data_1BDC # _entry.id 1BDC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BDC pdb_00001bdc 10.2210/pdb1bdc/pdb WWPDB D_1000171618 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-01-11 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BDC _pdbx_database_status.recvd_initial_deposition_date 1996-06-28 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1BDD _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gouda, H.' 1 'Torigoe, H.' 2 'Saito, A.' 3 'Sato, M.' 4 'Arata, Y.' 5 'Shimada, I.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Three-dimensional solution structure of the B domain of staphylococcal protein A: comparisons of the solution and crystal structures. ; Biochemistry 31 9665 9672 1992 BICHAW US 0006-2960 0033 ? 1390743 10.1021/bi00155a020 1 ;15N Nuclear Magnetic Resonance Studies of the B Domain of Staphylococcal Protein A: Sequence Specific Assignments of the Imide 15N Resonances of the Proline Residues and the Interaction with Human Immunoglobulin G ; 'FEBS Lett.' 269 174 ? 1990 FEBLAL NE 0014-5793 0165 ? ? ? 2 ;Sequential 1H NMR Assignments and Secondary Structure of the B Domain of Staphylococcal Protein A: Structural Changes between the Free B Domain in Solution and the Fc-Bound B Domain in Crystal ; Biochemistry 29 8787 ? 1990 BICHAW US 0006-2960 0033 ? ? ? 3 'High Level Expression of a Synthetic Gene Coding for Igg-Binding Domain B of Staphylococcal Protein A' 'Protein Eng.' 2 481 ? 1989 PRENE9 UK 0269-2139 0859 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gouda, H.' 1 ? primary 'Torigoe, H.' 2 ? primary 'Saito, A.' 3 ? primary 'Sato, M.' 4 ? primary 'Arata, Y.' 5 ? primary 'Shimada, I.' 6 ? 1 'Torigoe, H.' 7 ? 1 'Shimada, I.' 8 ? 1 'Waelchli, M.' 9 ? 1 'Saito, A.' 10 ? 1 'Sato, M.' 11 ? 1 'Arata, Y.' 12 ? 2 'Torigoe, H.' 13 ? 2 'Shimada, I.' 14 ? 2 'Saito, A.' 15 ? 2 'Sato, M.' 16 ? 2 'Arata, Y.' 17 ? 3 'Saito, A.' 18 ? 3 'Honda, S.' 19 ? 3 'Nishi, T.' 20 ? 3 'Koike, M.' 21 ? 3 'Okazaki, K.' 22 ? 3 'Itoh, S.' 23 ? 3 'Sato, M.' 24 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'STAPHYLOCOCCUS AUREUS PROTEIN A' _entity.formula_weight 6778.418 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'B DOMAIN' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA _entity_poly.pdbx_seq_one_letter_code_can TADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ALA n 1 3 ASP n 1 4 ASN n 1 5 LYS n 1 6 PHE n 1 7 ASN n 1 8 LYS n 1 9 GLU n 1 10 GLN n 1 11 GLN n 1 12 ASN n 1 13 ALA n 1 14 PHE n 1 15 TYR n 1 16 GLU n 1 17 ILE n 1 18 LEU n 1 19 HIS n 1 20 LEU n 1 21 PRO n 1 22 ASN n 1 23 LEU n 1 24 ASN n 1 25 GLU n 1 26 GLU n 1 27 GLN n 1 28 ARG n 1 29 ASN n 1 30 GLY n 1 31 PHE n 1 32 ILE n 1 33 GLN n 1 34 SER n 1 35 LEU n 1 36 LYS