data_1BFY # _entry.id 1BFY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BFY pdb_00001bfy 10.2210/pdb1bfy/pdb WWPDB D_1000171708 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-05-25 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 5 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 6 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 17 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 18 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BFY _pdbx_database_status.recvd_initial_deposition_date 1998-05-23 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bertini, I.' 1 'Kurtz Junior, D.M.' 2 'Eidsness, M.K.' 3 'Liu, G.' 4 'Luchinat, C.' 5 'Rosato, A.' 6 'Scott, R.A.' 7 # _citation.id primary _citation.title 'Solution Structure of Reduced Clostridium Pasteurianum Rubredoxin' _citation.journal_abbrev J.Biol.Inorg.Chem. _citation.journal_volume 3 _citation.page_first 401 _citation.page_last ? _citation.year 1998 _citation.journal_id_ASTM JJBCFA _citation.country GW _citation.journal_id_ISSN 0949-8257 _citation.journal_id_CSD 2154 _citation.book_publisher ? _citation.pdbx_database_id_PubMed -1 _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bertini, I.' 1 ? primary 'Kurtz Junior, D.M.' 2 ? primary 'Eidsness, M.K.' 3 ? primary 'Liu, G.' 4 ? primary 'Luchinat, C.' 5 ? primary 'Rosato, A.' 6 ? primary 'Scott, R.A.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat RUBREDOXIN 6051.611 1 1.18.1.1 ? ? 'REDUCED CLOSTRIDIUM PASTEURIANUM RUBREDOXIN' 2 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE _entity_poly.pdbx_seq_one_letter_code_can MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'FE (III) ION' _pdbx_entity_nonpoly.comp_id FE # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 LYS n 1 4 TYR n 1 5 THR n 1 6 CYS n 1 7 THR n 1 8 VAL n 1 9 CYS n 1 10 GLY n 1 11 TYR n 1 12 ILE n 1 13 TYR n 1 14 ASN n 1 15 PRO n 1 16 GLU n 1 17 ASP n 1 18 GLY n 1 19 ASP n 1 20 PRO n 1 21 ASP n 1 22 ASN n 1 23 GLY n 1 24 VAL n 1 25 ASN n 1 26 PRO n 1 27 GLY n 1 28 THR n 1 29 ASP n 1 30 PHE n 1 31 LYS n 1 32 ASP n 1 33 ILE n 1 34 PRO n 1 35 ASP n 1 36 ASP n 1 37 TRP n 1 38 VAL n 1 39 CYS n 1 40 PRO n 1 41 LEU n 1 42 CYS n 1 43 GLY n 1 44 VAL n 1 45 GLY n 1 46 LYS n 1 47 ASP n 1 48 GLN n 1 49 PHE n 1 50 GLU n 1 51 GLU n 1 52 VAL n 1 53 GLU n 1 54 GLU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Clostridium pasteurianum' _entity_src_nat.pdbx_ncbi_taxonomy_id 1501 _entity_src_nat.genus Clostridium _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLU 54 54 54 GLU GLU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id FE _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 55 _pdbx_nonpoly_scheme.auth_seq_num 55 _pdbx_nonpoly_scheme.pdb_mon_id FE _pdbx_nonpoly_scheme.auth_mon_id FE _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DYANA 'model building' . ? 1 XWINNMR 'model building' . ? 2 DYANA refinement . ? 3 XWINNMR refinement . ? 