data_1AYJ # _entry.id 1AYJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1AYJ pdb_00001ayj 10.2210/pdb1ayj/pdb WWPDB D_1000171412 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-01-28 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 2 0 2019-12-25 6 'Structure model' 2 1 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Polymer sequence' 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Database references' 10 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type 6 5 'Structure model' entity_poly 7 5 'Structure model' pdbx_nmr_software 8 5 'Structure model' pdbx_struct_mod_residue 9 5 'Structure model' struct_conn 10 6 'Structure model' chem_comp_atom 11 6 'Structure model' chem_comp_bond 12 6 'Structure model' database_2 13 6 'Structure model' pdbx_entry_details 14 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 3 5 'Structure model' '_pdbx_nmr_software.name' 4 5 'Structure model' '_pdbx_struct_mod_residue.parent_comp_id' 5 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 6 'Structure model' '_database_2.pdbx_DOI' 7 6 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1AYJ _pdbx_database_status.recvd_initial_deposition_date 1997-11-05 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fant, F.' 1 'Borremans, F.A.M.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Determination of the three-dimensional solution structure of Raphanus sativus antifungal protein 1 by 1H NMR.' J.Mol.Biol. 279 257 270 1998 JMOBAK UK 0022-2836 0070 ? 9636715 10.1006/jmbi.1998.1767 1 ;Solution Conformation of Raphanus Sativus Antifungal Protein 1 (Rs-Afp1) by 1H Nuclear Magnetic Resonance. Resonance Assignments, Secondary Structure and Global Fold ; Bull.Soc.Chim.Belg. 106 51 ? 1997 BSCBAG BE 0037-9646 0054 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fant, F.' 1 ? primary 'Vranken, W.' 2 ? primary 'Broekaert, W.' 3 ? primary 'Borremans, F.' 4 ? 1 'Fant, F.' 5 ? 1 'Vranken, W.F.' 6 ? 1 'Martins, J.C.' 7 ? 1 'Borremans, F.A.M.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'ANTIFUNGAL PROTEIN 1' _entity.formula_weight 5685.550 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name RS-AFP1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(PCA)KLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC' _entity_poly.pdbx_seq_one_letter_code_can QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 LYS n 1 3 LEU n 1 4 CYS n 1 5 GLU n 1 6 ARG n 1 7 PRO n 1 8 SER n 1 9 GLY n 1 10 THR n 1 11 TRP n 1 12 SER n 1 13 GLY n 1 14 VAL n 1 15 CYS n 1 16 GLY n 1 17 ASN n 1 18 ASN n 1 19 ASN n 1 20 ALA n 1 21 CYS n 1 22 LYS n 1 23 ASN n 1 24 GLN n 1 25 CYS n 1 26 ILE n 1 27 ASN n 1 28 LEU n 1 29 GLU n 1 30 LYS n 1 31 ALA n 1 32 ARG n 1 33 HIS n 1 34 GLY n 1 35 SER n 1 36 CYS n 1 37 ASN n 1 38 TYR n 1 39 VAL n 1 40 PHE n 1 41 PRO n 1 42 ALA n 1 43 HIS n 1 44 LYS n 1 45 CYS n 1 46 ILE n 1 47 CYS n 1 48 TYR n 1 49 PHE n 1 50 PRO n 1 51 CYS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Chinese radish' _entity_src_nat.pdbx_organism_scientific 'Raphanus sativus var. niger' _entity_src_nat.pdbx_ncbi_taxonomy_id 41679 _entity_src_nat.genus Raphanus _entity_src_nat.species 'Raphanus sativus' _entity_src_nat.strain 'var. niger' _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ SEED _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 1 PCA PCA A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 CYS 51 51 51 CYS CYS A . n # _software.name AMBER _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # _cell.entry_id 