data_1BAH # _entry.id 1BAH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1BAH WWPDB D_1000171526 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BAH _pdbx_database_status.recvd_initial_deposition_date 1996-06-06 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Song, J.' 1 'Gilquin, B.' 2 'Jamin, N.' 3 'Guenneugues, M.' 4 'Dauplais, M.' 5 'Vita, C.' 6 'Menez, A.' 7 # _citation.id primary _citation.title ;NMR solution structure of a two-disulfide derivative of charybdotoxin: structural evidence for conservation of scorpion toxin alpha/beta motif and its hydrophobic side chain packing. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 36 _citation.page_first 3760 _citation.page_last 3766 _citation.year 1997 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9092804 _citation.pdbx_database_id_DOI 10.1021/bi962720h # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Song, J.' 1 ? primary 'Gilquin, B.' 2 ? primary 'Jamin, N.' 3 ? primary 'Drakopoulou, E.' 4 ? primary 'Guenneugues, M.' 5 ? primary 'Dauplais, M.' 6 ? primary 'Vita, C.' 7 ? primary 'Menez, A.' 8 ? # _cell.entry_id 1BAH _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BAH _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description CHARYBDOTOXIN _entity.formula_weight 4273.921 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name CHABII # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(PCA)FTNVSCTTSKE(ABA)WSVCQRLHNTSRGKCMNKK(ABA)RCYS' _entity_poly.pdbx_seq_one_letter_code_can QFTNVSCTTSKEAWSVCQRLHNTSRGKCMNKKARCYS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 PHE n 1 3 THR n 1 4 ASN n 1 5 VAL n 1 6 SER n 1 7 CYS n 1 8 THR n 1 9 THR n 1 10 SER n 1 11 LYS n 1 12 GLU n 1 13 ABA n 1 14 TRP n 1 15 SER n 1 16 VAL n 1 17 CYS n 1 18 GLN n 1 19 ARG n 1 20 LEU n 1 21 HIS n 1 22 ASN n 1 23 THR n 1 24 SER n 1 25 ARG n 1 26 GLY n 1 27 LYS n 1 28 CYS n 1 29 MET n 1 30 ASN n 1 31 LYS n 1 32 LYS n 1 33 ABA n 1 34 ARG n 1 35 CYS n 1 36 TYR n 1 37 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Egyptian scorpion' _entity_src_gen.gene_src_genus Leiurus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Leiurus quinquestriatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6883 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCKA_LEIQH _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P13487 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code QFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BAH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 37 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P13487 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 37 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 37 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1BAH ABA A 13 ? UNP P13487 CYS 13 'modified residue' 13 1 1 1BAH ABA A 33 ? UNP P13487 CYS 33 'modified residue' 33 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ABA 'L-peptide linking' n 'ALPHA-AMINOBUTYRIC ACID' ? 