data_1BDC
# 
_entry.id   1BDC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1BDC         pdb_00001bdc 10.2210/pdb1bdc/pdb 
WWPDB D_1000171618 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-01-11 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-02-16 
5 'Structure model' 1 4 2024-05-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' Other                       
6 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_database_status  
3 4 'Structure model' pdbx_struct_assembly  
4 4 'Structure model' pdbx_struct_oper_list 
5 5 'Structure model' chem_comp_atom        
6 5 'Structure model' chem_comp_bond        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_database_status.process_site'  
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BDC 
_pdbx_database_status.recvd_initial_deposition_date   1996-06-28 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1BDD 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   'representative structure' 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gouda, H.'   1 
'Torigoe, H.' 2 
'Saito, A.'   3 
'Sato, M.'    4 
'Arata, Y.'   5 
'Shimada, I.' 6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Three-dimensional solution structure of the B domain of staphylococcal protein A: comparisons of the solution and crystal structures.
;
Biochemistry   31  9665 9672 1992 BICHAW US 0006-2960 0033 ? 1390743 10.1021/bi00155a020 
1       
;15N Nuclear Magnetic Resonance Studies of the B Domain of Staphylococcal Protein A: Sequence Specific Assignments of the Imide 15N Resonances of the Proline Residues and the Interaction with Human Immunoglobulin G
;
'FEBS Lett.'   269 174  ?    1990 FEBLAL NE 0014-5793 0165 ? ?       ?                   
2       
;Sequential 1H NMR Assignments and Secondary Structure of the B Domain of Staphylococcal Protein A: Structural Changes between the Free B Domain in Solution and the Fc-Bound B Domain in Crystal
;
Biochemistry   29  8787 ?    1990 BICHAW US 0006-2960 0033 ? ?       ?                   
3       'High Level Expression of a Synthetic Gene Coding for Igg-Binding Domain B of Staphylococcal Protein A' 'Protein Eng.' 2   
481  ?    1989 PRENE9 UK 0269-2139 0859 ? ?       ?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gouda, H.'    1  ? 
primary 'Torigoe, H.'  2  ? 
primary 'Saito, A.'    3  ? 
primary 'Sato, M.'     4  ? 
primary 'Arata, Y.'    5  ? 
primary 'Shimada, I.'  6  ? 
1       'Torigoe, H.'  7  ? 
1       'Shimada, I.'  8  ? 
1       'Waelchli, M.' 9  ? 
1       'Saito, A.'    10 ? 
1       'Sato, M.'     11 ? 
1       'Arata, Y.'    12 ? 
2       'Torigoe, H.'  13 ? 
2       'Shimada, I.'  14 ? 
2       'Saito, A.'    15 ? 
2       'Sato, M.'     16 ? 
2       'Arata, Y.'    17 ? 
3       'Saito, A.'    18 ? 
3       'Honda, S.'    19 ? 
3       'Nishi, T.'    20 ? 
3       'Koike, M.'    21 ? 
3       'Okazaki, K.'  22 ? 
3       'Itoh, S.'     23 ? 
