data_1B4O # _entry.id 1B4O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1B4O pdb_00001b4o 10.2210/pdb1b4o/pdb WWPDB D_1000171477 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-01-05 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 4 'Structure model' 'Structure summary' 8 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_keywords 7 4 'Structure model' struct_ref_seq_dif 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_struct_keywords.text' 6 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1B4O _pdbx_database_status.recvd_initial_deposition_date 1998-12-24 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Consonni, R.' 1 'Santomo, L.' 2 'Zetta, L.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;A single-point mutation in the extreme heat- and pressure-resistant sso7d protein from sulfolobus solfataricus leads to a major rearrangement of the hydrophobic core. ; Biochemistry 38 12709 12717 1999 BICHAW US 0006-2960 0033 ? 10504241 10.1021/bi9911280 1 'Differential Scanning Calorimetry Study of the Thermodynamic Stability of Some Mutants of Sso7D from Sulfolobus Solfataricus' Biochemistry 37 10493 ? 1998 BICHAW US 0006-2960 0033 ? ? ? 2 ;Extreme Heat-and Pressure-Resistant 7-kDa Protein P2 from the Archaeon Sulfolobus Solfataricus is Dramatically Destabilized by a Single-Point Amino Acid Substitution ; Proteins 29 381 ? 1997 PSFGEY US 0887-3585 0867 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Consonni, R.' 1 ? primary 'Santomo, L.' 2 ? primary 'Fusi, P.' 3 ? primary 'Tortora, P.' 4 ? primary 'Zetta, L.' 5 ? 1 'Catanzano, F.' 6 ? 1 'Graziano, G.' 7 ? 1 'Fusi, P.' 8 ? 1 'Tortora, P.' 9 ? 1 'Barone, G.' 10 ? 2 'Fusi, P.' 11 ? 2 'Goossens, K.' 12 ? 2 'Consonni, R.' 13 ? 2 'Grisa, M.' 14 ? 2 'Puricelli, P.' 15 ? 2 'Vecchio, G.' 16 ? 2 'Vanoni, M.' 17 ? 2 'Zetta, L.' 18 ? 2 'Heremans, K.' 19 ? 2 'Tortora, P.' 20 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ENDORIBONUCLEASE P2' _entity.formula_weight 6958.127 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.27.- _entity.pdbx_mutation F31A _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name SSO7D # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ATVKFKYKGEEKQVDISKIKKVWRVGKMISATYDEGGGKTGRGAVSEKDAPKELLQMLEKQK _entity_poly.pdbx_seq_one_letter_code_can ATVKFKYKGEEKQVDISKIKKVWRVGKMISATYDEGGGKTGRGAVSEKDAPKELLQMLEKQK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 VAL n 1 4 LYS n 1 5 PHE n 1 6 LYS n 1 7 TYR n 1 8 LYS n 1 9 GLY n 1 10 GLU n 1 11 GLU n 1 12 LYS n 1 13 GLN n 1 14 VAL n 1 15 ASP n 1 16 ILE n 1 17 SER n 1 18 LYS n 1 19 ILE n 1 20 LYS n 1 21 LYS n 1 22 VAL n 1 23 TRP n 1 24 ARG n 1 25 VAL n 1 26 GLY n 1 27 LYS n 1 28 MET n 1 29 ILE n 1 30 SER n 1 31 ALA n 1 32 THR n 1 33 TYR n 1 34 ASP n 1 35 GLU n 1 36 GLY n 1 37 GLY n 1 38 GLY n 1 39 LYS n 1 40 THR n 1 41 GLY n 1 42 ARG n 1 43 GLY n 1 44 ALA n 1 45 VAL n 1 46 SER n 1 47 GLU n 1 48 LYS n 1 49 ASP n 1 50 ALA n 1 51 PRO n 1 52 LYS n 1 53 GLU n 1 54 LEU n 1 55 LEU n 1 56 GLN n 1 57 MET n 1 58 LEU n 1 59 GLU n 1 60 LYS n 1 61 GLN n 1 62 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Sulfolobus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sulfolobus solfataricus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3) PLYSE' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PT7-7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 LYS 62 62 62 LYS LYS A . n # _cell.entry_id 1B4O _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1B4O _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1B4O _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1B4O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1B4O _struct.title 'NMR STUDY OF SSO7D MUTANT (F31A) MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1B4O _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'RNASE AND DNA-BINDING PROTEIN, THERMOSTABLE RIBONUCLEASE, SULFOLOBUS SOLFATARICUS, DNA-BINDING PROTEIN, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DN71_SULSO _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P61991 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1B4O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P61991 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 62 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 62 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1B4O _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 31 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P61991 _struct_ref_seq_dif.db_mon_id PHE _struct_ref_seq_dif.pdbx_seq_db_seq_num 31 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 31 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id H1 _struct_conf.beg_label_comp_id LYS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 52 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 58 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LYS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 52 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 58 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 58 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 58 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLU _struct_mon_prot_cis.pdbx_label_seq_id_2 59 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLU _struct_mon_prot_cis.pdbx_auth_seq_id_2 59 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -8.94 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 30 ? ALA A 31 ? SER A 30 ALA A 31 A 2 GLY A 43 ? ALA A 44 ? GLY A 43 ALA A 44 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ALA _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 31 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 31 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLY _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 43 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 43 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 10 ? ? OE2 A GLU 10 ? ? 1.370 1.252 0.118 0.011 N 2 1 CD A GLU 11 ? ? OE2 A GLU 11 ? ? 1.372 1.252 0.120 0.011 N 3 1 CD A GLU 35 ? ? OE2 A GLU 35 ? ? 1.373 1.252 0.121 0.011 N 4 1 CD A GLU 47 ? ? OE2 A GLU 47 ? ? 1.372 1.252 0.120 0.011 N 5 1 CD A GLU 53 ? ? OE2 A GLU 53 ? ? 1.371 1.252 0.119 0.011 N 6 1 CD A GLU 59 ? ? OE2 A GLU 59 ? ? 1.370 1.252 0.118 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 24 ? ? CZ A ARG 24 ? ? NH1 A ARG 24 ? ? 124.00 120.30 3.70 0.50 N 2 1 NE A ARG 42 ? ? CZ A ARG 42 ? ? NH1 A ARG 42 ? ? 123.86 120.30 3.56 0.50 N 3 1 CA A LEU 58 ? ? C A LEU 58 ? ? N A GLU 59 ? ? 130.93 117.20 13.73 2.20 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 5 ? ? -101.67 -117.09 2 1 LYS A 6 ? ? 56.00 85.33 3 1 LYS A 8 ? ? -98.07 -64.17 4 1 LYS A 21 ? ? 80.46 107.78 5 1 VAL A 22 ? ? -128.33 -83.79 6 1 ARG A 24 ? ? -143.53 -73.13 7 1 GLU A 47 ? ? -158.21 -47.51 8 1 GLU A 59 ? ? 