'C4 H9 N O2' 103.120 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 278 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_ensemble.entry_id 1BAH _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version ? _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1BAH _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1BAH _struct.title 'A TWO DISULFIDE DERIVATIVE OF CHARYBDOTOXIN WITH DISULFIDE 13-33 REPLACED BY TWO ALPHA-AMINOBUTYRIC ACIDS, NMR, 30 STRUCTURES' _struct.pdbx_descriptor CHARYBDOTOXIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BAH _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'CHARYBDOTOXIN, NEUROTOXIN, POTASSIUM CHANNEL INHIBITOR, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 10 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 20 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 10 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 20 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 7 A CYS 28 1_555 ? ? ? ? ? ? ? 2.028 ? disulf2 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 17 A CYS 35 1_555 ? ? ? ? ? ? ? 2.039 ? covale1 covale both ? A PCA 1 C ? ? ? 1_555 A PHE 2 N ? ? A PCA 1 A PHE 2 1_555 ? ? ? ? ? ? ? 1.358 ? covale2 covale both ? A ABA 13 N ? ? ? 1_555 A GLU 12 C ? ? A ABA 13 A GLU 12 1_555 ? ? ? ? ? ? ? 1.359 ? covale3 covale both ? A ABA 13 C ? ? ? 1_555 A TRP 14 N ? ? A ABA 13 A TRP 14 1_555 ? ? ? ? ? ? ? 1.364 ? covale4 covale both ? A ABA 33 N ? ? ? 1_555 A LYS 32 C ? ? A ABA 33 A LYS 32 1_555 ? ? ? ? ? ? ? 1.369 ? covale5 covale both ? A ABA 33 C ? ? ? 1_555 A ARG 34 N ? ? A ABA 33 A ARG 34 1_555 ? ? ? ? ? ? ? 1.355 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id S1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 ARG A 25 ? MET A 29 ? ARG A 25 MET A 29 S1 2 LYS A 32 ? TYR A 36 ? LYS A 32 TYR A 36 # _database_PDB_matrix.entry_id 1BAH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BAH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 1 PCA PCA A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ABA 13 13 13 ABA ABA A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ABA 33 33 33 ABA ABA A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 SER 37 37 37 SER SER A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A PCA 1 A PCA 1 ? GLN 'PYROGLUTAMIC ACID' 2 A ABA 13 A ABA 13 ? ALA 'ALPHA-AMINOBUTYRIC ACID' 3 A ABA 33 A ABA 33 ? ALA 'ALPHA-AMINOBUTYRIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-01-11 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2019-12-25 5 'Structure model' 2 1 2020-01-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Polymer