1AYJ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1AYJ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1AYJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1AYJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1AYJ _struct.title ;DETERMINATION OF THE THREE-DIMENSIONAL SOLUTION STRUCTURE OF RAPHANUS SATIVUS ANTIFUNGAL PROTEIN 1 (RS-AFP1) BY 1H NMR, 20 STRUCTURES ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1AYJ _struct_keywords.pdbx_keywords FUNGICIDE _struct_keywords.text 'FUNGICIDE, PLANT DEFENSIN, CYSTEINE-STABILIZED ALFA/BETA MOTIF' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AFP1_SINAL _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P30231 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1AYJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 51 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P30231 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 51 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 51 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 18 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 28 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 18 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 28 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 4 A CYS 51 1_555 ? ? ? ? ? ? ? 2.072 ? ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 15 A CYS 36 1_555 ? ? ? ? ? ? ? 2.068 ? ? disulf3 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 45 SG ? ? A CYS 21 A CYS 45 1_555 ? ? ? ? ? ? ? 2.079 ? ? disulf4 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 25 A CYS 47 1_555 ? ? ? ? ? ? ? 2.068 ? ? covale1 covale both ? A PCA 1 C ? ? ? 1_555 A LYS 2 N ? ? A PCA 1 A LYS 2 1_555 ? ? ? ? ? ? ? 1.336 ? ? hydrog1 hydrog ? ? A GLU 29 N ? ? ? 1_555 A CYS 25 O ? ? A GLU 29 A CYS 25 1_555 ? ? ? ? ? ? ? ? ? ? hydrog2 hydrog ? ? A ILE 26 N ? ? ? 1_555 A LYS 22 O ? ? A ILE 26 A LYS 22 1_555 ? ? ? ? ? ? ? ? ? ? hydrog3 hydrog ? ? A CYS 25 N ? ? ? 1_555 A CYS 21 O ? ? A CYS 25 A CYS 21 1_555 ? ? ? ? ? ? ? ? ? ? hydrog4 hydrog ? ? A LYS 22 N ? ? ? 1_555 A ASN 18 O ? ? A LYS 22 A ASN 18 1_555 ? ? ? ? ? ? ? ? ? ? hydrog5 hydrog ? ? A GLN 24 N ? ? ? 1_555 A ALA 20 O ? ? A GLN 24 A ALA 20 1_555 ? ? ? ? ? ? ? ? ? ? hydrog6 hydrog ? ? A ARG 6 N ? ? ? 1_555 A CYS 47 O ? ? A ARG 6 A CYS 47 1_555 ? ? ? ? ? ? ? ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? hydrog ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 PCA A 1 ? . . . . PCA A 1 ? 1_555 . . . . . . . GLN 1 PCA 'Pyrrolidone carboxylic acid' 'Named protein modification' 2 CYS A 4 ? CYS A 51 ? CYS A 4 ? 1_555 CYS A 51 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 15 ? CYS A 36 ? CYS A 15 ? 1_555 CYS A 36 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 21 ? CYS A 45 ? CYS A 21 ? 1_555 CYS A 45 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 25 ? CYS A 47 ? CYS A 25 ? 1_555 CYS A 47 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 1 -9.98 2 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 2 -10.39 3 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 3 0.80 4 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 4 -8.96 5 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 5 -10.45 6 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 6 -8.23 7 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 7 -5.78 8 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 8 -10.34 9 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 9 -10.59 10 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 10 -10.80 11 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 11 -10.34 12 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 12 -10.71 13 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 