3       'Sato, M.'     24 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'STAPHYLOCOCCUS AUREUS PROTEIN A' 
_entity.formula_weight             6778.418 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'B DOMAIN' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       TADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA 
_entity_poly.pdbx_seq_one_letter_code_can   TADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  THR n 
1 2  ALA n 
1 3  ASP n 
1 4  ASN n 
1 5  LYS n 
1 6  PHE n 
1 7  ASN n 
1 8  LYS n 
1 9  GLU n 
1 10 GLN n 
1 11 GLN n 
1 12 ASN n 
1 13 ALA n 
1 14 PHE n 
1 15 TYR n 
1 16 GLU n 
1 17 ILE n 
1 18 LEU n 
1 19 HIS n 
1 20 LEU n 
1 21 PRO n 
1 22 ASN n 
1 23 LEU n 
1 24 ASN n 
1 25 GLU n 
1 26 GLU n 
1 27 GLN n 
1 28 ARG n 
1 29 ASN n 
1 30 GLY n 
1 31 PHE n 
1 32 ILE n 
1 33 GLN n 
1 34 SER n 
1 35 LEU n 
1 36 LYS n 
1 37 ASP n 
1 38 ASP n 
1 39 PRO n 
1 40 SER n 
1 41 GLN n 
1 42 SER n 
1 43 ALA n 
1 44 ASN n 
1 45 LEU n 
1 46 LEU n 
1 47 ALA n 
1 48 GLU n 
1 49 ALA n 
1 50 LYS n 
1 51 LYS n 
1 52 LEU n 
1 53 ASN n 
1 54 ASP n 
1 55 ALA n 
1 56 GLN n 
1 57 ALA n 
1 58 PRO n 
1 59 LYS n 
1 60 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Staphylococcus 
_entity_src_gen.pdbx_gene_src_gene                 'SYNTHETIC GENE' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Staphylococcus aureus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1280 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PPRAFW1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  THR 1  1  1  THR THR A . n 
A 1 2  ALA 2  2  2  ALA ALA A . n 
A 1 3  ASP 3  3  3  ASP ASP A . n 
A 1 4  ASN 4  4  4  ASN ASN A . n 
A 1 5  LYS 5  5  5  LYS LYS A . n 
A 1 6  PHE 6  6  6  PHE PHE A . n 
A 1 7  ASN 7  7  7  ASN ASN A . n 
A 1 8  LYS 8  8  8  LYS LYS A . n 
A 1 9  GLU 9  9  9  GLU GLU A . n 
A 1 10 GLN 10 10 10 GLN GLN A . n 
A 1 11 GLN 11 11 11 GLN GLN A . n 
A 1 12 ASN 12 12 12 ASN ASN A . n 
A 1 13 ALA 13 13 13 ALA ALA A . n 
A 1 14 PHE 14 14 14 PHE PHE A . n 
A 1 15 TYR 15 15 15 TYR TYR A . n 
A 1 16 GLU 16 16 16 GLU GLU A . n 
A 1 17 ILE 17 17 17 ILE ILE A . n 
A 1 18 LEU 18 18 18 LEU LEU A . n 
A 1 19 HIS 19 19 19 HIS HIS A . n 
A 1 20 LEU 20 20 20 LEU LEU A . n 
A 1 21 PRO 21 21 21 PRO PRO A . n 
A 1 22 ASN 22 22 22 ASN ASN A . n 
A 1 23 LEU 23 23 23 LEU LEU A . n 
A 1 24 ASN 24 24 24 ASN ASN A . n 
A 1 25 GLU 25 25 25 GLU GLU A . n 
A 1 26 GLU 26 26 26 GLU GLU A . n 
A 1 27 GLN 27 27 27 GLN GLN A . n 
A 1 28 ARG 28 28 28 ARG ARG A . n 
A 1 29 ASN 29 29 29 ASN ASN A . n 
A 1 30 GLY 30 30 30 GLY GLY A . n 
A 1 31 PHE 31 31 31 PHE PHE A . n 
A 1 32 ILE 32 32 32 ILE ILE A . n 
A 1 33 GLN 33 33 33 GLN GLN A . n 
A 1 34 SER 34 34 34 SER SER A . n 
A 1 35 LEU 35 35 35 LEU LEU A . n 
A 1 36 LYS 36 36 36 LYS LYS A . n 
A 1 37 ASP 37 37 37 ASP ASP A . n 
A 1 38 ASP 38 38 38 ASP ASP A . n 
A 1 39 PRO 39 39 39 PRO PRO A . n 