4 # _cell.entry_id 1BFY _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BFY _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1BFY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1BFY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1BFY _struct.title 'SOLUTION STRUCTURE OF REDUCED CLOSTRIDIUM PASTEURIANUM RUBREDOXIN, NMR, 20 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BFY _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'ELECTRON TRANSPORT, RUBREDOXIN, SOLUTION STRUCTURE, PARAMAGNETISM, NUCLEAR RELAXATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RUBR_CLOPA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00268 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BFY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 54 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00268 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 54 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 54 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 6 SG ? ? ? 1_555 B FE . FE ? ? A CYS 6 A FE 55 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc2 metalc ? ? A CYS 9 SG ? ? ? 1_555 B FE . FE ? ? A CYS 9 A FE 55 1_555 ? ? ? ? ? ? ? 2.226 ? ? metalc3 metalc ? ? A CYS 39 SG ? ? ? 1_555 B FE . FE ? ? A CYS 39 A FE 55 1_555 ? ? ? ? ? ? ? 2.253 ? ? metalc4 metalc ? ? A CYS 42 SG ? ? ? 1_555 B FE . FE ? ? A CYS 42 A FE 55 1_555 ? ? ? ? ? ? ? 2.247 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 6 ? A CYS 6 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 9 ? A CYS 9 ? 1_555 92.5 ? 2 SG ? A CYS 6 ? A CYS 6 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 100.5 ? 3 SG ? A CYS 9 ? A CYS 9 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 121.0 ? 4 SG ? A CYS 6 ? A CYS 6 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 125.0 ? 5 SG ? A CYS 9 ? A CYS 9 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 106.2 ? 6 SG ? A CYS 39 ? A CYS 39 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 111.7 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 3 ? TYR A 4 ? LYS A 3 TYR A 4 A 2 GLU A 51 ? VAL A 52 ? GLU A 51 VAL A 52 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 3 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 3 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 52 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 52 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details FEB Unknown ? ? ? ? 4 'IRON BINDING SITE.' AC1 Software A FE 55 ? 4 'BINDING SITE FOR RESIDUE FE A 55' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 FEB 4 CYS A 6 ? CYS A 6 . ? 1_555 ? 2 FEB 4 CYS A 9 ? CYS A 9 . ? 1_555 ? 3 FEB 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 4 FEB 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 5 AC1 4 CYS A 6 ? CYS A 6 . ? 1_555 ? 6 AC1 4 CYS A 9 ? CYS A 9 . ? 1_555 ? 7 AC1 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 8 AC1 4 CYS A 42 ? CYS A 42 . ? 1_555 ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 9 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 42 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 42 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 42 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 119.81 _pdbx_validate_rmsd_angle.angle_target_value 111.50 _pdbx_validate_rmsd_angle.angle_deviation 8.31 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? 