data_1BKT # _entry.id 1BKT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BKT pdb_00001bkt 10.2210/pdb1bkt/pdb WWPDB D_1000171871 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BKT _pdbx_database_status.recvd_initial_deposition_date 1998-07-03 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Renisio, J.G.' 1 'Romi-Lebrun, R.' 2 'Blanc, E.' 3 'Bornet, O.' 4 'Nakajima, T.' 5 'Darbon, H.' 6 # _citation.id primary _citation.title 'Solution structure of BmKTX, a K+ blocker toxin from the Chinese scorpion Buthus Martensi' _citation.journal_abbrev Proteins _citation.journal_volume 38 _citation.page_first 70 _citation.page_last 78 _citation.year 2000 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10651040 _citation.pdbx_database_id_DOI '10.1002/(SICI)1097-0134(20000101)38:1<70::AID-PROT8>3.0.CO;2-5' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Renisio, J.G.' 1 ? primary 'Romi-Lebrun, R.' 2 ? primary 'Blanc, E.' 3 ? primary 'Bornet, O.' 4 ? primary 'Nakajima, T.' 5 ? primary 'Darbon, H.' 6 ? # _cell.entry_id 1BKT _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BKT _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description BMKTX _entity.formula_weight 3975.841 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'VGINVKCKHSGQCLKPCKDAGMRFGKCINGKCDCTPK(NH2)' _entity_poly.pdbx_seq_one_letter_code_can VGINVKCKHSGQCLKPCKDAGMRFGKCINGKCDCTPKX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 GLY n 1 3 ILE n 1 4 ASN n 1 5 VAL n 1 6 LYS n 1 7 CYS n 1 8 LYS n 1 9 HIS n 1 10 SER n 1 11 GLY n 1 12 GLN n 1 13 CYS n 1 14 LEU n 1 15 LYS n 1 16 PRO n 1 17 CYS n 1 18 LYS n 1 19 ASP n 1 20 ALA n 1 21 GLY n 1 22 MET n 1 23 ARG n 1 24 PHE n 1 25 GLY n 1 26 LYS n 1 27 CYS n 1 28 ILE n 1 29 ASN n 1 30 GLY n 1 31 LYS n 1 32 CYS n 1 33 ASP n 1 34 CYS n 1 35 THR n 1 36 PRO n 1 37 LYS n 1 38 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Chinese scorpion' _entity_src_gen.gene_src_genus Mesobuthus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain KARSCH _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mesobuthus martensii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 34649 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCKT_MESMA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q9NII7 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code MKVFFAVLITLFICSMIIGIHGVGINVKCKHSGQCLKPCKDAGMRFGKCINGKCDCTPKG _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BKT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 37 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NII7 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 59 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 37 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 TOCSY 1 3 1 COSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 3 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents WATER # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX500 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1BKT _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details '15,000 ITERATIONS OF THE POWELL ALGORITHM WITH CHARMM FORCE FIELD' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1BKT _pdbx_nmr_details.text 'MODEL 1 WAS DETERMINED BY 2D PROTON NMR' # _pdbx_nmr_ensemble.entry_id 1BKT _pdbx_nmr_ensemble.conformers_calculated_total_number 25 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # _pdbx_nmr_representative.entry_id 1BKT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.84 BRUNGER 1 'structure solution' DIANA ? ? 2 'structure solution' DYANA ? ? 