13 -10.37 14 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 14 -10.22 15 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 15 -10.65 16 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 16 6.06 17 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 17 -10.70 18 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 18 -10.66 19 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 19 -10.66 20 PHE 40 A . ? PHE 40 A PRO 41 A ? PRO 41 A 20 6.88 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 4 ? PRO A 7 ? CYS A 4 PRO A 7 A 2 LYS A 44 ? PHE A 49 ? LYS A 44 PHE A 49 A 3 HIS A 33 ? ASN A 37 ? HIS A 33 ASN A 37 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O CYS A 4 ? O CYS A 4 N PHE A 49 ? N PHE A 49 A 2 3 O LYS A 44 ? O LYS A 44 N ASN A 37 ? N ASN A 37 # _pdbx_entry_details.entry_id 1AYJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.360 1.252 0.108 0.011 N 2 1 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.357 1.252 0.105 0.011 N 3 1 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.362 1.229 0.133 0.019 N 4 2 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.358 1.252 0.106 0.011 N 5 2 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.360 1.252 0.108 0.011 N 6 2 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.362 1.229 0.133 0.019 N 7 3 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.360 1.252 0.108 0.011 N 8 3 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.359 1.252 0.107 0.011 N 9 3 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.361 1.229 0.132 0.019 N 10 4 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.360 1.252 0.108 0.011 N 11 4 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.360 1.252 0.108 0.011 N 12 4 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.360 1.229 0.131 0.019 N 13 5 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.359 1.252 0.107 0.011 N 14 5 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.358 1.252 0.106 0.011 N 15 5 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.362 1.229 0.133 0.019 N 16 6 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.360 1.252 0.108 0.011 N 17 6 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.357 1.252 0.105 0.011 N 18 6 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.361 1.229 0.132 0.019 N 19 7 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.363 1.252 0.111 0.011 N 20 7 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.367 1.252 0.115 0.011 N 21 7 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.361 1.229 0.132 0.019 N 22 8 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.360 1.252 0.108 0.011 N 23 8 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.358 1.252 0.106 0.011 N 24 8 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.362 1.229 0.133 0.019 N 25 9 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.358 1.252 0.106 0.011 N 26 9 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.361 1.252 0.109 0.011 N 27 9 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.361 1.229 0.132 0.019 N 28 10 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.359 1.252 0.107 0.011 N 29 10 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.360 1.252 0.108 0.011 N 30 10 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.361 1.229 0.132 0.019 N 31 11 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.360 1.252 0.108 0.011 N 32 11 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.360 1.252 0.108 0.011 N 33 11 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.361 1.229 0.132 0.019 N 34 12 