA C N S 100 LEU C C N N 101 LEU O O N N 102 LEU CB C N N 103 LEU CG C N N 104 LEU CD1 C N N 105 LEU CD2 C N N 106 LEU OXT O N N 107 LEU H H N N 108 LEU H2 H N N 109 LEU HA H N N 110 LEU HB2 H N N 111 LEU HB3 H N N 112 LEU HG H N N 113 LEU HD11 H N N 114 LEU HD12 H N N 115 LEU HD13 H N N 116 LEU HD21 H N N 117 LEU HD22 H N N 118 LEU HD23 H N N 119 LEU HXT H N N 120 LYS N N N N 121 LYS CA C N S 122 LYS C C N N 123 LYS O O N N 124 LYS CB C N N 125 LYS CG C N N 126 LYS CD C N N 127 LYS CE C N N 128 LYS NZ N N N 129 LYS OXT O N N 130 LYS H H N N 131 LYS H2 H N N 132 LYS HA H N N 133 LYS HB2 H N N 134 LYS HB3 H N N 135 LYS HG2 H N N 136 LYS HG3 H N N 137 LYS HD2 H N N 138 LYS HD3 H N N 139 LYS HE2 H N N 140 LYS HE3 H N N 141 LYS HZ1 H N N 142 LYS HZ2 H N N 143 LYS HZ3 H N N 144 LYS HXT H N N 145 PHE N N N N 146 PHE CA C N S 147 PHE C C N N 148 PHE O O N N 149 PHE CB C N N 150 PHE CG C Y N 151 PHE CD1 C Y N 152 PHE CD2 C Y N 153 PHE CE1 C Y N 154 PHE CE2 C Y N 155 PHE CZ C Y N 156 PHE OXT O N N 157 PHE H H N N 158 PHE H2 H N N 159 PHE HA H N N 160 PHE HB2 H N N 161 PHE HB3 H N N 162 PHE HD1 H N N 163 PHE HD2 H N N 164 PHE HE1 H N N 165 PHE HE2 H N N 166 PHE HZ H N N 167 PHE HXT H N N 168 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ASN N CA sing N N 1 ASN N H sing N N 2 ASN N H2 sing N N 3 ASN CA C sing N N 4 ASN CA CB sing N N 5 ASN CA HA sing N N 6 ASN C O doub N N 7 ASN C OXT sing N N 8 ASN CB CG sing N N 9 ASN CB HB2 sing N N 10 ASN CB HB3 sing N N 11 ASN CG OD1 doub N N 12 ASN CG ND2 sing N N 13 ASN ND2 HD21 sing N N 14 ASN ND2 HD22 sing N N 15 ASN OXT HXT sing N N 16 ASP N CA sing N N 17 ASP N H sing N N 18 ASP N H2 sing N N 19 ASP CA C sing N N 20 ASP CA CB sing N N 21 ASP CA HA sing N N 22 ASP C O doub N N 23 ASP C OXT sing N N 24 ASP CB CG sing N N 25 ASP CB HB2 sing N N 26 ASP CB HB3 sing N N 27 ASP CG OD1 doub N N 28 ASP CG OD2 sing N N 29 ASP OD2 HD2 sing N N 30 ASP OXT HXT sing N N 31 CYS N CA sing N N 32 CYS N H sing N N 33 CYS N H2 sing N N 34 CYS CA C sing N N 35 CYS CA CB sing N N 36 CYS CA HA sing N N 37 CYS C O doub N N 38 CYS C OXT sing N N 39 CYS CB SG sing N N 40 CYS CB HB2 sing N N 41 CYS CB HB3 sing N N 42 CYS SG HG sing N N 43 CYS OXT HXT sing N N 44 GLU N CA sing N N 45 GLU N H sing N N 46 GLU N H2 sing N N 47 GLU CA C sing N N 48 GLU CA CB sing N N 49 GLU CA HA sing N N 50 GLU C O doub N N 51 GLU C OXT sing N N 52 GLU CB CG sing N N 53 GLU CB HB2 sing N N 54 GLU CB HB3 sing N N 55 GLU CG CD sing N N 56 GLU CG HG2 sing N N 57 GLU CG HG3 sing N N 58 GLU CD OE1 