58.72 167.41 2 1 CYS A 6 ? ? -68.77 -97.56 3 1 THR A 7 ? ? -172.95 -41.65 4 1 VAL A 8 ? ? -147.79 -38.62 5 1 VAL A 44 ? ? -145.46 -51.85 6 2 CYS A 6 ? ? -74.84 -112.08 7 2 THR A 7 ? ? -160.18 -158.20 8 2 CYS A 9 ? ? -153.19 -55.85 9 2 CYS A 39 ? ? -34.57 148.55 10 2 ASP A 47 ? ? 54.67 -68.53 11 3 CYS A 6 ? ? -58.91 94.72 12 3 TYR A 11 ? ? -150.82 66.13 13 3 ILE A 12 ? ? -37.79 125.19 14 3 CYS A 39 ? ? -39.65 144.02 15 3 LEU A 41 ? ? -149.32 35.87 16 3 CYS A 42 ? ? -131.19 -47.41 17 3 ASP A 47 ? ? 21.11 85.83 18 3 GLN A 48 ? ? 75.20 150.66 19 3 PHE A 49 ? ? -171.02 109.44 20 4 LYS A 2 ? ? 62.54 162.00 21 4 CYS A 6 ? ? -77.56 47.45 22 4 THR A 7 ? ? 43.39 -124.27 23 4 CYS A 9 ? ? -133.00 -70.04 24 4 TYR A 11 ? ? -131.91 -57.63 25 4 ILE A 12 ? ? 75.17 119.15 26 4 VAL A 44 ? ? 48.07 -149.39 27 4 ASP A 47 ? ? -158.43 -63.59 28 5 LYS A 2 ? ? 60.15 168.36 29 5 VAL A 8 ? ? -123.34 -65.15 30 5 CYS A 9 ? ? -94.56 -60.53 31 5 VAL A 44 ? ? 78.84 123.35 32 5 LYS A 46 ? ? 53.87 74.05 33 5 ASP A 47 ? ? -152.59 -69.67 34 6 THR A 7 ? ? -69.28 81.02 35 6 VAL A 8 ? ? 66.98 -74.88 36 6 CYS A 9 ? ? 43.05 -122.68 37 6 ASP A 19 ? ? -151.87 63.94 38 6 CYS A 42 ? ? -142.67 -68.19 39 6 LYS A 46 ? ? -148.55 33.89 40 7 LYS A 2 ? ? 62.18 171.60 41 7 VAL A 8 ? ? -140.50 24.22 42 7 TYR A 11 ? ? 21.00 65.27 43 7 LEU A 41 ? ? 68.80 -62.31 44 8 LYS A 2 ? ? 54.64 173.38 45 8 VAL A 8 ? ? -148.57 16.20 46 8 ILE A 12 ? ? 71.32 128.06 47 8 LYS A 46 ? ? 62.38 -88.02 48 8 ASP A 47 ? ? 46.83 -72.48 49 9 LYS A 2 ? ? 64.04 167.82 50 9 THR A 7 ? ? 53.84 -94.41 51 9 TYR A 11 ? ? -134.88 -57.76 52 9 ILE A 12 ? ? 75.22 121.25 53 9 VAL A 44 ? ? -143.58 -73.23 54 9 ASP A 47 ? ? 30.09 -93.74 55 9 GLN A 48 ? ? -150.34 64.84 56 9 PHE A 49 ? ? -45.72 156.12 57 10 LYS A 2 ? ? 57.79 174.94 58 10 THR A 7 ? ? -76.40 -74.18 59 10 VAL A 44 ? ? -99.50 -71.20 60 10 ASP A 47 ? ? -163.54 -82.93 61 10 PHE A 49 ? ? 49.32 92.43 62 11 LYS A 2 ? ? 62.60 167.47 63 11 THR A 7 ? ? -25.84 -82.36 64 11 CYS A 9 ? ? -141.09 -78.09 65 11 LEU A 41 ? ? 70.19 43.54 66 11 LYS A 46 ? ? 58.57 78.32 67 11 ASP A 47 ? ? -153.81 -99.68 68 12 LYS A 2 ? ? 59.73 170.29 69 12 THR A 7 ? ? 65.64 -72.37 70 12 TYR A 11 ? ? 22.19 63.88 71 12 PRO A 40 ? ? -69.60 95.81 72 12 LEU A 41 ? ? 85.42 59.11 73 12 CYS A 42 ? ? -147.22 -94.67 74 12 ASP A 47 ? ? -138.85 -65.84 75 13 LYS A 2 ? ? 62.47 165.33 76 13 CYS A 6 ? ? -81.37 -121.01 77 13 THR A 7 ? ? -160.49 -46.08 78 13 VAL A 8 ? ? -104.65 -66.75 79 13 TYR A 11 ? ? -65.76 87.21 80 13 ASP A 47 ? ? 29.26 -94.42 81 13 PHE A 49 ? ? -47.73 156.26 82 14 LYS A 2 ? ? 66.09 162.34 83 14 THR A 7 ? ? -41.60 -76.18 84 14 VAL A 8 ? ? -99.70 48.50 85 14 CYS A 9 ? ? -160.95 -60.95 86 14 LYS A 46 ? ? 59.50 101.78 87 14 ASP A 47 ? ? -138.80 -75.73 88 14 GLN A 48 ? ? -144.69 55.34 89 15 THR A 7 ? ? -82.29 -99.26 90 15 GLN A 48 ? ? -171.92 -38.66 91 16 VAL A 8 ? ? -132.50 -60.54 92 16 CYS A 9 ? ? -95.92 -89.31 93 16 CYS A 42 ? ? -147.76 -57.61 94 16 GLN A 48 ? ? -179.37 -30.06 95 16 GLU A 53 ? ? -69.00 82.13 96 17 LYS A 2 ? ? 55.83 174.82 97 17 VAL A 8 ? ? -153.35 35.91 98 17 CYS A 9 ? ? -121.79 -65.25 99 17 CYS A 42 ? ? -125.65 -97.83 100 17 VAL A 44 ? ? 