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.361 1.252 0.109 0.011 N 35 12 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.361 1.252 0.109 0.011 N 36 12 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.362 1.229 0.133 0.019 N 37 13 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.359 1.252 0.107 0.011 N 38 13 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.357 1.252 0.105 0.011 N 39 13 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.361 1.229 0.132 0.019 N 40 14 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.360 1.252 0.108 0.011 N 41 14 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.363 1.252 0.111 0.011 N 42 14 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.361 1.229 0.132 0.019 N 43 15 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.360 1.252 0.108 0.011 N 44 15 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.359 1.252 0.107 0.011 N 45 15 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.360 1.229 0.131 0.019 N 46 16 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.359 1.252 0.107 0.011 N 47 16 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.361 1.252 0.109 0.011 N 48 16 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.362 1.229 0.133 0.019 N 49 17 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.360 1.252 0.108 0.011 N 50 17 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.359 1.252 0.107 0.011 N 51 17 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.363 1.229 0.134 0.019 N 52 18 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.358 1.252 0.106 0.011 N 53 18 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.358 1.252 0.106 0.011 N 54 18 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.362 1.229 0.133 0.019 N 55 19 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.360 1.252 0.108 0.011 N 56 19 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.359 1.252 0.107 0.011 N 57 19 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.360 1.229 0.131 0.019 N 58 20 CD A GLU 5 ? ? OE2 A GLU 5 ? ? 1.363 1.252 0.111 0.011 N 59 20 CD A GLU 29 ? ? OE2 A GLU 29 ? ? 1.357 1.252 0.105 0.011 N 60 20 C A CYS 51 ? ? OXT A CYS 51 ? ? 1.361 1.229 0.132 0.019 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 10 ? ? -84.10 -72.53 2 1 ASN A 17 ? ? -168.21 107.57 3 1 LEU A 28 ? ? -75.01 -71.61 4 1 ALA A 31 ? ? -43.52 165.30 5 1 ARG A 32 ? ? -86.86 -74.54 6 1 TYR A 38 ? ? -83.22 -123.57 7 1 VAL A 39 ? ? 69.24 154.25 8 2 THR A 10 ? ? -109.71 -68.23 9 2 TRP A 11 ? ? -64.79 73.47 10 2 ASN A 17 ? ? -170.79 136.75 11 2 ALA A 31 ? ? -44.79 156.16 12 2 TYR A 38 ? ? -82.02 -123.56 13 2 VAL A 39 ? ? 68.87 153.07 14 3 THR A 10 ? ? -142.16 -70.38 15 3 TRP A 11 ? ? -68.85 81.43 16 3 ASN A 17 ? ? -170.81 134.25 17 3 ALA A 31 ? ? -38.98 156.63 18 3 ALA A 42 ? ? -172.68 81.56 19 3 HIS A 43 ? ? 87.97 117.24 20 4 LEU A 28 ? ? -69.96 -76.24 21 4 ALA A 31 ? ? -48.53 -164.79 22 4 ARG A 32 ? ? -132.35 -53.72 23 4 ALA A 42 ? ? -163.60 65.68 24 4 HIS A 43 ? ? 92.71 135.43 25 5 ASN A 17 ? ? -171.71 132.56 26 5 LEU A 28 ? ? -71.46 -70.14 27 5 ALA A 31 ? ? -44.66 160.30 28 5 ARG A 32 ? ? -83.50 -78.80 29 6 PRO A 7 ? ? -73.20 -77.75 30 6 THR A 10 ? ? -86.09 -96.31 31 6 TRP A 11 ? ? -68.32 91.91 32 6 SER A 12 ? ? -105.15 63.96 33 6 CYS A 15 ? ? -120.32 -56.11 34 6 ASN A 17 ? ? -165.62 106.83 35 6 ALA A 31 ? ? -47.08 163.77 36 6 ARG A 32 ? ? -88.00 -72.89 37 6 HIS A 43 ? ? 