A 1 40 SER 40 40 40 SER SER A . n 
A 1 41 GLN 41 41 41 GLN GLN A . n 
A 1 42 SER 42 42 42 SER SER A . n 
A 1 43 ALA 43 43 43 ALA ALA A . n 
A 1 44 ASN 44 44 44 ASN ASN A . n 
A 1 45 LEU 45 45 45 LEU LEU A . n 
A 1 46 LEU 46 46 46 LEU LEU A . n 
A 1 47 ALA 47 47 47 ALA ALA A . n 
A 1 48 GLU 48 48 48 GLU GLU A . n 
A 1 49 ALA 49 49 49 ALA ALA A . n 
A 1 50 LYS 50 50 50 LYS LYS A . n 
A 1 51 LYS 51 51 51 LYS LYS A . n 
A 1 52 LEU 52 52 52 LEU LEU A . n 
A 1 53 ASN 53 53 53 ASN ASN A . n 
A 1 54 ASP 54 54 54 ASP ASP A . n 
A 1 55 ALA 55 55 55 ALA ALA A . n 
A 1 56 GLN 56 56 56 GLN GLN A . n 
A 1 57 ALA 57 57 57 ALA ALA A . n 
A 1 58 PRO 58 58 58 PRO PRO A . n 
A 1 59 LYS 59 59 59 LYS LYS A . n 
A 1 60 ALA 60 60 60 ALA ALA A . n 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
_cell.entry_id           1BDC 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BDC 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          1BDC 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_database_PDB_matrix.entry_id          1BDC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1BDC 
_struct.title                     'STAPHYLOCOCCUS AUREUS PROTEIN A, IMMUNOGLOBULIN-BINDING B DOMAIN, NMR, 10 STRUCTURES' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BDC 
_struct_keywords.pdbx_keywords   'IMMUNOGLOBULIN-BINDING PROTEIN' 
_struct_keywords.text            'IMMUNOGLOBULIN-BINDING PROTEIN, TRANSMEMBRANE, CELL WALL, IMMUNOGLOBULIN BINDING DOMAIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SPA2_STAAU 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P38507 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLG
EAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNK
EQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNG
FIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKL
NDAQAPKEEDNNKPGKEDGNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDGNKPGKEDGNKPGK
EDGNKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEE
NPFIGTTVFGGLSLALGAALLAGRRREL
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1BDC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 60 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P38507 
_struct_ref_seq.db_align_beg                  212 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  270 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       60 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 10 ? HIS A 19 ? GLN A 10 HIS A 19 1 ? 10 
HELX_P HELX_P2 2 GLU A 25 ? ASP A 37 ? GLU A 25 ASP A 37 1 ? 13 
HELX_P HELX_P3 3 SER A 42 ? ALA A 55 ? SER A 42 ALA A 55 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1  HD21 A ASN 12 ? ? H A ALA 13 ? ? 1.18 
2 4  HD21 A ASN 7  ? ? H A LYS 8  ? ? 1.12 
3 4  HD21 A ASN 12 ? ? H A ALA 13 ? ? 1.33 
4 5  HG   A SER 42 ? ? H A ALA 43 ? ? 1.31 
5 6  HD21 A ASN 7  ? ? H A LYS 8  ? ? 1.12 