n 1 37 ASP n 1 38 ASP n 1 39 PRO n 1 40 SER n 1 41 GLN n 1 42 SER n 1 43 ALA n 1 44 ASN n 1 45 LEU n 1 46 LEU n 1 47 ALA n 1 48 GLU n 1 49 ALA n 1 50 LYS n 1 51 LYS n 1 52 LEU n 1 53 ASN n 1 54 ASP n 1 55 ALA n 1 56 GLN n 1 57 ALA n 1 58 PRO n 1 59 LYS n 1 60 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Staphylococcus _entity_src_gen.pdbx_gene_src_gene 'SYNTHETIC GENE' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PPRAFW1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ALA 60 60 60 ALA ALA A . n # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # _cell.entry_id 1BDC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BDC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1BDC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1BDC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1BDC _struct.title 'STAPHYLOCOCCUS AUREUS PROTEIN A, IMMUNOGLOBULIN-BINDING B DOMAIN, NMR, 10 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BDC _struct_keywords.pdbx_keywords 'IMMUNOGLOBULIN-BINDING PROTEIN' _struct_keywords.text 'IMMUNOGLOBULIN-BINDING PROTEIN, TRANSMEMBRANE, CELL WALL, IMMUNOGLOBULIN BINDING DOMAIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPA2_STAAU _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P38507 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLG EAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNK EQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNG FIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKL NDAQAPKEEDNNKPGKEDGNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDGNKPGKEDGNKPGK EDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEE NPFIGTTVFGGLSLALGAALLAGRRREL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BDC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 60 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P38507 _struct_ref_seq.db_align_beg 212 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 270 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 60 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 10 ? HIS A 19 ? GLN A 10 HIS A 19 1 ? 10 HELX_P HELX_P2 2 GLU A 25 ? ASP A 37 ? GLU A 25 ASP A 37 1 ? 13 HELX_P HELX_P3 3 SER A 42 ? ALA A 55 ? SER A 42 ALA A 55 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD21 A ASN 12 ? ? H A ALA 13 ? ? 1.18 2 4 HD21 A ASN 7 ? ? H A LYS 8 ? ? 1.12 3 4 HD21 A ASN 12 ? ? H A ALA 13 ? ? 1.33 4 5 HG A SER 42 ? ? H A ALA 43 ? ? 1.31 5 6 HD21 A ASN 7 ? ? H A LYS 8 ? ? 1.12 6 10 HD21 A ASN 7 ? ? H A LYS 8 ? ? 