75.97 154.48 38 7 PRO A 7 ? ? -76.95 -160.98 39 7 SER A 8 ? ? -59.54 83.29 40 7 THR A 10 ? ? -156.21 -58.31 41 7 ALA A 31 ? ? -42.28 161.31 42 7 ARG A 32 ? ? -82.75 -76.61 43 7 SER A 35 ? ? -178.31 100.48 44 7 PHE A 40 ? ? -41.41 150.09 45 8 SER A 8 ? ? -24.65 -69.41 46 8 THR A 10 ? ? -83.74 -72.60 47 8 TRP A 11 ? ? -65.63 77.32 48 8 ASN A 17 ? ? -172.35 131.47 49 8 SER A 35 ? ? -171.56 133.23 50 8 ALA A 42 ? ? -161.00 55.93 51 8 HIS A 43 ? ? 99.22 127.13 52 9 PRO A 7 ? ? -70.84 -73.60 53 9 THR A 10 ? ? -137.40 -59.75 54 9 TRP A 11 ? ? -64.89 73.02 55 9 LEU A 28 ? ? -69.71 -73.81 56 9 ALA A 31 ? ? -39.95 155.54 57 9 ARG A 32 ? ? -91.69 -68.23 58 9 SER A 35 ? ? -173.68 142.05 59 10 SER A 8 ? ? -70.46 -83.01 60 10 THR A 10 ? ? -144.70 -62.23 61 10 TRP A 11 ? ? -64.82 79.10 62 10 LEU A 28 ? ? -69.81 -74.74 63 10 ALA A 31 ? ? -44.36 163.75 64 10 ARG A 32 ? ? -84.98 -77.42 65 10 TYR A 38 ? ? -78.73 -124.00 66 10 VAL A 39 ? ? 68.33 151.15 67 11 PRO A 7 ? ? -64.59 -170.38 68 11 ALA A 31 ? ? -41.68 159.48 69 11 SER A 35 ? ? -172.18 134.70 70 12 PRO A 7 ? ? -78.51 -91.73 71 12 THR A 10 ? ? -84.41 -70.59 72 12 TRP A 11 ? ? -66.65 76.52 73 12 ASN A 17 ? ? -173.47 135.58 74 12 ALA A 31 ? ? -39.49 -179.63 75 12 TYR A 38 ? ? -83.21 -109.53 76 12 VAL A 39 ? ? 61.71 150.66 77 13 PRO A 7 ? ? -83.04 -143.46 78 13 SER A 8 ? ? -45.66 -3.24 79 13 THR A 10 ? ? -156.42 -64.26 80 13 ALA A 31 ? ? -42.24 150.59 81 13 SER A 35 ? ? -171.52 98.78 82 13 PHE A 40 ? ? -41.68 150.13 83 14 PRO A 7 ? ? -73.29 -76.62 84 14 THR A 10 ? ? -84.77 -71.31 85 14 TRP A 11 ? ? -67.99 74.07 86 14 CYS A 15 ? ? -132.55 -51.41 87 14 ALA A 31 ? ? -40.30 157.84 88 14 TYR A 38 ? ? -78.23 -111.70 89 14 VAL A 39 ? ? 61.76 150.12 90 15 ALA A 31 ? ? -42.79 154.26 91 15 SER A 35 ? ? -176.52 110.24 92 15 TYR A 38 ? ? -79.43 -123.66 93 15 VAL A 39 ? ? 67.11 154.60 94 16 PRO A 7 ? ? -76.60 -93.78 95 16 THR A 10 ? ? -83.98 -96.31 96 16 ALA A 31 ? ? -38.12 157.45 97 16 ALA A 42 ? ? -167.47 100.29 98 16 HIS A 43 ? ? 70.02 114.28 99 17 SER A 8 ? ? -24.92 -67.44 100 17 ALA A 31 ? ? -43.65 158.14 101 17 ARG A 32 ? ? -91.99 -65.24 102 17 SER A 35 ? ? -174.18 142.67 103 17 TYR A 38 ? ? -84.13 -111.75 104 17 VAL A 39 ? ? 53.86 162.00 105 18 THR A 10 ? ? -84.84 -74.32 106 18 LEU A 28 ? ? -72.79 -72.15 107 18 ALA A 31 ? ? -46.27 159.37 108 18 TYR A 38 ? ? -82.25 -116.18 109 18 VAL A 39 ? ? 61.94 151.64 110 19 THR A 10 ? ? -115.34 -76.79 111 19 TRP A 11 ? ? -64.92 74.04 112 19 ALA A 31 ? ? -43.94 154.76 113 19 SER A 35 ? ? -179.60 114.26 114 19 TYR A 38 ? ? -83.65 -115.17 115 19 VAL A 39 ? ? 54.91 160.72 116 20 THR A 10 ? ? -92.70 -69.91 117 20 ALA A 31 ? ? -40.35 158.80 118 20 SER A 35 ? ? -173.81 146.35 119 20 PHE A 40 ? ? -38.77 138.08 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 38 ? ? 0.165 'SIDE CHAIN' 2 2 ARG A 32 ? ? 0.115 'SIDE CHAIN' 3 2 TYR A 38 ? ? 0.175 'SIDE CHAIN' 4 2 TYR A 48 ? ? 0.073 'SIDE CHAIN' 5 3 ARG A 6 ? ? 0.103 'SIDE CHAIN' 6 3 ARG A 32 ? ? 0.088 'SIDE CHAIN' 7 3 TYR A 38 ? ? 0.105 'SIDE CHAIN' 8 3 PHE A 49 ? ? 0.094 'SIDE CHAIN' 9 4 TYR A 38 ? ? 0.150 'SIDE CHAIN' 10 5 ARG A 32 ? ? 0.084 'SIDE CHAIN' 11 5 TYR A 38 ? ? 0.140 'SIDE CHAIN' 12 6 TYR A 38 ? ? 0.149 'SIDE CHAIN' 13 6 PHE A 49 ? ? 0.097 'SIDE CHAIN' 14 7 TYR A 38 ? ? 0.108 'SIDE CHAIN' 15 7 TYR A 48 ? ? 0.080 'SIDE CHAIN' 16 8 ARG A 6 ? ? 0.203 'SIDE CHAIN' 17 8 ARG A 32 ? ? 0.088 'SIDE CHAIN' 18 8 TYR A 38 ? ? 0.184 'SIDE CHAIN' 19 8 PHE A 49 ? ? 0.134 'SIDE CHAIN' 20 9 TYR A 38 ? ? 0.092 'SIDE CHAIN' 21 9 PHE A 49 ? ? 0.132 'SIDE CHAIN' 22 10 ARG A 32 ? ? 0.083 'SIDE CHAIN' 23 10 TYR A 38 ? ? 0.174 'SIDE CHAIN' 24 10 TYR A 48 ? ? 0.073 'SIDE CHAIN' 25 11 ARG A 32 ? ? 0.082 'SIDE CHAIN' 26 11 TYR A 38 ? ? 0.130 'SIDE CHAIN' 27 11 TYR A 48 ? ? 0.067 'SIDE CHAIN' 28 12 TYR A 38 ? ? 0.150 'SIDE CHAIN' 29 14 ARG A 32 ? ? 