76.94 -173.20 101 17 ASP A 47 ? ? -159.45 -75.49 102 17 PHE A 49 ? ? 53.15 173.47 103 18 LYS A 2 ? ? 66.32 164.38 104 18 THR A 7 ? ? 76.14 -62.46 105 18 VAL A 8 ? ? -78.79 43.72 106 18 CYS A 9 ? ? 177.05 -102.49 107 18 ILE A 12 ? ? 79.84 110.73 108 18 LEU A 41 ? ? -150.80 51.50 109 18 CYS A 42 ? ? -142.84 -64.68 110 18 VAL A 44 ? ? 61.77 -83.65 111 18 GLN A 48 ? ? 36.93 47.02 112 19 LYS A 2 ? ? 62.09 165.76 113 19 VAL A 8 ? ? -160.98 -32.74 114 19 CYS A 42 ? ? -162.90 -66.79 115 20 ILE A 12 ? ? 69.64 113.01 116 20 ASP A 47 ? ? 69.59 -63.24 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 6 _pdbx_validate_peptide_omega.auth_comp_id_1 GLU _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 53 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 54 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 149.72 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 CA ? A MET 1 ? 'WRONG HAND' . 2 4 CA ? A MET 1 ? 'WRONG HAND' . 3 5 CA ? A MET 1 ? 'WRONG HAND' . 4 7 CA ? A MET 1 ? 'WRONG HAND' . 5 8 CA ? A MET 1 ? 'WRONG HAND' . 6 9 CA ? A MET 1 ? 'WRONG HAND' . 7 10 CA ? A MET 1 ? 'WRONG HAND' . 8 11 CA ? A MET 1 ? 'WRONG HAND' . 9 12 CA ? A MET 1 ? 'WRONG HAND' . 10 13 CA ? A MET 1 ? 'WRONG HAND' . 11 14 CA ? A MET 1 ? 'WRONG HAND' . 12 17 CA ? A MET 1 ? 'WRONG HAND' . 13 18 CA ? A MET 1 ? 'WRONG HAND' . 14 19 CA ? A MET 1 ? 'WRONG HAND' . # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 4 ? ? 0.085 'SIDE CHAIN' 2 1 TYR A 13 ? ? 0.077 'SIDE CHAIN' 3 2 TYR A 11 ? ? 0.103 'SIDE CHAIN' 4 2 TYR A 13 ? ? 0.073 'SIDE CHAIN' 5 3 TYR A 4 ? ? 0.076 'SIDE CHAIN' 6 3 TYR A 13 ? ? 0.072 'SIDE CHAIN' 7 4 TYR A 4 ? ? 0.094 'SIDE CHAIN' 8 4 TYR A 13 ? ? 0.084 'SIDE CHAIN' 9 5 TYR A 13 ? ? 0.078 'SIDE CHAIN' 10 6 TYR A 13 ? ? 0.077 'SIDE CHAIN' 11 7 TYR A 4 ? ? 0.118 'SIDE CHAIN' 12 7 TYR A 13 ? ? 0.076 'SIDE CHAIN' 13 10 TYR A 13 ? ? 0.085 'SIDE CHAIN' 14 11 TYR A 4 ? ? 0.089 'SIDE CHAIN' 15 12 TYR A 13 ? ? 0.090 'SIDE CHAIN' 16 12 PHE A 30 ? ? 0.087 'SIDE CHAIN' 17 13 TYR A 4 ? ? 0.115 'SIDE CHAIN' 18 14 TYR A 13 ? ? 0.070 'SIDE CHAIN' 19 16 TYR A 4 ? ? 0.105 'SIDE CHAIN' 20 16 TYR A 13 ? ? 0.083 'SIDE CHAIN' 21 16 PHE A 30 ? ? 0.078 'SIDE CHAIN' 22 17 TYR A 4 ? ? 0.110 'SIDE CHAIN' 23 17 TYR A 13 ? ? 0.081 'SIDE CHAIN' 24 18 TYR A 4 ? ? 0.099 'SIDE CHAIN' 25 18 TYR A 13 ? ? 0.088 'SIDE CHAIN' 26 19 TYR A 13 ? ? 0.074 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1BFY _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST TARGET FUNCTION' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents WATER # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure NORMAL _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '0.1 M' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 TOCSY 1 3 1 DQF-COSY 1 4 1 IR-NOESY 1 # _pdbx_nmr_details.entry_id 1BFY _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING 2D NMR SPECTROSCOPY.' # _pdbx_nmr_refine.entry_id 1BFY _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DYANA 1.4 GUNTERT,WUTHRICH 1 'structure solution' 'BRUKER XWINNMR' XWINNMR ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ASN