1.24 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.242 1.369 -0.127 0.015 N 2 2 CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.245 1.369 -0.124 0.015 N 3 3 CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.244 1.369 -0.125 0.015 N 4 4 CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.244 1.369 -0.125 0.015 N 5 5 CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.244 1.369 -0.125 0.015 N 6 6 CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.244 1.369 -0.125 0.015 N 7 7 CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.239 1.369 -0.130 0.015 N 8 8 CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.238 1.369 -0.131 0.015 N 9 9 CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.244 1.369 -0.125 0.015 N 10 10 CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.242 1.369 -0.127 0.015 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -161.18 -18.16 2 1 ASP A 3 ? ? -108.14 -70.93 3 1 ASN A 4 ? ? -72.79 -161.22 4 1 ASN A 7 ? ? -152.79 -36.37 5 1 LYS A 8 ? ? -53.07 80.04 6 1 GLU A 9 ? ? 42.96 29.05 7 1 GLN A 10 ? ? -91.89 -73.22 8 1 LEU A 18 ? ? -82.95 35.61 9 1 LEU A 20 ? ? -42.90 101.71 10 1 ASP A 38 ? ? -153.06 83.85 11 1 PRO A 39 ? ? -65.69 32.55 12 1 SER A 40 ? ? -90.37 -80.24 13 1 ALA A 55 ? ? -52.83 -6.37 14 2 LYS A 5 ? ? -163.65 61.45 15 2 ASN A 7 ? ? -147.46 -38.41 16 2 LYS A 8 ? ? -55.49 78.20 17 2 GLN A 10 ? ? -93.89 -75.72 18 2 TYR A 15 ? ? -58.75 -4.83 19 2 LEU A 18 ? ? -72.71 28.42 20 2 HIS A 19 ? ? -142.96 -20.95 21 2 LEU A 20 ? ? -37.26 94.29 22 2 ASN A 29 ? ? -39.53 -27.07 23 2 ASP A 38 ? ? -159.57 73.32 24 2 PRO A 39 ? ? -68.64 29.00 25 2 SER A 40 ? ? -93.61 -61.92 26 2 ALA A 43 ? ? -39.05 -39.27 27 2 ASN A 53 ? ? -78.66 -71.89 28 2 ALA A 55 ? ? -66.09 2.49 29 2 GLN A 56 ? ? -137.01 -51.94 30 2 LYS A 59 ? ? -142.17 53.14 31 3 ASP A 3 ? ? 66.68 -25.75 32 3 ASN A 4 ? ? 40.45 86.91 33 3 ASN A 7 ? ? -155.93 -37.64 34 3 LYS A 8 ? ? -56.43 79.31 35 3 GLU A 9 ? ? 36.20 24.87 36 3 ILE A 17 ? ? -39.95 -27.02 37 3 LEU A 18 ? ? -73.54 25.06 38 3 LEU A 20 ? ? -36.14 92.41 39 3 ASP A 38 ? ? -161.80 71.73 40 3 SER A 40 ? ? -52.75 0.71 41 3 SER A 42 ? ? -35.33 -71.17 42 3 ALA A 55 ? ? -67.81 9.87 43 3 GLN A 56 ? ? -153.96 -41.69 44 3 ALA A 57 ? ? -46.27 165.97 45 3 LYS A 59 ? ? -86.28 34.37 46 4 LYS A 5 ? ? 53.05 172.17 47 4 PHE A 6 ? ? 36.32 103.81 48 4 ASN A 7 ? ? -149.56 -28.75 49 4 LYS A 8 ? ? -38.55 160.57 50 4 GLU A 9 ? ? -63.44 15.08 51 4 LEU A 18 ? ? -84.34 37.70 52 4 HIS A 19 ? ? -146.38 -27.58 53 4 LEU A 20 ? ? -38.70 97.33 54 4 ASP A 38 ? ? -159.79 74.24 55 4 PRO A 39 ? ? -67.58 23.86 56 4 PRO A 58 ? ? -61.95 -170.57 57 5 ALA A 2 ? ? -106.93 -80.79 58 5 ASN A 4 ? ? -171.93 10.38 59 5 LYS A 5 ? ? 54.87 113.36 60 5 PHE A 6 ? ? 158.72 78.66 61 5 ASN A 7 ? ? -142.43 -20.46 62 5 GLU A 9 ? ? 178.98 24.35 63 5 LEU A 18 ? ? -84.49 38.07 64 5 HIS A 19 ? ? -147.36 -4.62 65 5 LEU A 20 ? ? -46.25 106.95 66 5 ASP A 38 ? ? -152.64 75.26 67 5 PRO A 39 ? ? -66.65 25.73 68 5 GLN A 41 ? ? -149.18 15.54 69 5 PRO A 58 ? ? -60.55 -175.44 70 6 ALA A 2 ? ? 