85.15 84.98 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ARG _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 24 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 VAL _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 25 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -148.84 # _pdbx_nmr_ensemble.entry_id 1B4O _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY TERM' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents H2O # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 DQF-COSY 1 2 1 GE-TOCSY 1 3 1 GE-NOESY 1 # _pdbx_nmr_details.entry_id 1B4O _pdbx_nmr_details.text 'THE MINIMIZED AVERAGE STRUCTURE WAS DETERMINED USING 22 SELECTED CONFORMERS' # _pdbx_nmr_refine.entry_id 1B4O _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Discover 2.9 DAUBER-OSGUTHORPE 1 'structure solution' Discover ? ? 2 'structure solution' Felix ? ? 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 ILE N N N N 106 ILE CA C N S 107 ILE C C N N 108 ILE O O N N 109 ILE CB C N S 110 ILE CG1 C N N 111 ILE CG2 C N N 112 ILE CD1 C N N 113 ILE OXT O N N 114 ILE H H N N 115 ILE H2 H N N 116 ILE HA H N N 117 ILE HB H N N 118 ILE HG12 H N N 119 ILE HG13 H N N 120 ILE HG21 H N N 121 ILE HG22 H N N 122 ILE HG23 H N N 123 ILE HD11 H N N 124 ILE HD12 H N N 125 ILE HD13 H N N 126 ILE HXT H N N 127 LEU N N N N 128 LEU CA C N S 129 LEU C C N N 130 LEU O O N N 131 LEU CB C N N 132 LEU CG C N N 133 LEU CD1 C N N 134 LEU CD2 C N N 135 LEU OXT O N N 136 LEU H H N N 137 LEU H2 H N N 138 LEU HA H N N 139 LEU HB2 H N N 140 LEU HB3 H N N 141 LEU HG H N N 142 LEU HD11 H N N 143 LEU HD12 H N N 144 LEU HD13 H N N 145 LEU HD21 H N N 146 LEU HD22 H N N 147 LEU HD23 H N N 148 LEU HXT H N N 149 LYS N N N N 150 LYS CA C N S 151 LYS C C N N 152 LYS O O N N 153 LYS CB C N N 154 LYS CG C N N 155 LYS CD C N N 156 LYS CE C N N 157 LYS NZ N N N 158 LYS OXT O N N 159 LYS H H N N 160 LYS H2 H N N 161 LYS HA H N N 162 LYS HB2 H N N 163 LYS HB3 H N N 164 LYS HG2 H N N 165 LYS HG3 H N N 166 LYS HD2 H N N 167 LYS HD3 H N N 168 LYS HE2 H N N 169 LYS HE3 H N N 170 LYS HZ1 H N N 171 LYS HZ2 H N N 172 LYS HZ3 H N N 173 LYS HXT H N N 174 MET N N N N 175 MET CA C N S 176 MET C C N N 177 MET O O N N 178 MET CB C N N 179 MET CG C N N 180 MET SD S N N 181 MET CE C N N 182 MET OXT O N N 183 MET H H N N 184 MET H2 H N N 185 MET HA H N N 186 MET HB2 H N N 187 MET HB3 H N N 188 MET HG2 H N N 189 MET HG3 H N N 190 MET HE1 H N N 191 MET HE2 H N N 192 MET HE3 H N N 193 MET HXT H N N 194 PHE N N N N 195 PHE CA C N S 196 PHE C C N N 197 PHE O O N N 198 PHE CB C N N 199 PHE CG C Y N 200 PHE CD1 C Y N 201 PHE CD2 C Y N 202 PHE CE1 C Y N 203 PHE CE2 C Y N 204 PHE CZ C Y N 205 PHE OXT O N N 206 PHE H H N N 207 PHE H2 H N N 208 PHE HA H N N 209 PHE HB2 H N N 210 PHE HB3 H N N 211 PHE HD1 H N N 212 PHE HD2 H N N 213 PHE HE1 H N N 214 PHE HE2 H N N 215 PHE HZ H N N 216 PHE HXT H N N 217 PRO N N N N 218 PRO CA C N S 219 PRO C C N N 220 PRO O O N N 221 PRO CB C N N 222 PRO CG C N N 223 PRO CD C N N 224 PRO OXT O N N 225 PRO H H N N 226 PRO HA H N N 227 PRO HB2 H N N 228 PRO HB3 H N N 229 PRO HG2 H N N 230 PRO HG3 H N N 231 PRO HD2 H N N 232 PRO HD3 H N N 233 PRO HXT H N N 234 SER N N N N 235 SER CA C N S 236 SER C C N N 237 SER O O N N 238 SER CB C N N 239 SER OG O N N 240 SER OXT O N N 241 SER H H N N 242 SER H2 H N N 243 SER HA H N N 244 SER HB2 H N N 245 SER HB3 H N N 246 SER HG H N N 247 SER HXT H N N 248 THR N N N N 249 THR CA C N S 250 THR C C N N 251 THR O O N N 252 THR CB C N R 253 THR OG1 O N N 254 