3 # _exptl.entry_id 1BKT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1BKT _struct.title 'BMKTX TOXIN FROM SCORPION BUTHUS MARTENSII KARSCH, NMR, 25 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BKT _struct_keywords.pdbx_keywords NEUROTOXIN _struct_keywords.text 'SCORPION, NEUROTOXIN, LARGE CONDUCTANCE POTASSIUM CHANNEL, VOLTAGE GATED POTASSIUM CHANNEL, BUTHUS MARTENSII' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 14 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 20 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 14 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 20 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 7 A CYS 27 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 13 A CYS 32 1_555 ? ? ? ? ? ? ? 2.015 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 17 A CYS 34 1_555 ? ? ? ? ? ? ? 2.019 ? ? covale1 covale both ? A LYS 37 C ? ? ? 1_555 A NH2 38 N ? ? A LYS 37 A NH2 38 1_555 ? ? ? ? ? ? ? 1.305 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 25 ? CYS A 27 ? GLY A 25 CYS A 27 A 2 CYS A 32 ? CYS A 34 ? CYS A 32 CYS A 34 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 26 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 26 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id ASP _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 33 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASP _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 33 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 38 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 38' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 PRO A 36 ? PRO A 36 . ? 1_555 ? 2 AC1 2 LYS A 37 ? LYS A 37 . ? 1_555 ? # _database_PDB_matrix.entry_id 1BKT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1BKT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 NH2 38 38 38 NH2 NH2 A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-01-13 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 6 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 7 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 10 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 15 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 16 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 17 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.84 ? 1 X-PLOR refinement 3.84 ? 2 X-PLOR phasing 3.84 ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 H A GLY 2 ? ? H A CYS 34 ? ? 1.33 2 6 H A GLY 2 ? ? H A CYS 34 ? ? 1.35 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 20 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 32 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 32 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 SG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 32 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 120.83 _pdbx_validate_rmsd_angle.angle_target_value 114.20 _pdbx_validate_rmsd_angle.angle_deviation 6.63 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.10 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 3 ? ? -115.06 -103.83 2 1 ASN A 4 ? ? -173.26 38.63 3 1 MET A 22 ? ? -127.24 -165.74 4 1 ILE A 28 ? ? -112.17 -80.78 5 2 ILE A 3 ? ? -121.61 -106.24 6 2 ASN A 4 ? ? -176.01 37.15 7 2 MET A 22 ? ? -126.41 -163.48 8 2 ILE A 28 ? ? -112.54 -80.09 9 2 THR A 35 ? ? -118.72 64.42 10 2 PRO A 36 ? ? -59.18 176.79 11 3 ILE A 3 ? ? -116.35 -107.62 12 3 ASN A 4 ? ? -176.45 40.51 13 3 MET A 22 ? ? -127.51 -165.83 14 3 ILE A 28 ? ? -112.82 -78.82 15 4 ILE A 3 ? ? -113.99 -104.57 16 4 ASN A 4 ? ? -174.48 34.52 17 4 MET A 22 ? ? -127.13 -162.36 18 4 ILE A 28 ? ? -115.21 -79.27 19 5 ILE A 3 ? ? -121.58 -107.95 20 5 ASN A 4 ? ? -175.63 38.29 21 5 SER A 10 ? ? -89.44 34.61 22 5 MET A 22 ? ? -128.44 -163.02 23 5 ILE A 28 ? ? -112.24 -73.86 24 6 ILE A 3 ? ? -121.32 -107.00 25 6 ASN A 4 ? ? -175.71 38.47 26 6 MET A 22 ? ? -125.98 -164.34 27 6 ILE