sequence' 7 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity_poly 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_mod_residue 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 2 4 'Structure model' '_pdbx_database_status.process_site' 3 4 'Structure model' '_pdbx_struct_mod_residue.parent_comp_id' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 13 CA A CYS 28 ? ? CB A CYS 28 ? ? SG A CYS 28 ? ? 122.90 114.20 8.70 1.10 N 2 20 CA A CYS 28 ? ? CB A CYS 28 ? ? SG A CYS 28 ? ? 123.34 114.20 9.14 1.10 N 3 22 CA A CYS 28 ? ? CB A CYS 28 ? ? SG A CYS 28 ? ? 121.45 114.20 7.25 1.10 N 4 23 CA A CYS 28 ? ? CB A CYS 28 ? ? SG A CYS 28 ? ? 121.67 114.20 7.47 1.10 N 5 27 CA A CYS 28 ? ? CB A CYS 28 ? ? SG A CYS 28 ? ? 121.78 114.20 7.58 1.10 N 6 28 CA A CYS 28 ? ? CB A CYS 28 ? ? SG A CYS 28 ? ? 123.39 114.20 9.19 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 4 ? ? -141.02 53.90 2 1 LYS A 11 ? ? -172.54 -35.32 3 1 HIS A 21 ? ? -106.06 -112.18 4 1 ASN A 22 ? ? -179.88 60.52 5 1 SER A 24 ? ? -144.98 20.07 6 1 MET A 29 ? ? -99.03 -122.10 7 1 LYS A 31 ? ? -144.72 -1.06 8 2 LYS A 11 ? ? -177.36 -44.86 9 2 HIS A 21 ? ? -101.83 -114.09 10 2 ASN A 22 ? ? -177.70 59.38 11 2 SER A 24 ? ? -145.14 36.18 12 2 LYS A 27 ? ? -125.83 -145.61 13 2 MET A 29 ? ? -97.21 -121.92 14 2 LYS A 31 ? ? -144.82 -2.36 15 3 ASN A 4 ? ? -144.82 54.70 16 3 LYS A 11 ? ? -175.61 -36.07 17 3 HIS A 21 ? ? -103.05 -110.60 18 3 ASN A 22 ? ? -178.85 63.92 19 3 MET A 29 ? ? -100.07 -119.68 20 4 ASN A 4 ? ? -150.40 55.43 21 4 VAL A 5 ? ? -102.85 -167.07 22 4 LYS A 11 ? ? -168.21 -34.90 23 4 HIS A 21 ? ? -115.78 -115.16 24 4 ASN A 22 ? ? -173.98 58.32 25 4 LYS A 27 ? ? -135.79 -151.34 26 4 MET A 29 ? ? -98.94 -123.27 27 4 LYS A 31 ? ? -144.97 -1.56 28 5 LYS A 11 ? ? -177.25 -39.25 29 5 HIS A 21 ? ? -116.60 -118.12 30 5 ASN A 22 ? ? -173.86 59.34 31 5 SER A 24 ? ? -132.84 -32.13 32 5 LYS A 27 ? ? -108.72 -147.83 33 5 MET A 29 ? ? -95.18 -124.74 34 5 LYS A 31 ? ? -142.19 -7.28 35 6 ASN A 4 ? ? -148.94 49.29 36 6 THR A 8 ? ? -126.45 -56.11 37 6 LYS A 11 ? ? 179.75 -45.94 38 6 HIS A 21 ? ? -100.31 -113.70 39 6 ASN A 22 ? ? -175.86 56.80 40 6 SER A 24 ? ? -131.62 -33.00 41 6 LYS A 27 ? ? -126.29 -141.60 42 6 MET A 29 ? ? -98.83 -125.85 43 7 ASN A 4 ? ? -145.56 54.24 44 7 VAL A 5 ? ? -103.64 -169.73 45 7 LYS A 11 ? ? -178.70 -39.18 46 7 HIS A 21 ? ? -118.22 -116.19 47 7 ASN A 22 ? ? -172.07 59.17 48 7 LYS A 27 ? ? -127.06 -149.48 49 7 MET A 29 ? ? -99.38 -121.23 50 7 LYS A 31 ? ? -140.93 -6.55 51 8 ASN A 4 ? ? -141.87 45.31 52 8 THR A 8 ? ? -123.34 -54.06 53 8 LYS A 11 ? ? -173.19 -34.61 54 8 HIS A 21 ? ? -122.38 -116.59 55 8 ASN A 22 ? ? -173.09 57.77 56 8 MET A 29 ? ? -96.70 -123.17 57 9 THR A 8 ? ? -132.08 -47.86 58 9 LYS A 11 ? ? -177.64 -33.64 59 9 HIS A 21 ? ? -99.66 -112.32 60 9 ASN A 22 ? ? 