0.089 'SIDE CHAIN' 30 14 TYR A 38 ? ? 0.162 'SIDE CHAIN' 31 14 TYR A 48 ? ? 0.073 'SIDE CHAIN' 32 15 ARG A 32 ? ? 0.104 'SIDE CHAIN' 33 15 TYR A 38 ? ? 0.179 'SIDE CHAIN' 34 16 TYR A 38 ? ? 0.087 'SIDE CHAIN' 35 17 ARG A 32 ? ? 0.108 'SIDE CHAIN' 36 17 TYR A 38 ? ? 0.164 'SIDE CHAIN' 37 17 TYR A 48 ? ? 0.077 'SIDE CHAIN' 38 18 ARG A 32 ? ? 0.102 'SIDE CHAIN' 39 18 TYR A 38 ? ? 0.161 'SIDE CHAIN' 40 18 PHE A 49 ? ? 0.092 'SIDE CHAIN' 41 19 ARG A 32 ? ? 0.111 'SIDE CHAIN' 42 19 TYR A 38 ? ? 0.165 'SIDE CHAIN' 43 20 TYR A 38 ? ? 0.088 'SIDE CHAIN' # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PCA _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PCA _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLN _pdbx_struct_mod_residue.details 'PYROGLUTAMIC ACID' # _pdbx_nmr_ensemble.entry_id 1AYJ _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION AND ENERGY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 305 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 DQF-COSY 1 2 1 E.COSY 1 3 1 NOESY 1 4 1 TOCSY 1 # _pdbx_nmr_refine.entry_id 1AYJ _pdbx_nmr_refine.method 'DIANA AND SIMULATED ANNEALING' _pdbx_nmr_refine.details 'SIMULATED ANNEALING PROTOCOL ADOPTED NILGES ET AL. 1988, FEBS LETTERS, VOL. 239, PP129-136. INSIGHT II ALSO WAS USED.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Discover ? 'MSI/BIOSYM TECHNOLOGIES' 1 'structure solution' DIANA/REDAC ? ? 2 'structure solution' INSIGHTII/DISCOVER ? ? 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CYS N N N N 58 CYS CA C N R 59 CYS C C N N 60 CYS O O N N 61 CYS CB C N N 62 CYS SG S N N 63 CYS OXT O N N 64 CYS H H N N 65 CYS H2 H N N 66 CYS HA H N N 67 CYS HB2 H N N 68 CYS HB3 H N N 69 CYS HG H N N 70 CYS HXT H N N 71 GLN N N N N 72 GLN CA C N S 73 GLN C C N N 74 GLN O O N N 75 GLN CB C N N 76 GLN CG C N N 77 GLN CD C N N 78 GLN OE1 O N N 79 GLN NE2 N N N 80 GLN OXT O N N 81 GLN H H N N 82 GLN H2 H N N 83 GLN HA H N N 84 GLN HB2 H N N 85 GLN HB3 H N N 86 GLN HG2 H N N 87 GLN HG3 H N N 88 GLN HE21 H N N 89 GLN HE22 H N N 90 GLN HXT H N N 91 GLU N N N N 92 GLU CA C N S 93 GLU C C N N 94 GLU O O N N 95 GLU CB C N N 96 GLU CG C N N 97 GLU CD C N N 98 GLU OE1 O N N 99 GLU OE2 O N N 100 GLU OXT O N N 101 GLU H H N N 102 GLU H2 H N N 103 GLU HA H N N 104 GLU HB2 H N N 105 GLU HB3 H N N 106 GLU HG2 H N N 107 GLU HG3 H N N 108 GLU HE2 H N N 109 GLU HXT H N N 110 GLY N N N N 111 GLY CA C N N 112 GLY C C N N 113 GLY O O N N 114 GLY OXT O N N 115 GLY H H N N 116 GLY H2 H N N 117 GLY HA2 H N N 118 GLY HA3 H N N 119 GLY HXT H N N 120 HIS N N N N 121 HIS CA C N S 122 HIS C C N N 123 HIS O O N N 124 HIS CB C N N 125 HIS CG C Y N 126 HIS ND1 N Y N 127 HIS CD2 C Y N 128 HIS CE1 C Y N 129 HIS NE2 N Y N 130 HIS OXT O N N 131 HIS H H N N 132 HIS H2 H N N 133 HIS HA H N N 134 HIS HB2 H N N 135 HIS HB3 H N N 136 HIS HD1 H N N 137 HIS HD2 H N N 138 HIS HE1 H N N 139 HIS HE2 H N N 140 HIS HXT H N N 141 ILE N N N N 142 ILE CA C N S 143 ILE C C N N 144 ILE O O N N 145 ILE CB C N S 146 ILE CG1 C N N 147 ILE CG2 C N N 148 ILE CD1 C N N 149 ILE OXT O N N 150 ILE H H N N 151 ILE H2 H N N 152 ILE HA H N N 153 ILE HB H N N 154 ILE HG12 H N N 155 ILE HG13 H N N 156 ILE HG21 H N N 157 ILE HG22 H N N 158 ILE HG23 H N N 159 ILE HD11 H N N 160 ILE HD12 H N N 161 ILE HD13 H N N 162 ILE HXT H N N 163 LEU N N N N 164 LEU CA C N S 165 LEU C C N N 166 LEU O O N N 167 LEU CB C N N 168 LEU CG C N N 169 LEU CD1 C N N 170 LEU CD2 C N N 171 LEU OXT O N N 172 LEU H H N N 173 LEU H2 H N N 174 LEU HA H N N 175 LEU HB2 H N N 176 LEU HB3 H N N 177 LEU HG H N N 178 LEU HD11 H N N 179 LEU HD12 H N N 180 LEU HD13 H N N 181 