A 28 ? ? -112.08 -74.15 28 7 ILE A 3 ? ? -122.48 -107.61 29 7 ASN A 4 ? ? -176.65 37.50 30 7 MET A 22 ? ? -128.27 -164.01 31 7 ILE A 28 ? ? -114.55 -82.54 32 8 ILE A 3 ? ? -114.27 -105.56 33 8 ASN A 4 ? ? -175.22 34.92 34 8 MET A 22 ? ? -127.32 -164.81 35 8 ILE A 28 ? ? -113.26 -81.18 36 9 ILE A 3 ? ? -124.26 -106.79 37 9 ASN A 4 ? ? -176.69 36.49 38 9 MET A 22 ? ? -127.62 -166.01 39 9 ILE A 28 ? ? -115.27 -79.19 40 10 ILE A 3 ? ? -111.69 -105.07 41 10 ASN A 4 ? ? -173.18 35.75 42 10 MET A 22 ? ? -128.49 -163.51 43 10 ILE A 28 ? ? -114.33 -77.45 44 11 ILE A 3 ? ? -114.71 -106.02 45 11 ASN A 4 ? ? -174.38 36.63 46 11 MET A 22 ? ? -124.44 -164.71 47 11 ILE A 28 ? ? -112.28 -78.12 48 12 ILE A 3 ? ? -113.62 -104.67 49 12 ASN A 4 ? ? -175.30 35.60 50 12 MET A 22 ? ? -124.49 -163.74 51 12 ILE A 28 ? ? -115.12 -78.49 52 13 ILE A 3 ? ? -121.24 -105.23 53 13 ASN A 4 ? ? -175.70 36.60 54 13 MET A 22 ? ? -123.82 -165.74 55 13 ILE A 28 ? ? -112.59 -78.80 56 14 ILE A 3 ? ? -113.81 -105.35 57 14 ASN A 4 ? ? -174.67 36.49 58 14 MET A 22 ? ? -126.73 -165.24 59 14 ILE A 28 ? ? -116.12 -79.18 60 15 ILE A 3 ? ? -113.81 -104.68 61 15 ASN A 4 ? ? -174.67 34.80 62 15 MET A 22 ? ? -124.25 -165.44 63 15 ILE A 28 ? ? -109.72 -83.18 64 16 ILE A 3 ? ? -110.30 -104.46 65 16 ASN A 4 ? ? -173.91 35.29 66 16 SER A 10 ? ? -91.26 35.22 67 16 MET A 22 ? ? -127.15 -165.50 68 16 ILE A 28 ? ? -115.11 -78.82 69 17 ILE A 3 ? ? -122.54 -106.76 70 17 ASN A 4 ? ? -177.24 34.60 71 17 MET A 22 ? ? -124.85 -166.57 72 17 ILE A 28 ? ? -114.96 -81.08 73 18 ILE A 3 ? ? -122.50 -107.67 74 18 ASN A 4 ? ? -175.63 35.82 75 18 SER A 10 ? ? -94.67 34.14 76 18 MET A 22 ? ? -128.57 -167.32 77 18 ILE A 28 ? ? -115.22 -77.65 78 18 PRO A 36 ? ? -57.50 174.80 79 19 ILE A 3 ? ? -114.25 -103.80 80 19 ASN A 4 ? ? -173.81 31.39 81 19 MET A 22 ? ? -128.22 -164.04 82 19 ILE A 28 ? ? -114.68 -81.93 83 20 ILE A 3 ? ? -111.62 -105.43 84 20 ASN A 4 ? ? -173.80 36.81 85 20 MET A 22 ? ? -125.15 -164.27 86 20 ILE A 28 ? ? -116.91 -78.86 87 21 ILE A 3 ? ? -111.82 -104.95 88 21 ASN A 4 ? ? -176.01 33.76 89 21 MET A 22 ? ? -125.64 -164.85 90 21 ILE A 28 ? ? -118.08 -78.74 91 22 ILE A 3 ? ? -112.06 -104.15 92 22 ASN A 4 ? ? -173.01 33.40 93 22 SER A 10 ? ? -88.59 35.54 94 22 MET A 22 ? ? -125.15 -165.71 95 22 ILE A 28 ? ? -114.60 -82.95 96 22 THR A 35 ? ? -116.76 66.28 97 23 ILE A 3 ? ? -110.47 -104.65 98 23 ASN A 4 ? ? -173.95 33.79 99 23 SER A 10 ? ? -89.50 34.16 100 23 MET A 22 ? ? -124.82 -165.95 101 23 ILE A 28 ? ? -117.13 -78.45 102 24 ILE A 3 ? ? -114.55 -105.33 103 24 ASN A 4 ? ? -175.15 33.58 104 24 MET A 22 ? ? -124.18 -165.62 105 24 ILE A 28 ? ? -109.63 -85.59 106 25 ILE A 3 ? ? -120.92 -106.63 107 25 ASN A 4 ? ? -175.76 35.43 108 25 SER A 10 ? ? -85.46 34.52 109 25 MET A 22 ? ? -126.14 -164.56 110 25 ILE A 28 ? ? -116.45 -79.27 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 23 ? ? 0.116 'SIDE CHAIN' 2 2 ARG A 23 ? ? 0.293 'SIDE CHAIN' 3 3 ARG A 23 ? ? 0.093 'SIDE CHAIN' 4 4 ARG A 23 ? ? 0.098 'SIDE CHAIN' 5 5 ARG A 23 ? ? 0.286 'SIDE CHAIN' 6 6 ARG A 23 ? ? 0.130 'SIDE CHAIN' 7 8 ARG A 23 ? ? 0.120 'SIDE CHAIN' 8 9 ARG A 23 ? ? 0.125 'SIDE CHAIN' 9 10 ARG A 23 ? ? 0.136 'SIDE CHAIN' 10 11 ARG A 23 ? ? 0.140 'SIDE CHAIN' 11 12 ARG A 23 ? ? 0.104 'SIDE CHAIN' 12 13 ARG A 23 ? ? 0.140 'SIDE CHAIN' 13 15 ARG A 23 ? ? 0.140 'SIDE CHAIN' 14 16 ARG A 23 ? ? 0.088 'SIDE CHAIN' 15 17 ARG A 23 ? ? 0.105 'SIDE CHAIN' 16 18 ARG A 23 ? ? 0.149 'SIDE CHAIN' 17 19 ARG A 23 ? ? 0.113 'SIDE CHAIN' 18 20 ARG A 23 ? ? 0.094 'SIDE CHAIN' 19 21 ARG A 23 ? ? 0.116 'SIDE CHAIN' 20 22 ARG A 23 ? ? 0.174 'SIDE CHAIN' 21 23 ARG A 23 ? ? 0.117 'SIDE CHAIN' 22 24 ARG A 23 ? ? 0.141 'SIDE CHAIN' 23 25 ARG A 23 ? ? 0.110 'SIDE CHAIN' #