doub N N 59 GLU CD OE2 sing N N 60 GLU OE2 HE2 sing N N 61 GLU OXT HXT sing N N 62 GLY N CA sing N N 63 GLY N H sing N N 64 GLY N H2 sing N N 65 GLY CA C sing N N 66 GLY CA HA2 sing N N 67 GLY CA HA3 sing N N 68 GLY C O doub N N 69 GLY C OXT sing N N 70 GLY OXT HXT sing N N 71 ILE N CA sing N N 72 ILE N H sing N N 73 ILE N H2 sing N N 74 ILE CA C sing N N 75 ILE CA CB sing N N 76 ILE CA HA sing N N 77 ILE C O doub N N 78 ILE C OXT sing N N 79 ILE CB CG1 sing N N 80 ILE CB CG2 sing N N 81 ILE CB HB sing N N 82 ILE CG1 CD1 sing N N 83 ILE CG1 HG12 sing N N 84 ILE CG1 HG13 sing N N 85 ILE CG2 HG21 sing N N 86 ILE CG2 HG22 sing N N 87 ILE CG2 HG23 sing N N 88 ILE CD1 HD11 sing N N 89 ILE CD1 HD12 sing N N 90 ILE CD1 HD13 sing N N 91 ILE OXT HXT sing N N 92 LEU N CA sing N N 93 LEU N H sing N N 94 LEU N H2 sing N N 95 LEU CA C sing N N 96 LEU CA CB sing N N 97 LEU CA HA sing N N 98 LEU C O doub N N 99 LEU C OXT sing N N 100 LEU CB CG sing N N 101 LEU CB HB2 sing N N 102 LEU CB HB3 sing N N 103 LEU CG CD1 sing N N 104 LEU CG CD2 sing N N 105 LEU CG HG sing N N 106 LEU CD1 HD11 sing N N 107 LEU CD1 HD12 sing N N 108 LEU CD1 HD13 sing N N 109 LEU CD2 HD21 sing N N 110 LEU CD2 HD22 sing N N 111 LEU CD2 HD23 sing N N 112 LEU OXT HXT sing N N 113 LYS N CA sing N N 114 LYS N H sing N N 115 LYS N H2 sing N N 116 LYS CA C sing N N 117 LYS CA CB sing N N 118 LYS CA HA sing N N 119 LYS C O doub N N 120 LYS C OXT sing N N 121 LYS CB CG sing N N 122 LYS CB HB2 sing N N 123 LYS CB HB3 sing N N 124 LYS CG CD sing N N 125 LYS CG HG2 sing N N 126 LYS CG HG3 sing N N 127 LYS CD CE sing N N 128 LYS CD HD2 sing N N 129 LYS CD HD3 sing N N 130 LYS CE NZ sing N N 131 LYS CE HE2 sing N N 132 LYS CE HE3 sing N N 133 LYS NZ HZ1 sing N N 134 LYS NZ HZ2 sing N N 135 LYS NZ HZ3 sing N N 136 LYS OXT HXT sing N N 137 PHE N CA sing N N 138 PHE N H sing N N 139 PHE N H2 sing N N 140 PHE CA C sing N N 141 PHE CA CB sing N N 142 PHE CA HA sing N N 143 PHE C O doub N N 144 PHE C OXT sing N N 145 PHE CB CG sing N N 146 PHE CB HB2 sing N N 147 PHE CB HB3 sing N N 148 PHE CG CD1 doub Y N 149 PHE CG CD2 sing Y N 150 PHE CD1 CE1 sing Y N 151 PHE CD1 HD1 sing N N 152 PHE CD2 CE2 doub Y N 153 PHE CD2 HD2 sing N N 154 PHE CE1 CZ doub Y N 155 PHE CE1 HE1 sing N N 156 PHE CE2 CZ sing Y N 157 PHE CE2 HE2 sing N N 158 PHE CZ HZ sing N N 159 PHE OXT HXT sing N N 160 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITY _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 1AQG _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_