N N N N 1 ASN CA C N S 2 ASN C C N N 3 ASN O O N N 4 ASN CB C N N 5 ASN CG C N N 6 ASN OD1 O N N 7 ASN ND2 N N N 8 ASN OXT O N N 9 ASN H H N N 10 ASN H2 H N N 11 ASN HA H N N 12 ASN HB2 H N N 13 ASN HB3 H N N 14 ASN HD21 H N N 15 ASN HD22 H N N 16 ASN HXT H N N 17 ASP N N N N 18 ASP CA C N S 19 ASP C C N N 20 ASP O O N N 21 ASP CB C N N 22 ASP CG C N N 23 ASP OD1 O N N 24 ASP OD2 O N N 25 ASP OXT O N N 26 ASP H H N N 27 ASP H2 H N N 28 ASP HA H N N 29 ASP HB2 H N N 30 ASP HB3 H N N 31 ASP HD2 H N N 32 ASP HXT H N N 33 CYS N N N N 34 CYS CA C N R 35 CYS C C N N 36 CYS O O N N 37 CYS CB C N N 38 CYS SG S N N 39 CYS OXT O N N 40 CYS H H N N 41 CYS H2 H N N 42 CYS HA H N N 43 CYS HB2 H N N 44 CYS HB3 H N N 45 CYS HG H N N 46 CYS HXT H N N 47 FE FE FE N N 48 GLN N N N N 49 GLN CA C N S 50 GLN C C N N 51 GLN O O N N 52 GLN CB C N N 53 GLN CG C N N 54 GLN CD C N N 55 GLN OE1 O N N 56 GLN NE2 N N N 57 GLN OXT O N N 58 GLN H H N N 59 GLN H2 H N N 60 GLN HA H N N 61 GLN HB2 H N N 62 GLN HB3 H N N 63 GLN HG2 H N N 64 GLN HG3 H N N 65 GLN HE21 H N N 66 GLN HE22 H N N 67 GLN HXT H N N 68 GLU N N N N 69 GLU CA C N S 70 GLU C C N N 71 GLU O O N N 72 GLU CB C N N 73 GLU CG C N N 74 GLU CD C N N 75 GLU OE1 O N N 76 GLU OE2 O N N 77 GLU OXT O N N 78 GLU H H N N 79 GLU H2 H N N 80 GLU HA H N N 81 GLU HB2 H N N 82 GLU HB3 H N N 83 GLU HG2 H N N 84 GLU HG3 H N N 85 GLU HE2 H N N 86 GLU HXT H N N 87 GLY N N N N 88 GLY CA C N N 89 GLY C C N N 90 GLY O O N N 91 GLY OXT O N N 92 GLY H H N N 93 GLY H2 H N N 94 GLY HA2 H N N 95 GLY HA3 H N N 96 GLY HXT H N N 97 ILE N N N N 98 ILE CA C N S 99 ILE C C N N 100 ILE O O N N 101 ILE CB C N S 102 ILE CG1 C N N 103 ILE CG2 C N N 104 ILE CD1 C N N 105 ILE OXT O N N 106 ILE H H N N 107 ILE H2 H N N 108 ILE HA H N N 109 ILE HB H N N 110 ILE HG12 H N N 111 ILE HG13 H N N 112 ILE HG21 H N N 113 ILE HG22 H N N 114 ILE HG23 H N N 115 ILE HD11 H N N 116 ILE HD12 H N N 117 ILE HD13 H N N 118 ILE HXT H N N 119 LEU N N N N 120 LEU CA C N S 121 LEU C C N N 122 LEU O O N N 123 LEU CB C N N 124 LEU CG C N N 125 LEU CD1 C N N 126 LEU CD2 C N N 127 LEU OXT O N N 128 LEU H H N N 129 LEU H2 H N N 130 LEU HA H N N 131 LEU HB2 H N N 132 LEU HB3 H N N 133 LEU HG H N N 134 LEU HD11 H N N 135 LEU HD12 H N N 136 LEU HD13 H N N 137 LEU HD21 H N N 138 LEU HD22 H N N 139 LEU HD23 H N N 140 LEU HXT H N N 141 LYS N N N N 142 LYS CA C N S 143 LYS C C N N 144 LYS O O N N 145 LYS CB C N N 146 LYS CG C N N 147 LYS CD C N N 148 LYS CE C N N 149 LYS NZ N N N 150 LYS OXT O N N 151 LYS H H N N 152 LYS H2 H N N 153 LYS HA H N N 154 LYS HB2 H N N 155 LYS HB3 H N N 156 LYS HG2 H N N 157 LYS HG3 H N N 158 LYS HD2 H N N 159 LYS HD3 H N N 160 LYS HE2 H N N 161 LYS HE3 H N N 162 LYS HZ1 H N N 163 LYS HZ2 H N N 164 LYS HZ3 H N N 165 LYS HXT H N N 166 MET N N N N 167 MET CA C N S 168 MET C C N N 169 MET O O N N 170 MET CB C N N 171 MET CG C N N 172 MET SD S N N 173 MET CE C N N 174 MET OXT O N N 175 MET H H N N 176 MET H2 H N N 177 MET HA H N N 178 MET HB2 H N N 179 MET HB3 H N N 180 MET HG2 H N N 181 MET HG3 H N N 182 MET HE1 H N N 183 MET HE2 H N N 184 MET HE3 H N N 185 MET HXT H N N 186 