LEU HD21 H N N 182 LEU HD22 H N N 183 LEU HD23 H N N 184 LEU HXT H N N 185 LYS N N N N 186 LYS CA C N S 187 LYS C C N N 188 LYS O O N N 189 LYS CB C N N 190 LYS CG C N N 191 LYS CD C N N 192 LYS CE C N N 193 LYS NZ N N N 194 LYS OXT O N N 195 LYS H H N N 196 LYS H2 H N N 197 LYS HA H N N 198 LYS HB2 H N N 199 LYS HB3 H N N 200 LYS HG2 H N N 201 LYS HG3 H N N 202 LYS HD2 H N N 203 LYS HD3 H N N 204 LYS HE2 H N N 205 LYS HE3 H N N 206 LYS HZ1 H N N 207 LYS HZ2 H N N 208 LYS HZ3 H N N 209 LYS HXT H N N 210 PCA N N N N 211 PCA CA C N S 212 PCA CB C N N 213 PCA CG C N N 214 PCA CD C N N 215 PCA OE O N N 216 PCA C C N N 217 PCA O O N N 218 PCA OXT O N N 219 PCA H H N N 220 PCA HA H N N 221 PCA HB2 H N N 222 PCA HB3 H N N 223 PCA HG2 H N N 224 PCA HG3 H N N 225 PCA HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TRP N N N N 298 TRP CA C N S 299 TRP C C N N 300 TRP O O N N 301 TRP CB C N N 302 TRP CG C Y N 303 TRP CD1 C Y N 304 TRP CD2 C Y N 305 TRP NE1 N Y N 306 TRP CE2 C Y N 307 TRP CE3 C Y N 308 TRP CZ2 C Y N 309 TRP CZ3 C Y N 310 TRP CH2 C Y N 311 TRP OXT O N N 312 TRP H H N N 313 TRP H2 H N N 314 TRP HA H N N 315 TRP HB2 H N N 316 TRP HB3 H N N 317 TRP HD1 H N N 318 TRP HE1 H N N 319 TRP HE3 H N N 320 TRP HZ2 H N N 321 TRP HZ3 H N N 322 TRP HH2 H N N 323 TRP HXT H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 HIS N CA sing N N 114 HIS N H sing N N 115 HIS N H2 sing N N 116 HIS CA C sing N N 117 HIS CA CB sing N N 118 HIS CA HA sing N N 119 HIS C O doub N N 120 HIS C OXT sing N N 121 HIS CB CG sing N N 122 HIS CB HB2 sing N N 123 HIS CB HB3 sing N N 124 HIS CG ND1 sing Y N 125 HIS CG CD2 doub Y N 126 HIS ND1 CE1 doub Y N 127 HIS ND1 HD1 sing N N 128 HIS CD2 NE2 sing Y N 129 HIS CD2 HD2 sing N N 130 HIS CE1 NE2 sing Y N 131 HIS CE1 HE1 sing N N 132 HIS NE2 HE2 sing N N 133 HIS OXT HXT sing N N 134 ILE N CA sing N N 135 ILE N H sing N N 136 ILE N H2 sing N N 137 ILE CA C sing N N 138 ILE CA CB sing N N 139 ILE CA HA sing N N 140 ILE C O doub N N 141 ILE C OXT sing N N 142 ILE CB CG1 sing N N 143 ILE CB CG2 sing N N 144 ILE CB HB sing N N 145 ILE CG1 CD1 sing N N 146 ILE CG1 HG12 sing N N 147 ILE CG1 HG13 sing N N 148 ILE CG2 HG21 sing N N 149 ILE CG2 HG22 sing N N 150 ILE CG2 HG23 sing N N 151 ILE CD1 HD11 sing N N 152 ILE CD1 HD12 sing N N 153 ILE CD1 HD13 sing N N 154 ILE OXT HXT sing N N 155 LEU N CA sing N N 156 LEU N H sing N N 157 LEU N H2 sing N N 158 LEU CA C sing N N 159 LEU CA CB sing N N 160 LEU CA HA sing N N 161 LEU C O doub N N 162 LEU C OXT sing N N 163 LEU CB CG sing N N 164 LEU CB HB2 sing N N 165 LEU CB HB3 sing N N 166 LEU CG CD1 sing N N 167 LEU CG CD2 sing N N 168 LEU CG HG sing N N 169 LEU CD1 HD11 sing N N 170 LEU CD1 HD12 sing N N 171 LEU CD1 HD13 sing N N 172 LEU CD2 HD21 sing N N 173 LEU CD2 HD22 sing N N 174 LEU CD2 HD23 sing N N 175 LEU OXT HXT sing N N 176 LYS N CA sing N N 177 LYS N H sing N N 178 LYS N H2 sing N N 179 LYS CA C sing N N 180 LYS CA CB sing N N 181 LYS CA HA sing N N 182 LYS C O doub N N 183 LYS C OXT sing N N 184 LYS CB CG sing N N 185 LYS CB HB2 sing N N 186 LYS CB HB3 sing N N 187 LYS CG CD sing N N 188 LYS CG HG2 sing N N 189 LYS CG HG3 sing N N 190 LYS CD CE sing N N 191 LYS CD HD2 sing N N 192 LYS CD HD3 sing N N 193 LYS CE NZ sing N N 194 LYS CE HE2 sing N N 195 LYS CE HE3 sing N N 196 LYS NZ HZ1 sing N N 197 LYS NZ HZ2 sing N N 198 LYS NZ HZ3 sing N N 199 LYS OXT HXT sing N N 200 PCA N CA sing N N 201 PCA N CD sing N N 202 PCA N H sing N N 203 PCA CA CB sing N N 204 PCA CA C sing N N 205 PCA CA HA sing N N 206 PCA CB CG sing N N 207 PCA CB HB2 sing N N 208 PCA CB HB3 sing N N 209 