6 10 HD21 A ASN 7  ? ? H A LYS 8  ? ? 1.24 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1  CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.242 1.369 -0.127 0.015 N 
2  2  CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.245 1.369 -0.124 0.015 N 
3  3  CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.244 1.369 -0.125 0.015 N 
4  4  CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.244 1.369 -0.125 0.015 N 
5  5  CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.244 1.369 -0.125 0.015 N 
6  6  CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.244 1.369 -0.125 0.015 N 
7  7  CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.239 1.369 -0.130 0.015 N 
8  8  CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.238 1.369 -0.131 0.015 N 
9  9  CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.244 1.369 -0.125 0.015 N 
10 10 CG A HIS 19 ? ? ND1 A HIS 19 ? ? 1.242 1.369 -0.127 0.015 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  ALA A 2  ? ? -161.18 -18.16  
2   1  ASP A 3  ? ? -108.14 -70.93  
3   1  ASN A 4  ? ? -72.79  -161.22 
4   1  ASN A 7  ? ? -152.79 -36.37  
5   1  LYS A 8  ? ? -53.07  80.04   
6   1  GLU A 9  ? ? 42.96   29.05   
7   1  GLN A 10 ? ? -91.89  -73.22  
8   1  LEU A 18 ? ? -82.95  35.61   
9   1  LEU A 20 ? ? -42.90  101.71  
10  1  ASP A 38 ? ? -153.06 83.85   
11  1  PRO A 39 ? ? -65.69  32.55   
12  1  SER A 40 ? ? -90.37  -80.24  
13  1  ALA A 55 ? ? -52.83  -6.37   
14  2  LYS A 5  ? ? -163.65 61.45   
15  2  ASN A 7  ? ? -147.46 -38.41  
16  2  LYS A 8  ? ? -55.49  78.20   
17  2  GLN A 10 ? ? -93.89  -75.72  
18  2  TYR A 15 ? ? -58.75  -4.83   
19  2  LEU A 18 ? ? -72.71  28.42   
20  2  HIS A 19 ? ? -142.96 -20.95  
21  2  LEU A 20 ? ? -37.26  94.29   
22  2  ASN A 29 ? ? -39.53  -27.07  
23  2  ASP A 38 ? ? -159.57 73.32   
24  2  PRO A 39 ? ? -68.64  29.00   
25  2  SER A 40 ? ? -93.61  -61.92  
26  2  ALA A 43 ? ? -39.05  -39.27  
27  2  ASN A 53 ? ? -78.66  -71.89  
28  2  ALA A 55 ? ? -66.09  2.49    
29  2  GLN A 56 ? ? -137.01 -51.94  
30  2  LYS A 59 ? ? -142.17 53.14   
31  3  ASP A 3  ? ? 66.68   -25.75  
32  3  ASN A 4  ? ? 40.45   86.91   
33  3  ASN A 7  ? ? -155.93 -37.64  
34  3  LYS A 8  ? ? -56.43  79.31   
35  3  GLU A 9  ? ? 36.20   24.87   
36  3  ILE A 17 ? ? -39.95  -27.02  
37  3  LEU A 18 ? ? -73.54  25.06   
38  3  LEU A 20 ? ? -36.14  92.41   
39  3  ASP A 38 ? ? -161.80 71.73   
40  3  SER A 40 ? ? -52.75  0.71    
41  3  SER A 42 ? ? -35.33  -71.17  
42  3  ALA A 55 ? ? -67.81  9.87    
43  3  GLN A 56 ? ? -153.96 -41.69  
44  3  ALA A 57 ? ? -46.27  165.97  
45  3  LYS A 59 ? ? -86.28  34.37   
46  4  LYS A 5  ? ? 53.05   172.17  
47  4  PHE A 6  ? ? 36.32   103.81  
48  4  ASN A 7  ? ? -149.56 -28.75  
49  4  LYS A 8  ? ? -38.55  160.57  
50  4  GLU A 9  ? ? -63.44  15.08   
51  4  LEU A 18 ? ? -84.34  37.70   
52  4  HIS A 19 ? ? -146.38 -27.58  
53  4  LEU A 20 ? ? -38.70  97.33   