PHE N N N N 187 PHE CA C N S 188 PHE C C N N 189 PHE O O N N 190 PHE CB C N N 191 PHE CG C Y N 192 PHE CD1 C Y N 193 PHE CD2 C Y N 194 PHE CE1 C Y N 195 PHE CE2 C Y N 196 PHE CZ C Y N 197 PHE OXT O N N 198 PHE H H N N 199 PHE H2 H N N 200 PHE HA H N N 201 PHE HB2 H N N 202 PHE HB3 H N N 203 PHE HD1 H N N 204 PHE HD2 H N N 205 PHE HE1 H N N 206 PHE HE2 H N N 207 PHE HZ H N N 208 PHE HXT H N N 209 PRO N N N N 210 PRO CA C N S 211 PRO C C N N 212 PRO O O N N 213 PRO CB C N N 214 PRO CG C N N 215 PRO CD C N N 216 PRO OXT O N N 217 PRO H H N N 218 PRO HA H N N 219 PRO HB2 H N N 220 PRO HB3 H N N 221 PRO HG2 H N N 222 PRO HG3 H N N 223 PRO HD2 H N N 224 PRO HD3 H N N 225 PRO HXT H N N 226 THR N N N N 227 THR CA C N S 228 THR C C N N 229 THR O O N N 230 THR CB C N R 231 THR OG1 O N N 232 THR CG2 C N N 233 THR OXT O N N 234 THR H H N N 235 THR H2 H N N 236 THR HA H N N 237 THR HB H N N 238 THR HG1 H N N 239 THR HG21 H N N 240 THR HG22 H N N 241 THR HG23 H N N 242 THR HXT H N N 243 TRP N N N N 244 TRP CA C N S 245 TRP C C N N 246 TRP O O N N 247 TRP CB C N N 248 TRP CG C Y N 249 TRP CD1 C Y N 250 TRP CD2 C Y N 251 TRP NE1 N Y N 252 TRP CE2 C Y N 253 TRP CE3 C Y N 254 TRP CZ2 C Y N 255 TRP CZ3 C Y N 256 TRP CH2 C Y N 257 TRP OXT O N N 258 TRP H H N N 259 TRP H2 H N N 260 TRP HA H N N 261 TRP HB2 H N N 262 TRP HB3 H N N 263 TRP HD1 H N N 264 TRP HE1 H N N 265 TRP HE3 H N N 266 TRP HZ2 H N N 267 TRP HZ3 H N N 268 TRP HH2 H N N 269 TRP HXT H N N 270 TYR N N N N 271 TYR CA C N S 272 TYR C C N N 273 TYR O O N N 274 TYR CB C N N 275 TYR CG C Y N 276 TYR CD1 C Y N 277 TYR CD2 C Y N 278 TYR CE1 C Y N 279 TYR CE2 C Y N 280 TYR CZ C Y N 281 TYR OH O N N 282 TYR OXT O N N 283 TYR H H N N 284 TYR H2 H N N 285 TYR HA H N N 286 TYR HB2 H N N 287 TYR HB3 H N N 288 TYR HD1 H N N 289 TYR HD2 H N N 290 TYR HE1 H N N 291 TYR HE2 H N N 292 TYR HH H N N 293 TYR HXT H N N 294 VAL N N N N 295 VAL CA C N S 296 VAL C C N N 297 VAL O O N N 298 VAL CB C N N 299 VAL CG1 C N N 300 VAL CG2 C N N 301 VAL OXT O N N 302 VAL H H N N 303 VAL H2 H N N 304 VAL HA H N N 305 VAL HB H N N 306 VAL HG11 H N N 307 VAL HG12 H N N 308 VAL HG13 H N N 309 VAL HG21 H N N 310 VAL HG22 H N N 311 VAL HG23 H N N 312 VAL HXT H N N 313 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ASN N CA sing N N 1 ASN N H sing N N 2 ASN N H2 sing N N 3 ASN CA C sing N N 4 ASN CA CB sing N N 5 ASN CA HA sing N N 6 ASN C O doub N N 7 ASN C OXT sing N N 8 ASN CB CG sing N N 9 ASN CB HB2 sing N N 10 ASN CB HB3 sing N N 11 ASN CG OD1 doub N N 12 ASN CG ND2 sing N N 13 ASN ND2 HD21 sing N N 14 ASN ND2 HD22 sing N N 15 ASN OXT HXT sing N N 16 ASP N CA sing N N 17 ASP N H sing N N 18 ASP N H2 sing N N 19 ASP CA C sing N N 20 ASP CA CB sing N N 21 ASP CA HA sing N N 22 ASP C O doub N N 23 ASP C OXT sing N N 24 ASP CB CG sing N N 25 ASP CB HB2 sing N N 26 ASP CB HB3 sing N N 27 ASP CG OD1 doub N N 28 ASP CG OD2 sing N N 29 ASP OD2 HD2 sing N N 30 ASP OXT HXT sing N N 31 CYS N CA sing N N 32 CYS N H sing N N 33 CYS N H2 sing N N 34 CYS CA C sing N N 35 CYS CA CB sing N N 36 CYS CA HA sing N N 37 CYS C O doub N N 38 CYS C OXT sing N N 39 CYS CB SG sing N N 40 