PCA CG CD sing N N 210 PCA CG HG2 sing N N 211 PCA CG HG3 sing N N 212 PCA CD OE doub N N 213 PCA C O doub N N 214 PCA C OXT sing N N 215 PCA OXT HXT sing N N 216 PHE N CA sing N N 217 PHE N H sing N N 218 PHE N H2 sing N N 219 PHE CA C sing N N 220 PHE CA CB sing N N 221 PHE CA HA sing N N 222 PHE C O doub N N 223 PHE C OXT sing N N 224 PHE CB CG sing N N 225 PHE CB HB2 sing N N 226 PHE CB HB3 sing N N 227 PHE CG CD1 doub Y N 228 PHE CG CD2 sing Y N 229 PHE CD1 CE1 sing Y N 230 PHE CD1 HD1 sing N N 231 PHE CD2 CE2 doub Y N 232 PHE CD2 HD2 sing N N 233 PHE CE1 CZ doub Y N 234 PHE CE1 HE1 sing N N 235 PHE CE2 CZ sing Y N 236 PHE CE2 HE2 sing N N 237 PHE CZ HZ sing N N 238 PHE OXT HXT sing N N 239 PRO N CA sing N N 240 PRO N CD sing N N 241 PRO N H sing N N 242 PRO CA C sing N N 243 PRO CA CB sing N N 244 PRO CA HA sing N N 245 PRO C O doub N N 246 PRO C OXT sing N N 247 PRO CB CG sing N N 248 PRO CB HB2 sing N N 249 PRO CB HB3 sing N N 250 PRO CG CD sing N N 251 PRO CG HG2 sing N N 252 PRO CG HG3 sing N N 253 PRO CD HD2 sing N N 254 PRO CD HD3 sing N N 255 PRO OXT HXT sing N N 256 SER N CA sing N N 257 SER N H sing N N 258 SER N H2 sing N N 259 SER CA C sing N N 260 SER CA CB sing N N 261 SER CA HA sing N N 262 SER C O doub N N 263 SER C OXT sing N N 264 SER CB OG sing N N 265 SER CB HB2 sing N N 266 SER CB HB3 sing N N 267 SER OG HG sing N N 268 SER OXT HXT sing N N 269 THR N CA sing N N 270 THR N H sing N N 271 THR N H2 sing N N 272 THR CA C sing N N 273 THR CA CB sing N N 274 THR CA HA sing N N 275 THR C O doub N N 276 THR C OXT sing N N 277 THR CB OG1 sing N N 278 THR CB CG2 sing N N 279 THR CB HB sing N N 280 THR OG1 HG1 sing N N 281 THR CG2 HG21 sing N N 282 THR CG2 HG22 sing N N 283 THR CG2 HG23 sing N N 284 THR OXT HXT sing N N 285 TRP N CA sing N N 286 TRP N H sing N N 287 TRP N H2 sing N N 288 TRP CA C sing N N 289 TRP CA CB sing N N 290 TRP CA HA sing N N 291 TRP C O doub N N 292 TRP C OXT sing N N 293 TRP CB CG sing N N 294 TRP CB HB2 sing N N 295 TRP CB HB3 sing N N 296 TRP CG CD1 doub Y N 297 TRP CG CD2 sing Y N 298 TRP CD1 NE1 sing Y N 299 TRP CD1 HD1 sing N N 300 TRP CD2 CE2 doub Y N 301 TRP CD2 CE3 sing Y N 302 TRP NE1 CE2 sing Y N 303 TRP NE1 HE1 sing N N 304 TRP CE2 CZ2 sing Y N 305 TRP CE3 CZ3 doub Y N 306 TRP CE3 HE3 sing N N 307 TRP CZ2 CH2 doub Y N 308 TRP CZ2 HZ2 sing N N 309 TRP CZ3 CH2 sing Y N 310 TRP CZ3 HZ3 sing N N 311 TRP CH2 HH2 sing N N 312 TRP OXT HXT sing N N 313 TYR N CA sing N N 314 TYR N H sing N N 315 TYR N H2 sing N N 316 TYR CA C sing N N 317 TYR CA CB sing N N 318 TYR CA HA sing N N 319 TYR C O doub N N 320 TYR C OXT sing N N 321 TYR CB CG sing N N 322 TYR CB HB2 sing N N 323 TYR CB HB3 sing N N 324 TYR CG CD1 doub Y N 325 TYR CG CD2 sing Y N 326 TYR CD1 CE1 sing Y N 327 TYR CD1 HD1 sing N N 328 TYR CD2 CE2 doub Y N 329 TYR CD2 HD2 sing N N 330 TYR CE1 CZ doub Y N 331 TYR CE1 HE1 sing N N 332 TYR CE2 CZ sing Y N 333 TYR CE2 HE2 sing N N 334 TYR CZ OH sing N N 335 TYR OH HH sing N N 336 TYR OXT HXT sing N N 337 VAL N CA sing N N 338 VAL N H sing N N 339 VAL N H2 sing N N 340 VAL CA C sing N N 341 VAL CA CB sing N N 342 VAL CA HA sing N N 343 VAL C O doub N N 344 VAL C OXT sing N N 345 VAL CB CG1 sing N N 346 VAL CB CG2 sing N N 347 VAL CB HB sing N N 348 VAL CG1 HG11 sing N N 349 VAL CG1 HG12 sing N N 350 VAL CG1 HG13 sing N N 351 VAL CG2 HG21 sing N N 352 VAL CG2 HG22 sing N N 353 VAL CG2 HG23 sing N N 354 VAL OXT HXT sing N N 355 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AM500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1AYJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_