THR CG2 C N N 255 THR OXT O N N 256 THR H H N N 257 THR H2 H N N 258 THR HA H N N 259 THR HB H N N 260 THR HG1 H N N 261 THR HG21 H N N 262 THR HG22 H N N 263 THR HG23 H N N 264 THR HXT H N N 265 TRP N N N N 266 TRP CA C N S 267 TRP C C N N 268 TRP O O N N 269 TRP CB C N N 270 TRP CG C Y N 271 TRP CD1 C Y N 272 TRP CD2 C Y N 273 TRP NE1 N Y N 274 TRP CE2 C Y N 275 TRP CE3 C Y N 276 TRP CZ2 C Y N 277 TRP CZ3 C Y N 278 TRP CH2 C Y N 279 TRP OXT O N N 280 TRP H H N N 281 TRP H2 H N N 282 TRP HA H N N 283 TRP HB2 H N N 284 TRP HB3 H N N 285 TRP HD1 H N N 286 TRP HE1 H N N 287 TRP HE3 H N N 288 TRP HZ2 H N N 289 TRP HZ3 H N N 290 TRP HH2 H N N 291 TRP HXT H N N 292 TYR N N N N 293 TYR CA C N S 294 TYR C C N N 295 TYR O O N N 296 TYR CB C N N 297 TYR CG C Y N 298 TYR CD1 C Y N 299 TYR CD2 C Y N 300 TYR CE1 C Y N 301 TYR CE2 C Y N 302 TYR CZ C Y N 303 TYR OH O N N 304 TYR OXT O N N 305 TYR H H N N 306 TYR H2 H N N 307 TYR HA H N N 308 TYR HB2 H N N 309 TYR HB3 H N N 310 TYR HD1 H N N 311 TYR HD2 H N N 312 TYR HE1 H N N 313 TYR HE2 H N N 314 TYR HH H N N 315 TYR HXT H N N 316 VAL N N N N 317 VAL CA C N S 318 VAL C C N N 319 VAL O O N N 320 VAL CB C N N 321 VAL CG1 C N N 322 VAL CG2 C N N 323 VAL OXT O N N 324 VAL H H N N 325 VAL H2 H N N 326 VAL HA H N N 327 VAL HB H N N 328 VAL HG11 H N N 329 VAL HG12 H N N 330 VAL HG13 H N N 331 VAL HG21 H N N 332 VAL HG22 H N N 333 VAL HG23 H N N 334 VAL HXT H N N 335 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 ILE N CA sing N N 100 ILE N H sing N N 101 ILE N H2 sing N N 102 ILE CA C sing N N 103 ILE CA CB sing N N 104 ILE CA HA sing N N 105 ILE C O doub N N 106 ILE C OXT sing N N 107 ILE CB CG1 sing N N 108 ILE CB CG2 sing N N 109 ILE CB HB sing N N 110 ILE CG1 CD1 sing N N 111 ILE CG1 HG12 sing N N 112 ILE CG1 HG13 sing N N 113 ILE CG2 HG21 sing N N 114 ILE CG2 HG22 sing N N 115 ILE CG2 HG23 sing N N 116 ILE CD1 HD11 sing N N 117 ILE CD1 HD12 sing N N 118 ILE CD1 HD13 sing N N 119 ILE OXT HXT sing N N 120 LEU N CA sing N N 121 LEU N H sing N N 122 LEU N H2 sing N N 123 LEU CA C sing N N 124 LEU CA CB sing N N 125 LEU CA HA sing N N 126 LEU C O doub N N 127 LEU C OXT sing N N 128 LEU CB CG sing N N 129 LEU CB HB2 sing N N 130 LEU CB HB3 sing N N 131 LEU CG CD1 sing N N 132 LEU CG CD2 sing N N 133 LEU CG HG sing N N 134 LEU CD1 HD11 sing N N 135 LEU CD1 HD12 sing N N 136 LEU CD1 HD13 sing N N 137 LEU CD2 HD21 sing N N 138 LEU CD2 HD22 sing N N 139 LEU CD2 HD23 sing N N 140 LEU OXT HXT sing N N 141 LYS N CA sing N N 142 LYS N H sing N N 143 LYS N H2 sing N N 144 LYS CA C sing N N 145 LYS CA CB sing N N 146 LYS CA HA sing N N 147 LYS C O doub N N 148 LYS C OXT sing N N 149 LYS CB CG sing N N 150 LYS CB HB2 sing N N 151 LYS CB HB3 sing N N 152 LYS CG CD sing N N 153 LYS CG HG2 sing N N 154 LYS CG HG3 sing N N 155 LYS CD CE sing N N 156 LYS CD HD2 sing N N 157 LYS CD HD3 sing N N 158 LYS CE NZ sing N N 159 LYS CE HE2 sing N N 160 LYS CE HE3 sing N N 161 LYS NZ HZ1 sing N N 162 LYS NZ HZ2 sing N N 163 LYS NZ HZ3 sing N N 164 LYS OXT HXT sing N N 165 MET N CA sing N N 166 MET N H sing N N 167 MET N H2 sing N N 168 MET CA C sing N N 169 MET CA CB sing N N 170 MET CA HA sing N N 171 MET C O doub N N 172 MET C OXT sing N N 173 MET CB CG sing N N 174 MET CB HB2 sing N N 175 MET CB HB3 sing N N 176 MET CG SD sing N N 177 MET CG HG2 sing N N 178 MET CG HG3 sing N N 179 MET SD CE sing N N 180 MET CE HE1 sing N N 181 MET CE HE2 sing N N 182 MET