59.73 116.27 71 6 ASP A 3 ? ? -144.29 -112.25 72 6 ASN A 4 ? ? -88.46 46.86 73 6 LYS A 5 ? ? -109.37 53.11 74 6 ASN A 7 ? ? -161.07 -39.30 75 6 LYS A 8 ? ? -41.19 81.97 76 6 GLU A 9 ? ? 38.83 24.91 77 6 GLN A 10 ? ? -91.61 -89.62 78 6 LEU A 18 ? ? -87.29 32.96 79 6 HIS A 19 ? ? -149.75 13.80 80 6 GLU A 26 ? ? -78.26 -71.71 81 6 ASP A 38 ? ? -161.02 78.64 82 6 PRO A 39 ? ? -71.91 38.67 83 6 GLN A 41 ? ? -109.02 46.28 84 6 ALA A 43 ? ? -38.88 -24.55 85 6 GLN A 56 ? ? -138.94 -59.02 86 6 ALA A 57 ? ? -41.15 163.80 87 6 LYS A 59 ? ? -131.45 -148.62 88 7 ASP A 3 ? ? -61.02 -158.78 89 7 LYS A 5 ? ? -46.47 150.08 90 7 ASN A 7 ? ? -160.86 -34.65 91 7 GLU A 9 ? ? -176.99 29.97 92 7 LEU A 18 ? ? -77.34 38.79 93 7 LEU A 20 ? ? -35.86 92.16 94 7 SER A 40 ? ? -51.09 -0.49 95 7 ALA A 43 ? ? -39.60 -34.92 96 7 GLN A 56 ? ? -132.23 -50.80 97 7 PRO A 58 ? ? -61.40 -172.70 98 8 ASN A 7 ? ? -160.29 -34.42 99 8 LYS A 8 ? ? -53.60 75.36 100 8 GLN A 10 ? ? -94.58 -86.86 101 8 LEU A 18 ? ? -89.74 35.60 102 8 LEU A 20 ? ? -38.06 96.49 103 8 PRO A 39 ? ? -59.51 81.82 104 8 SER A 40 ? ? -80.62 -86.40 105 8 GLN A 41 ? ? -148.98 55.76 106 8 ALA A 55 ? ? -64.76 6.01 107 8 GLN A 56 ? ? -147.63 -55.90 108 8 ALA A 57 ? ? -38.57 102.90 109 9 PHE A 6 ? ? -176.17 122.34 110 9 ASN A 7 ? ? -157.47 -40.73 111 9 LYS A 8 ? ? -48.34 89.85 112 9 GLU A 9 ? ? 36.92 26.15 113 9 GLN A 10 ? ? -92.77 -67.96 114 9 LEU A 18 ? ? -65.98 15.67 115 9 HIS A 19 ? ? -143.70 35.62 116 9 ASN A 29 ? ? -39.66 -29.35 117 9 GLN A 33 ? ? -39.40 -37.51 118 9 PRO A 39 ? ? -67.00 25.68 119 9 GLN A 41 ? ? -160.24 21.96 120 9 ALA A 43 ? ? -39.55 -33.11 121 9 GLN A 56 ? ? -147.46 10.32 122 10 ASP A 3 ? ? -96.64 43.01 123 10 ASN A 7 ? ? -162.79 -36.92 124 10 LYS A 8 ? ? -53.68 72.09 125 10 GLU A 9 ? ? 35.51 25.89 126 10 LEU A 18 ? ? -90.30 39.98 127 10 HIS A 19 ? ? -140.69 -20.57 128 10 LEU A 20 ? ? -38.16 98.30 129 10 PRO A 39 ? ? -71.64 33.11 130 10 GLN A 41 ? ? -144.97 46.94 131 10 LYS A 50 ? ? -39.71 -25.01 132 10 PRO A 58 ? ? -62.01 -173.45 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 28 ? ? 0.288 'SIDE CHAIN' 2 2 ARG A 28 ? ? 0.201 'SIDE CHAIN' 3 3 ARG A 28 ? ? 0.231 'SIDE CHAIN' 4 4 ARG A 28 ? ? 0.172 'SIDE CHAIN' 5 5 ARG A 28 ? ? 0.232 'SIDE CHAIN' 6 6 ARG A 28 ? ? 0.127 'SIDE CHAIN' 7 6 PHE A 31 ? ? 0.074 'SIDE CHAIN' 8 8 ARG A 28 ? ? 0.314 'SIDE CHAIN' 9 9 ARG A 28 ? ? 0.315 'SIDE CHAIN' 10 10 ARG A 28 ? ? 