54  4  ASP A 38 ? ? -159.79 74.24   
55  4  PRO A 39 ? ? -67.58  23.86   
56  4  PRO A 58 ? ? -61.95  -170.57 
57  5  ALA A 2  ? ? -106.93 -80.79  
58  5  ASN A 4  ? ? -171.93 10.38   
59  5  LYS A 5  ? ? 54.87   113.36  
60  5  PHE A 6  ? ? 158.72  78.66   
61  5  ASN A 7  ? ? -142.43 -20.46  
62  5  GLU A 9  ? ? 178.98  24.35   
63  5  LEU A 18 ? ? -84.49  38.07   
64  5  HIS A 19 ? ? -147.36 -4.62   
65  5  LEU A 20 ? ? -46.25  106.95  
66  5  ASP A 38 ? ? -152.64 75.26   
67  5  PRO A 39 ? ? -66.65  25.73   
68  5  GLN A 41 ? ? -149.18 15.54   
69  5  PRO A 58 ? ? -60.55  -175.44 
70  6  ALA A 2  ? ? 59.73   116.27  
71  6  ASP A 3  ? ? -144.29 -112.25 
72  6  ASN A 4  ? ? -88.46  46.86   
73  6  LYS A 5  ? ? -109.37 53.11   
74  6  ASN A 7  ? ? -161.07 -39.30  
75  6  LYS A 8  ? ? -41.19  81.97   
76  6  GLU A 9  ? ? 38.83   24.91   
77  6  GLN A 10 ? ? -91.61  -89.62  
78  6  LEU A 18 ? ? -87.29  32.96   
79  6  HIS A 19 ? ? -149.75 13.80   
80  6  GLU A 26 ? ? -78.26  -71.71  
81  6  ASP A 38 ? ? -161.02 78.64   
82  6  PRO A 39 ? ? -71.91  38.67   
83  6  GLN A 41 ? ? -109.02 46.28   
84  6  ALA A 43 ? ? -38.88  -24.55  
85  6  GLN A 56 ? ? -138.94 -59.02  
86  6  ALA A 57 ? ? -41.15  163.80  
87  6  LYS A 59 ? ? -131.45 -148.62 
88  7  ASP A 3  ? ? -61.02  -158.78 
89  7  LYS A 5  ? ? -46.47  150.08  
90  7  ASN A 7  ? ? -160.86 -34.65  
91  7  GLU A 9  ? ? -176.99 29.97   
92  7  LEU A 18 ? ? -77.34  38.79   
93  7  LEU A 20 ? ? -35.86  92.16   
94  7  SER A 40 ? ? -51.09  -0.49   
95  7  ALA A 43 ? ? -39.60  -34.92  
96  7  GLN A 56 ? ? -132.23 -50.80  
97  7  PRO A 58 ? ? -61.40  -172.70 
98  8  ASN A 7  ? ? -160.29 -34.42  
99  8  LYS A 8  ? ? -53.60  75.36   
100 8  GLN A 10 ? ? -94.58  -86.86  
101 8  LEU A 18 ? ? -89.74  35.60   
102 8  LEU A 20 ? ? -38.06  96.49   
103 8  PRO A 39 ? ? -59.51  81.82   
104 8  SER A 40 ? ? -80.62  -86.40  
105 8  GLN A 41 ? ? -148.98 55.76   
106 8  ALA A 55 ? ? -64.76  6.01    
107 8  GLN A 56 ? ? -147.63 -55.90  
108 8  ALA A 57 ? ? -38.57  102.90  
109 9  PHE A 6  ? ? -176.17 122.34  
110 9  ASN A 7  ? ? -157.47 -40.73  
111 9  LYS A 8  ? ? -48.34  89.85   
112 9  GLU A 9  ? ? 36.92   26.15   
113 9  GLN A 10 ? ? -92.77  -67.96  
114 9  LEU A 18 ? ? -65.98  15.67   
115 9  HIS A 19 ? ? -143.70 35.62   
116 9  ASN A 29 ? ? -39.66  -29.35  
117 9  GLN A 33 ? ? -39.40  -37.51  
118 9  PRO A 39 ? ? -67.00  25.68   
119 9  GLN A 41 ? ? -160.24 21.96   
120 9  ALA A 43 ? ? -39.55  -33.11  
121 9  GLN A 56 ? ? -147.46 10.32   
122 10 ASP A 3  ? ? -96.64  43.01   
123 10 ASN A 7  ? ? -162.79 -36.92  
124 10 LYS A 8  ? ? -53.68  72.09   
125 10 GLU A 9  ? ? 35.51   25.89   
126 10 LEU A 18 ? ? -90.30  39.98   
127 10 HIS A 19 ? ? -140.69 -20.57  
128 10 LEU A 20 ? ? -38.16  98.30   
129 10 PRO A 39 ? ? -71.64  33.11   
130 10 GLN A 41 ? ? -144.97 46.94   
131 10 LYS A 50 ? ? -39.71  -25.01  