CE HE3 sing N N 183 MET OXT HXT sing N N 184 PHE N CA sing N N 185 PHE N H sing N N 186 PHE N H2 sing N N 187 PHE CA C sing N N 188 PHE CA CB sing N N 189 PHE CA HA sing N N 190 PHE C O doub N N 191 PHE C OXT sing N N 192 PHE CB CG sing N N 193 PHE CB HB2 sing N N 194 PHE CB HB3 sing N N 195 PHE CG CD1 doub Y N 196 PHE CG CD2 sing Y N 197 PHE CD1 CE1 sing Y N 198 PHE CD1 HD1 sing N N 199 PHE CD2 CE2 doub Y N 200 PHE CD2 HD2 sing N N 201 PHE CE1 CZ doub Y N 202 PHE CE1 HE1 sing N N 203 PHE CE2 CZ sing Y N 204 PHE CE2 HE2 sing N N 205 PHE CZ HZ sing N N 206 PHE OXT HXT sing N N 207 PRO N CA sing N N 208 PRO N CD sing N N 209 PRO N H sing N N 210 PRO CA C sing N N 211 PRO CA CB sing N N 212 PRO CA HA sing N N 213 PRO C O doub N N 214 PRO C OXT sing N N 215 PRO CB CG sing N N 216 PRO CB HB2 sing N N 217 PRO CB HB3 sing N N 218 PRO CG CD sing N N 219 PRO CG HG2 sing N N 220 PRO CG HG3 sing N N 221 PRO CD HD2 sing N N 222 PRO CD HD3 sing N N 223 PRO OXT HXT sing N N 224 SER N CA sing N N 225 SER N H sing N N 226 SER N H2 sing N N 227 SER CA C sing N N 228 SER CA CB sing N N 229 SER CA HA sing N N 230 SER C O doub N N 231 SER C OXT sing N N 232 SER CB OG sing N N 233 SER CB HB2 sing N N 234 SER CB HB3 sing N N 235 SER OG HG sing N N 236 SER OXT HXT sing N N 237 THR N CA sing N N 238 THR N H sing N N 239 THR N H2 sing N N 240 THR CA C sing N N 241 THR CA CB sing N N 242 THR CA HA sing N N 243 THR C O doub N N 244 THR C OXT sing N N 245 THR CB OG1 sing N N 246 THR CB CG2 sing N N 247 THR CB HB sing N N 248 THR OG1 HG1 sing N N 249 THR CG2 HG21 sing N N 250 THR CG2 HG22 sing N N 251 THR CG2 HG23 sing N N 252 THR OXT HXT sing N N 253 TRP N CA sing N N 254 TRP N H sing N N 255 TRP N H2 sing N N 256 TRP CA C sing N N 257 TRP CA CB sing N N 258 TRP CA HA sing N N 259 TRP C O doub N N 260 TRP C OXT sing N N 261 TRP CB CG sing N N 262 TRP CB HB2 sing N N 263 TRP CB HB3 sing N N 264 TRP CG CD1 doub Y N 265 TRP CG CD2 sing Y N 266 TRP CD1 NE1 sing Y N 267 TRP CD1 HD1 sing N N 268 TRP CD2 CE2 doub Y N 269 TRP CD2 CE3 sing Y N 270 TRP NE1 CE2 sing Y N 271 TRP NE1 HE1 sing N N 272 TRP CE2 CZ2 sing Y N 273 TRP CE3 CZ3 doub Y N 274 TRP CE3 HE3 sing N N 275 TRP CZ2 CH2 doub Y N 276 TRP CZ2 HZ2 sing N N 277 TRP CZ3 CH2 sing Y N 278 TRP CZ3 HZ3 sing N N 279 TRP CH2 HH2 sing N N 280 TRP OXT HXT sing N N 281 TYR N CA sing N N 282 TYR N H sing N N 283 TYR N H2 sing N N 284 TYR CA C sing N N 285 TYR CA CB sing N N 286 TYR CA HA sing N N 287 TYR C O doub N N 288 TYR C OXT sing N N 289 TYR CB CG sing N N 290 TYR CB HB2 sing N N 291 TYR CB HB3 sing N N 292 TYR CG CD1 doub Y N 293 TYR CG CD2 sing Y N 294 TYR CD1 CE1 sing Y N 295 TYR CD1 HD1 sing N N 296 TYR CD2 CE2 doub Y N 297 TYR CD2 HD2 sing N N 298 TYR CE1 CZ doub Y N 299 TYR CE1 HE1 sing N N 300 TYR CE2 CZ sing Y N 301 TYR CE2 HE2 sing N N 302 TYR CZ OH sing N N 303 TYR OH HH sing N N 304 TYR OXT HXT sing N N 305 VAL N CA sing N N 306 VAL N H sing N N 307 VAL N H2 sing N N 308 VAL CA C sing N N 309 VAL CA CB sing N N 310 VAL CA HA sing N N 311 VAL C O doub N N 312 VAL C OXT sing N N 313 VAL CB CG1 sing N N 314 VAL CB CG2 sing N N 315 VAL CB HB sing N N 316 VAL CG1 HG11 sing N N 317 VAL CG1 HG12 sing N N 318 VAL CG1 HG13 sing N N 319 VAL CG2 HG21 sing N N 320 VAL CG2 HG22 sing N N 321 VAL CG2 HG23 sing N N 322 VAL OXT HXT sing N N 323 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1B4O _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_