0.204 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1BDC _pdbx_nmr_ensemble.conformers_calculated_total_number 55 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria ;AT FIRST, THE DEPOSITORS CARRIED OUT THE DISTANCE GEOMETRY CALCULATION BY STARTING FROM 55 INITIAL STRUCTURES. THIS CALCULATION RESULTED IN 41 SOLUTIONS, WHICH HAD CORRECT POLYPEPTIDE FOLDS EXCLUDING 14 MIRROR-IMAGE SUBSTRUCTURES. NEXT, THE DYNAMICAL SIMULATED ANNEALING CALCULATIONS WERE PERFORMED BY USING THESE 41 SUBSTRUCTURES. THE DISTANCE AND TORSION ANGLE VIOLATIONS OF THE 41 SOLUTIONS OBTAINED BY THE DYNAMICAL SIMULATED ANNEALING CALCULATIONS WERE SMALLER THAN 0.6 ANGSTROMS AND 27 DEGREES, RESPECTIVELY. THE DEPOSITORS SELECTED 10 SOLUTIONS THAT HAD THE DISTANCE AND TORSION ANGLE VIOLATIONS OF SMALLER THAN 0.5 ANGSTROMS AND 10 DEGREES, RESPECTIVELY. ; # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 DQF-COSY 1 2 1 HOHAHA 1 3 1 NOESY 1 4 1 'PE-COSY; 1H-15N HSQC' 1 5 1 DOUBLE-DEPT 1 6 1 2D-HMQC-HOHAHA 1 7 1 2D-HMQC-NOESY 1 8 1 HMQC-J 1 # _pdbx_nmr_refine.entry_id 1BDC _pdbx_nmr_refine.method 'HYBRID DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING METHOD' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR ? BRUNGER 1 'structure solution' EMBOSS ? ? 2 'structure solution' X-PLOR ? ? 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TYR N N N N 284 TYR CA C N S 285 TYR C C N N 286 TYR O O N N 287 TYR CB C N N 288 TYR CG C Y N 289 TYR CD1 C Y N 290 TYR CD2 C Y N 291 TYR CE1 C Y N 292 TYR CE2 C Y N 293 TYR CZ C Y N 294 TYR OH O N N 295 TYR OXT O N N 296 TYR H H N N 297 TYR H2 H N N 298 TYR HA H N N 299 TYR HB2 H N N 300 TYR HB3 H N N 301 TYR HD1 H N N 302 TYR HD2 H N N 303 TYR HE1 H N N 304 TYR HE2 H N N 305 TYR HH H N N 306 TYR HXT H N N 307 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 SER N CA sing N N 243 SER N H sing N N 244 SER N H2 sing N N 245 SER CA C sing N N 246 SER CA CB sing N N 247 SER CA HA sing N N 248 SER C O doub N N 249 SER C OXT sing N N 250 SER CB OG sing N N 251 SER CB HB2 sing N N 252 SER CB HB3 sing N N 253 SER OG HG sing N N 254 SER OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 TYR N CA sing N N 272 TYR N H sing N N 273 TYR N H2 sing N N 274 TYR CA C sing N N 275 TYR CA CB sing N N 276 TYR CA HA sing N N 277 TYR C O doub N N 278 TYR C OXT sing N N 279 TYR CB CG sing N N 280 TYR CB HB2 sing N N 281 TYR CB HB3 sing N N 282 TYR CG CD1 doub Y N 283 TYR CG CD2 sing Y N 284 TYR CD1 CE1 sing Y N 285 TYR CD1 HD1 sing N N 286 TYR CD2 CE2 doub Y N 287 TYR CD2 HD2 sing N N 288 TYR CE1 CZ doub Y N 289 TYR CE1 HE1 sing N N 290 TYR CE2 CZ sing Y N 291 TYR CE2 HE2 sing N N 292 TYR CZ OH sing N N 293 TYR OH HH sing N N 294 TYR OXT HXT sing N N 295 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model JNM-GSX _pdbx_nmr_spectrometer.manufacturer JEOL _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1BDC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_