CYS CB HB2 sing N N 41 CYS CB HB3 sing N N 42 CYS SG HG sing N N 43 CYS OXT HXT sing N N 44 GLN N CA sing N N 45 GLN N H sing N N 46 GLN N H2 sing N N 47 GLN CA C sing N N 48 GLN CA CB sing N N 49 GLN CA HA sing N N 50 GLN C O doub N N 51 GLN C OXT sing N N 52 GLN CB CG sing N N 53 GLN CB HB2 sing N N 54 GLN CB HB3 sing N N 55 GLN CG CD sing N N 56 GLN CG HG2 sing N N 57 GLN CG HG3 sing N N 58 GLN CD OE1 doub N N 59 GLN CD NE2 sing N N 60 GLN NE2 HE21 sing N N 61 GLN NE2 HE22 sing N N 62 GLN OXT HXT sing N N 63 GLU N CA sing N N 64 GLU N H sing N N 65 GLU N H2 sing N N 66 GLU CA C sing N N 67 GLU CA CB sing N N 68 GLU CA HA sing N N 69 GLU C O doub N N 70 GLU C OXT sing N N 71 GLU CB CG sing N N 72 GLU CB HB2 sing N N 73 GLU CB HB3 sing N N 74 GLU CG CD sing N N 75 GLU CG HG2 sing N N 76 GLU CG HG3 sing N N 77 GLU CD OE1 doub N N 78 GLU CD OE2 sing N N 79 GLU OE2 HE2 sing N N 80 GLU OXT HXT sing N N 81 GLY N CA sing N N 82 GLY N H sing N N 83 GLY N H2 sing N N 84 GLY CA C sing N N 85 GLY CA HA2 sing N N 86 GLY CA HA3 sing N N 87 GLY C O doub N N 88 GLY C OXT sing N N 89 GLY OXT HXT sing N N 90 ILE N CA sing N N 91 ILE N H sing N N 92 ILE N H2 sing N N 93 ILE CA C sing N N 94 ILE CA CB sing N N 95 ILE CA HA sing N N 96 ILE C O doub N N 97 ILE C OXT sing N N 98 ILE CB CG1 sing N N 99 ILE CB CG2 sing N N 100 ILE CB HB sing N N 101 ILE CG1 CD1 sing N N 102 ILE CG1 HG12 sing N N 103 ILE CG1 HG13 sing N N 104 ILE CG2 HG21 sing N N 105 ILE CG2 HG22 sing N N 106 ILE CG2 HG23 sing N N 107 ILE CD1 HD11 sing N N 108 ILE CD1 HD12 sing N N 109 ILE CD1 HD13 sing N N 110 ILE OXT HXT sing N N 111 LEU N CA sing N N 112 LEU N H sing N N 113 LEU N H2 sing N N 114 LEU CA C sing N N 115 LEU CA CB sing N N 116 LEU CA HA sing N N 117 LEU C O doub N N 118 LEU C OXT sing N N 119 LEU CB CG sing N N 120 LEU CB HB2 sing N N 121 LEU CB HB3 sing N N 122 LEU CG CD1 sing N N 123 LEU CG CD2 sing N N 124 LEU CG HG sing N N 125 LEU CD1 HD11 sing N N 126 LEU CD1 HD12 sing N N 127 LEU CD1 HD13 sing N N 128 LEU CD2 HD21 sing N N 129 LEU CD2 HD22 sing N N 130 LEU CD2 HD23 sing N N 131 LEU OXT HXT sing N N 132 LYS N CA sing N N 133 LYS N H sing N N 134 LYS N H2 sing N N 135 LYS CA C sing N N 136 LYS CA CB sing N N 137 LYS CA HA sing N N 138 LYS C O doub N N 139 LYS C OXT sing N N 140 LYS CB CG sing N N 141 LYS CB HB2 sing N N 142 LYS CB HB3 sing N N 143 LYS CG CD sing N N 144 LYS CG HG2 sing N N 145 LYS CG HG3 sing N N 146 LYS CD CE sing N N 147 LYS CD HD2 sing N N 148 LYS CD HD3 sing N N 149 LYS CE NZ sing N N 150 LYS CE HE2 sing N N 151 LYS CE HE3 sing N N 152 LYS NZ HZ1 sing N N 153 LYS NZ HZ2 sing N N 154 LYS NZ HZ3 sing N N 155 LYS OXT HXT sing N N 156 MET N CA sing N N 157 MET N H sing N N 158 MET N H2 sing N N 159 MET CA C sing N N 160 MET CA CB sing N N 161 MET CA HA sing N N 162 MET C O doub N N 163 MET C OXT sing N N 164 MET CB CG sing N N 165 MET CB HB2 sing N N 166 MET CB HB3 sing N N 167 MET CG SD sing N N 168 MET CG HG2 sing N N 169 MET CG HG3 sing N N 170 MET SD CE sing N N 171 MET CE HE1 sing N N 172 MET CE HE2 sing N N 173 MET CE HE3 sing N N 174 MET OXT HXT sing N N 175 PHE N CA sing N N 176 PHE