178.30 63.73 61 9 LYS A 27 ? ? -109.86 -139.46 62 9 MET A 29 ? ? -99.32 -121.56 63 9 TYR A 36 ? ? -143.87 59.66 64 10 THR A 8 ? ? -130.81 -46.92 65 10 LYS A 11 ? ? -171.18 -46.79 66 10 LEU A 20 ? ? -90.07 -68.20 67 10 HIS A 21 ? ? -104.13 -114.65 68 10 ASN A 22 ? ? -178.13 82.18 69 10 SER A 24 ? ? -144.96 28.78 70 10 MET A 29 ? ? -101.73 -122.13 71 11 ASN A 4 ? ? -148.13 57.25 72 11 THR A 8 ? ? -131.11 -47.89 73 11 LYS A 11 ? ? -171.98 -45.67 74 11 LEU A 20 ? ? -90.01 -64.78 75 11 HIS A 21 ? ? -99.45 -112.94 76 11 ASN A 22 ? ? -176.47 59.04 77 11 SER A 24 ? ? -145.11 19.00 78 11 LYS A 27 ? ? -117.37 -143.25 79 11 MET A 29 ? ? -96.16 -125.48 80 12 ASN A 4 ? ? -141.01 51.39 81 12 THR A 8 ? ? -130.41 -48.39 82 12 LYS A 11 ? ? -171.10 -41.81 83 12 HIS A 21 ? ? -104.73 -113.27 84 12 ASN A 22 ? ? -177.17 65.25 85 12 SER A 24 ? ? -134.63 -33.05 86 12 LYS A 27 ? ? -133.63 -140.35 87 12 MET A 29 ? ? -96.16 -126.18 88 12 LYS A 31 ? ? -142.37 -1.52 89 13 ASN A 4 ? ? -146.86 52.67 90 13 THR A 8 ? ? -131.38 -52.56 91 13 LYS A 11 ? ? -171.57 -36.73 92 13 HIS A 21 ? ? -122.25 -116.67 93 13 ASN A 22 ? ? -173.55 63.21 94 13 SER A 24 ? ? -142.06 35.82 95 13 LYS A 27 ? ? -127.05 -146.25 96 13 MET A 29 ? ? -109.03 -132.48 97 14 ASN A 4 ? ? -147.83 49.38 98 14 THR A 8 ? ? -123.99 -53.05 99 14 LYS A 11 ? ? -171.04 -42.03 100 14 HIS A 21 ? ? -109.35 -112.59 101 14 ASN A 22 ? ? -172.71 55.57 102 14 LYS A 27 ? ? -114.13 -140.92 103 14 MET A 29 ? ? -94.97 -121.47 104 15 ASN A 4 ? ? -141.09 57.88 105 15 VAL A 5 ? ? -104.28 -167.23 106 15 HIS A 21 ? ? -118.28 -117.83 107 15 ASN A 22 ? ? -170.02 61.29 108 15 LYS A 27 ? ? -145.01 -156.37 109 15 MET A 29 ? ? -99.72 -121.47 110 15 LYS A 31 ? ? -144.76 -0.88 111 16 ASN A 4 ? ? -151.74 49.43 112 16 THR A 8 ? ? -125.48 -52.65 113 16 LYS A 11 ? ? -174.38 -36.08 114 16 LEU A 20 ? ? -90.09 -73.16 115 16 SER A 24 ? ? -145.03 32.20 116 16 MET A 29 ? ? -97.27 -121.96 117 16 LYS A 31 ? ? -142.03 -4.11 118 17 ASN A 4 ? ? -147.59 54.33 119 17 LYS A 11 ? ? -175.79 -31.36 120 17 HIS A 21 ? ? -99.97 -115.60 121 17 ASN A 22 ? ? -177.74 58.57 122 17 LYS A 27 ? ? -132.41 -139.62 123 17 MET A 29 ? ? -95.31 -123.96 124 17 LYS A 31 ? ? -140.98 -3.11 125 18 ASN A 4 ? ? -149.02 48.20 126 18 THR A 8 ? ? -130.19 -49.06 127 18 LYS A 11 ? ? -175.02 -35.69 128 18 HIS A 21 ? ? -122.33 -114.51 129 18 ASN A 22 ? ? -173.32 58.02 130 18 SER A 24 ? ? -145.09 37.97 131 18 MET A 29 ? ? -97.10 -121.88 132 19 VAL A 5 ? ? -102.29 -167.87 133 19 LYS A 11 ? ? -174.64 -43.00 134 19 HIS A 21 ? ? -109.83 -116.05 135 19 ASN A 22 ? ? -173.00 57.42 136 19 THR A 23 ? ? -144.71 -156.95 137 19 SER A 24 ? ? -145.10 -2.42 138 19 MET A 29 ? ? -99.62 -121.81 139 20 ASN A 4 ? ? -142.22 52.27 140 20 THR A 8 ? ? -132.85 -52.75 141 20 LYS A 11 ? ? -163.29 -37.12 142 20 LEU A 20 ? ? -90.06 -67.97 143 20 HIS A 21 ? ? -102.73 -114.83 144 20 ASN A 22 ? ? -175.55 58.18 145 20 LYS A 27 ? ? -129.09 -146.00 146 20 MET A 29 ? ? -107.12 -128.82 147 21 ASN A 4 ? ? -149.89 53.30 148 21 THR A 8 ? ? -130.41 -47.21 149 21 LYS A 11 ? ? -172.74 -32.26 150 21 HIS A 21 ? ? -119.36 -115.38 151 21 ASN A 22 ? ? -177.06 58.80 152 21 LYS A 27 ? ? -114.03 -146.78 153 21 MET A 29 ? ? -97.10 -124.06 154 22 THR A 8 ? ? -124.77 -56.77 155 22 SER A 10 ? ? -90.04 57.80 156 22 LYS A 11 ? ? -168.33 -33.33 157 22 LEU A 20 ? ? -90.13 -61.91 158 22 HIS A 21 ? ? -106.21 -112.74 159 22 ASN A 22 ? ? -175.72 57.80 160 22 LYS A 27 ? ? -144.98 -150.36 161 22 MET A 29 ? ? -105.72 -130.20 162 22 LYS A 31 ? ? -140.91 -3.05 163 23 ASN A 4 ? ? -141.91 56.16 164 23 THR A 8 ? ? -130.11 -55.36 165 23 LYS A 11 ? ? -170.09 -42.48 166 23 HIS A 21 ? ? -101.62 -112.57 167 23 ASN A 22 ? ? -174.98 57.98 168 23 SER A 24 ? ? -144.98 23.61 169 23 MET A 29 ? ? -99.45 -122.61 170 24 THR A 8 ? ? -131.39 -47.76 171 24 LYS A 11 ? ? -173.44 -43.29 172 24 HIS A 21 ? ? -100.68 -114.54 173 24 ASN A 22 ? ? -177.73 61.27 174 24 LYS A 27 ? ? -107.97 -149.47 175 24 MET A 29 ? ? -95.00 -119.32 176 24 LYS A 31 ? ? -140.12 -11.58 177 25 THR A 8 ? ? -132.33 -45.91 178 25 LYS A 11 ? ? -173.51 -35.61 179 25 HIS A 21 ? ? -115.09 -119.04 180 25 ASN A 22 ? ? -175.21 62.42 181 25 LYS A 27 ? ? -106.95 -143.35 182 25 MET A 29 ? ? -98.42 -118.75 183 25 LYS A 31 ? ? -131.56 -35.11 184 26 ASN A 4 ? ? -145.36 52.95 185 26 LYS A 11 ? ? -173.94 -38.83 186 26 HIS A 21 ? ? -118.88 -119.08 187 26 ASN A 22 ? ? -174.92 56.35 188 26 LYS A 27 ? ? -127.86 -149.50 189 26 MET A 29 ? ? -98.61 -128.26 190 26 LYS A 31 ? ? -140.46 -3.74 191 27 ASN A 4 ? ? -146.69 52.56 192 27 THR A 8 ? ? -123.25 -57.79 193 27 LYS A 11 ? ? -165.45 -35.81 194 27 HIS A 21 ? ? -101.84 -115.10 195 27 ASN A 22 ? ? 179.86 60.95 196 27 LYS A 27 ? ? -144.96 -154.42 197 27 MET A 29 ? ? -107.63 -132.02 198 28 ASN A 4 ? ? -148.29 49.99 199 28 THR A 8 ? ? -128.66 -51.38 200 28 LYS A 11 ? ? -173.93 -42.49 201 28 HIS A 21 ? ? -118.97 -116.31 202 28 ASN A 22 ? ? -175.84 59.74 203 28 SER A 24 ? ? -144.89 32.62 204 28 MET A 29 ? ? -106.73 -131.62 205 29 ASN A 4 ? ? -155.51 52.30 206 29 LYS A 11 ? ? -173.79 -36.42 207 29 HIS A 21 ? ? -115.94 -119.08 208 29 ASN A 22 ? ? -170.88 58.15 209 29 LYS A 27 ? ? -112.13 -140.53 210 29 MET A 29 ? ? -97.55 -122.52 211 30 ASN A 4 ? ? -149.16 54.02 212 30 THR A 8 ? ? -131.48 -47.23 213 30 LYS A 11 ? ? -173.06 -38.63 214 30 HIS A 21 ? ? -104.05 -114.36 215 30 ASN A 22 ? ? 179.56 60.30 216 30 SER A 24 ? ? -141.72 17.29 217 30 MET A 29 ? ? -98.50 -122.72 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 17 HIS A 21 ? ? 0.081 'SIDE CHAIN' 2 22 TYR A 36 ? ? 0.070 'SIDE CHAIN' #