132 10 PRO A 58 ? ? -62.01  -173.45 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1  ARG A 28 ? ? 0.288 'SIDE CHAIN' 
2  2  ARG A 28 ? ? 0.201 'SIDE CHAIN' 
3  3  ARG A 28 ? ? 0.231 'SIDE CHAIN' 
4  4  ARG A 28 ? ? 0.172 'SIDE CHAIN' 
5  5  ARG A 28 ? ? 0.232 'SIDE CHAIN' 
6  6  ARG A 28 ? ? 0.127 'SIDE CHAIN' 
7  6  PHE A 31 ? ? 0.074 'SIDE CHAIN' 
8  8  ARG A 28 ? ? 0.314 'SIDE CHAIN' 
9  9  ARG A 28 ? ? 0.315 'SIDE CHAIN' 
10 10 ARG A 28 ? ? 0.204 'SIDE CHAIN' 
# 
_pdbx_nmr_ensemble.entry_id                             1BDC 
_pdbx_nmr_ensemble.conformers_calculated_total_number   55 
_pdbx_nmr_ensemble.conformers_submitted_total_number    10 
_pdbx_nmr_ensemble.conformer_selection_criteria         
;AT FIRST, THE DEPOSITORS CARRIED OUT THE DISTANCE GEOMETRY CALCULATION BY STARTING FROM 55 INITIAL STRUCTURES. THIS CALCULATION RESULTED IN 41 SOLUTIONS, WHICH HAD CORRECT POLYPEPTIDE FOLDS EXCLUDING 14 MIRROR-IMAGE SUBSTRUCTURES. NEXT, THE DYNAMICAL SIMULATED ANNEALING CALCULATIONS WERE PERFORMED BY USING THESE 41 SUBSTRUCTURES. THE DISTANCE AND TORSION ANGLE VIOLATIONS OF THE 41 SOLUTIONS OBTAINED BY THE DYNAMICAL SIMULATED ANNEALING CALCULATIONS WERE SMALLER THAN 0.6 ANGSTROMS AND 27 DEGREES, RESPECTIVELY. THE DEPOSITORS SELECTED 10 SOLUTIONS THAT HAD THE DISTANCE AND TORSION ANGLE VIOLATIONS OF SMALLER THAN 0.5 ANGSTROMS AND 10 DEGREES, RESPECTIVELY.
;
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  5.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 DQF-COSY               1 
2 1 HOHAHA                 1 
3 1 NOESY                  1 
4 1 'PE-COSY; 1H-15N HSQC' 1 
5 1 DOUBLE-DEPT            1 
6 1 2D-HMQC-HOHAHA         1 
7 1 2D-HMQC-NOESY          1 
8 1 HMQC-J                 1 
# 
_pdbx_nmr_refine.entry_id           1BDC 
_pdbx_nmr_refine.method             'HYBRID DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING METHOD' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           X-PLOR ? BRUNGER 1 
'structure solution' EMBOSS ? ?       2 
'structure solution' X-PLOR ? ?       3 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
HIS N    N N N 123 
HIS CA   C N S 124 
HIS C    C N N 125 
HIS O    O N N 126 
HIS CB   C N N 127 
HIS CG   C Y N 128 
HIS ND1  N Y N 129 
HIS CD2  C Y N 130 
HIS CE1  C Y N 131 
HIS NE2  N Y N 132 
HIS OXT  O N N 133 
HIS H    H N N 134 
HIS H2   H N N 135 
HIS HA   H N N 136 
HIS HB2  H N N 137 
HIS HB3  H N N 138 
HIS HD1  H N N 139 
HIS HD2  H N N 140 
HIS HE1  H N N 141 
HIS HE2  H N N 142 
HIS HXT  H N N 143 
ILE N    N N N 144 
ILE CA   C N S 145 
ILE C    C N N 146 
ILE O    O N N 147 
ILE CB   C N S 148 
ILE CG1  C N N 149 
ILE CG2  C N N 150 
ILE CD1  C N N 151 
ILE OXT  O N N 152 
ILE H    H N N 153 
ILE H2   H N N 154 
ILE HA   H N N 155 
ILE HB   H N N 156 
ILE HG12 H N N 157 
ILE HG13 H N N 158 
ILE HG21 H N N 159 
ILE HG22 H N N 160 