N H sing N N 177 PHE N H2 sing N N 178 PHE CA C sing N N 179 PHE CA CB sing N N 180 PHE CA HA sing N N 181 PHE C O doub N N 182 PHE C OXT sing N N 183 PHE CB CG sing N N 184 PHE CB HB2 sing N N 185 PHE CB HB3 sing N N 186 PHE CG CD1 doub Y N 187 PHE CG CD2 sing Y N 188 PHE CD1 CE1 sing Y N 189 PHE CD1 HD1 sing N N 190 PHE CD2 CE2 doub Y N 191 PHE CD2 HD2 sing N N 192 PHE CE1 CZ doub Y N 193 PHE CE1 HE1 sing N N 194 PHE CE2 CZ sing Y N 195 PHE CE2 HE2 sing N N 196 PHE CZ HZ sing N N 197 PHE OXT HXT sing N N 198 PRO N CA sing N N 199 PRO N CD sing N N 200 PRO N H sing N N 201 PRO CA C sing N N 202 PRO CA CB sing N N 203 PRO CA HA sing N N 204 PRO C O doub N N 205 PRO C OXT sing N N 206 PRO CB CG sing N N 207 PRO CB HB2 sing N N 208 PRO CB HB3 sing N N 209 PRO CG CD sing N N 210 PRO CG HG2 sing N N 211 PRO CG HG3 sing N N 212 PRO CD HD2 sing N N 213 PRO CD HD3 sing N N 214 PRO OXT HXT sing N N 215 THR N CA sing N N 216 THR N H sing N N 217 THR N H2 sing N N 218 THR CA C sing N N 219 THR CA CB sing N N 220 THR CA HA sing N N 221 THR C O doub N N 222 THR C OXT sing N N 223 THR CB OG1 sing N N 224 THR CB CG2 sing N N 225 THR CB HB sing N N 226 THR OG1 HG1 sing N N 227 THR CG2 HG21 sing N N 228 THR CG2 HG22 sing N N 229 THR CG2 HG23 sing N N 230 THR OXT HXT sing N N 231 TRP N CA sing N N 232 TRP N H sing N N 233 TRP N H2 sing N N 234 TRP CA C sing N N 235 TRP CA CB sing N N 236 TRP CA HA sing N N 237 TRP C O doub N N 238 TRP C OXT sing N N 239 TRP CB CG sing N N 240 TRP CB HB2 sing N N 241 TRP CB HB3 sing N N 242 TRP CG CD1 doub Y N 243 TRP CG CD2 sing Y N 244 TRP CD1 NE1 sing Y N 245 TRP CD1 HD1 sing N N 246 TRP CD2 CE2 doub Y N 247 TRP CD2 CE3 sing Y N 248 TRP NE1 CE2 sing Y N 249 TRP NE1 HE1 sing N N 250 TRP CE2 CZ2 sing Y N 251 TRP CE3 CZ3 doub Y N 252 TRP CE3 HE3 sing N N 253 TRP CZ2 CH2 doub Y N 254 TRP CZ2 HZ2 sing N N 255 TRP CZ3 CH2 sing Y N 256 TRP CZ3 HZ3 sing N N 257 TRP CH2 HH2 sing N N 258 TRP OXT HXT sing N N 259 TYR N CA sing N N 260 TYR N H sing N N 261 TYR N H2 sing N N 262 TYR CA C sing N N 263 TYR CA CB sing N N 264 TYR CA HA sing N N 265 TYR C O doub N N 266 TYR C OXT sing N N 267 TYR CB CG sing N N 268 TYR CB HB2 sing N N 269 TYR CB HB3 sing N N 270 TYR CG CD1 doub Y N 271 TYR CG CD2 sing Y N 272 TYR CD1 CE1 sing Y N 273 TYR CD1 HD1 sing N N 274 TYR CD2 CE2 doub Y N 275 TYR CD2 HD2 sing N N 276 TYR CE1 CZ doub Y N 277 TYR CE1 HE1 sing N N 278 TYR CE2 CZ sing Y N 279 TYR CE2 HE2 sing N N 280 TYR CZ OH sing N N 281 TYR OH HH sing N N 282 TYR OXT HXT sing N N 283 VAL N CA sing N N 284 VAL N H sing N N 285 VAL N H2 sing N N 286 VAL CA C sing N N 287 VAL CA CB sing N N 288 VAL CA HA sing N N 289 VAL C O doub N N 290 VAL C OXT sing N N 291 VAL CB CG1 sing N N 292 VAL CB CG2 sing N N 293 VAL CB HB sing N N 294 VAL CG1 HG11 sing N N 295 VAL CG1 HG12 sing N N 296 VAL CG1 HG13 sing N N 297 VAL CG2 HG21 sing N N 298 VAL CG2 HG22 sing N N 299 VAL CG2 HG23 sing N N 300 VAL OXT HXT sing N N 301 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength 1 AVANCE800 Bruker 800 2 AMX600 Bruker 600 # _atom_sites.entry_id 1BFY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_