ILE HG23 H N N 161 
ILE HD11 H N N 162 
ILE HD12 H N N 163 
ILE HD13 H N N 164 
ILE HXT  H N N 165 
LEU N    N N N 166 
LEU CA   C N S 167 
LEU C    C N N 168 
LEU O    O N N 169 
LEU CB   C N N 170 
LEU CG   C N N 171 
LEU CD1  C N N 172 
LEU CD2  C N N 173 
LEU OXT  O N N 174 
LEU H    H N N 175 
LEU H2   H N N 176 
LEU HA   H N N 177 
LEU HB2  H N N 178 
LEU HB3  H N N 179 
LEU HG   H N N 180 
LEU HD11 H N N 181 
LEU HD12 H N N 182 
LEU HD13 H N N 183 
LEU HD21 H N N 184 
LEU HD22 H N N 185 
LEU HD23 H N N 186 
LEU HXT  H N N 187 
LYS N    N N N 188 
LYS CA   C N S 189 
LYS C    C N N 190 
LYS O    O N N 191 
LYS CB   C N N 192 
LYS CG   C N N 193 
LYS CD   C N N 194 
LYS CE   C N N 195 
LYS NZ   N N N 196 
LYS OXT  O N N 197 
LYS H    H N N 198 
LYS H2   H N N 199 
LYS HA   H N N 200 
LYS HB2  H N N 201 
LYS HB3  H N N 202 
LYS HG2  H N N 203 
LYS HG3  H N N 204 
LYS HD2  H N N 205 
LYS HD3  H N N 206 
LYS HE2  H N N 207 
LYS HE3  H N N 208 
LYS HZ1  H N N 209 
LYS HZ2  H N N 210 
LYS HZ3  H N N 211 
LYS HXT  H N N 212 
PHE N    N N N 213 
PHE CA   C N S 214 
PHE C    C N N 215 
PHE O    O N N 216 
PHE CB   C N N 217 
PHE CG   C Y N 218 
PHE CD1  C Y N 219 
PHE CD2  C Y N 220 
PHE CE1  C Y N 221 
PHE CE2  C Y N 222 
PHE CZ   C Y N 223 
PHE OXT  O N N 224 
PHE H    H N N 225 
PHE H2   H N N 226 
PHE HA   H N N 227 
PHE HB2  H N N 228 
PHE HB3  H N N 229 
PHE HD1  H N N 230 
PHE HD2  H N N 231 
PHE HE1  H N N 232 
PHE HE2  H N N 233 
PHE HZ   H N N 234 
PHE HXT  H N N 235 
PRO N    N N N 236 
PRO CA   C N S 237 
PRO C    C N N 238 
PRO O    O N N 239 
PRO CB   C N N 240 
PRO CG   C N N 241 
PRO CD   C N N 242 
PRO OXT  O N N 243 
PRO H    H N N 244 
PRO HA   H N N 245 
PRO HB2  H N N 246 
PRO HB3  H N N 247 
PRO HG2  H N N 248 
PRO HG3  H N N 249 
PRO HD2  H N N 250 
PRO HD3  H N N 251 
PRO HXT  H N N 252 
SER N    N N N 253 
SER CA   C N S 254 
SER C    C N N 255 
SER O    O N N 256 
SER CB   C N N 257 
SER OG   O N N 258 
SER OXT  O N N 259 
SER H    H N N 260 
SER H2   H N N 261 
SER HA   H N N 262 
SER HB2  H N N 263 
SER HB3  H N N 264 
SER HG   H N N 265 
SER HXT  H N N 266 
THR N    N N N 267 
THR CA   C N S 268 
THR C    C N N 269 
THR O    O N N 270 
THR CB   C N R 271 
THR OG1  O N N 272 
THR CG2  C N N 273 
THR OXT  O N N 274 
THR H    H N N 275 
THR H2   H N N 276 
THR HA   H N N 277 
THR HB   H N N 278 
THR HG1  H N N 279 
THR HG21 H N N 280 
THR HG22 H N N 281 
THR HG23 H N N 282 
THR HXT  H N N 283 
TYR N    N N N 284 
TYR CA   C N S 285 
TYR C    C N N 286 
TYR O    O N N 287 
TYR CB   C N N 288 
TYR CG   C Y N 289 
TYR CD1  C Y N 290 
TYR CD2  C Y N 291 
TYR CE1  C Y N 292 
TYR CE2  C Y N 293 
TYR CZ   C Y N 294 
TYR OH   O N N 295 
TYR OXT  O N N 296 
TYR H    H N N 297 
TYR H2   H N N 298 
TYR HA   H N N 299 
TYR HB2  H N N 300 
TYR HB3  H N N 301 
TYR HD1  H N N 302 
TYR HD2  H N N 303 
TYR HE1  H N N 304 
TYR HE2  H N N 305 
TYR HH   H N N 306 
TYR HXT  H N N 307 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
PHE N   CA   sing N N 203 
PHE N   H    sing N N 204 
PHE N   H2   sing N N 205 
PHE CA  C    sing N N 206 
PHE CA  CB   sing N N 207 
PHE CA  HA   sing N N 208 
PHE C   O    doub N N 209 
PHE C   OXT  sing N N 210 
PHE CB  CG   sing N N 211 
PHE CB  HB2  sing N N 212 
PHE CB  HB3  sing N N 213 
PHE CG  CD1  doub Y N 214 
PHE CG  CD2  sing Y N 215 
PHE CD1 CE1  sing Y N 216 
PHE CD1 HD1  sing N N 217 
PHE CD2 CE2  doub Y N 218 
PHE CD2 HD2  sing N N 219 
PHE CE1 CZ   doub Y N 220 
PHE CE1 HE1  sing N N 221 
PHE CE2 CZ   sing Y N 222 
PHE CE2 HE2  sing N N 223 
PHE CZ  HZ   sing N N 224 
PHE OXT HXT  sing N N 225 
PRO N   CA   sing N N 226 
PRO N   CD   sing N N 227 
PRO N   H    sing N N 228 
PRO CA  C    sing N N 229 
PRO CA  CB   sing N N 230 
PRO CA  HA   sing N N 231 
PRO C   O    doub N N 232 
PRO C   OXT  sing N N 233 
PRO CB  CG   sing N N 234 
PRO CB  HB2  sing N N 235 
PRO CB  HB3  sing N N 236 
PRO CG  CD   sing N N 237 
PRO CG  HG2  sing N N 238 
PRO CG  HG3  sing N N 239 
PRO CD  HD2  sing N N 240 
PRO CD  HD3  sing N N 241 
PRO OXT HXT  sing N N 242 
SER N   CA   sing N N 243 
SER N   H    sing N N 244 
SER N   H2   sing N N 245 
SER CA  C    sing N N 246 
SER CA  CB   sing N N 247 
SER CA  HA   sing N N 248 
SER C   O    doub N N 249 
SER C   OXT  sing N N 250 
SER CB  OG   sing N N 251 
SER CB  HB2  sing N N 252 
SER CB  HB3  sing N N 253 
SER OG  HG   sing N N 254 
SER OXT HXT  sing N N 255 
THR N   CA   sing N N 256 
THR N   H    sing N N 257 
THR N   H2   sing N N 258 
THR CA  C    sing N N 259 
THR CA  CB   sing N N 260 
THR CA  HA   sing N N 261 
THR C   O    doub N N 262 
THR C   OXT  sing N N 263 
THR CB  OG1  sing N N 264 
THR CB  CG2  sing N N 265 
THR CB  HB   sing N N 266 
THR OG1 HG1  sing N N 267 
THR CG2 HG21 sing N N 268 
THR CG2 HG22 sing N N 269 
THR CG2 HG23 sing N N 270 
THR OXT HXT  sing N N 271 
TYR N   CA   sing N N 272 
TYR N   H    sing N N 273 
TYR N   H2   sing N N 274 
TYR CA  C    sing N N 275 
TYR CA  CB   sing N N 276 
TYR CA  HA   sing N N 277 
TYR C   O    doub N N 278 
TYR C   OXT  sing N N 279 
TYR CB  CG   sing N N 280 
TYR CB  HB2  sing N N 281 
TYR CB  HB3  sing N N 282 
TYR CG  CD1  doub Y N 283 
TYR CG  CD2  sing Y N 284 
TYR CD1 CE1  sing Y N 285 
TYR CD1 HD1  sing N N 286 
TYR CD2 CE2  doub Y N 287 
TYR CD2 HD2  sing N N 288 
TYR CE1 CZ   doub Y N 289 
TYR CE1 HE1  sing N N 290 
TYR CE2 CZ   sing Y N 291 
TYR CE2 HE2  sing N N 292 
TYR CZ  OH   sing N N 293 
TYR OH  HH   sing N N 294 
TYR OXT HXT  sing N N 295 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             JNM-GSX 
_pdbx_nmr_spectrometer.manufacturer      JEOL 
_pdbx_nmr_spectrometer.field_strength    500 
# 
_atom_sites.entry_id                    1BDC 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_