data_1BKU # _entry.id 1BKU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1BKU pdb_00001bku 10.2210/pdb1bku/pdb WWPDB D_1000171872 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-01-13 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' pdbx_entry_details 11 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 17 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 18 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1BKU _pdbx_database_status.recvd_initial_deposition_date 1998-07-13 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hashimoto, Y.' 1 'Nishikido, J.' 2 'Toma, K.' 3 'Yamamoto, K.' 4 'Haneda, K.' 5 'Inazu, T.' 6 'Valentine, K.' 7 'Opella, S.J.' 8 # _citation.id primary _citation.title ;Effects of glycosylation on the structure and dynamics of eel calcitonin in micelles and lipid bilayers determined by nuclear magnetic resonance spectroscopy. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 38 _citation.page_first 8377 _citation.page_last 8384 _citation.year 1999 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10387083 _citation.pdbx_database_id_DOI 10.1021/bi983018j # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hashimoto, Y.' 1 ? primary 'Toma, K.' 2 ? primary 'Nishikido, J.' 3 ? primary 'Yamamoto, K.' 4 ? primary 'Haneda, K.' 5 ? primary 'Inazu, T.' 6 ? primary 'Valentine, K.G.' 7 ? primary 'Opella, S.J.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description CALCITONIN _entity.formula_weight 3419.906 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP(NH2)' _entity_poly.pdbx_seq_one_letter_code_can CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTPX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 SER n 1 3 ASN n 1 4 LEU n 1 5 SER n 1 6 THR n 1 7 CYS n 1 8 VAL n 1 9 LEU n 1 10 GLY n 1 11 LYS n 1 12 LEU n 1 13 SER n 1 14 GLN n 1 15 GLU n 1 16 LEU n 1 17 HIS n 1 18 LYS n 1 19 LEU n 1 20 GLN n 1 21 THR n 1 22 TYR n 1 23 PRO n 1 24 ARG n 1 25 THR n 1 26 ASP n 1 27 VAL n 1 28 GLY n 1 29 ALA n 1 30 GLY n 1 31 THR n 1 32 PRO n 1 33 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Japanese eel' _entity_src_gen.gene_src_genus Anguilla _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Anguilla japonica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7937 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 NH2 33 33 33 NH2 NH2 A . n # _cell.entry_id 1BKU _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1BKU _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1BKU _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1BKU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1BKU _struct.title 'EFFECTS OF GLYCOSYLATION ON THE STRUCTURE AND DYNAMICS OF EEL CALCITONIN, NMR, 10 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1BKU _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'HORMONE, CALCIUM-REGULATING HORMONE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CALC_ANGJA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P01262 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1BKU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01262 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 32 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 32 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 5 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 19 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 5 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 19 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 7 SG ? ? A CYS 1 A CYS 7 1_555 ? ? ? ? ? ? ? 2.040 ? ? covale1 covale both ? A PRO 32 C ? ? ? 1_555 A NH2 33 N ? ? A PRO 32 A NH2 33 1_555 ? ? ? ? ? ? ? 1.336 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NH2 A 33 ? PRO A 32 ? NH2 A 33 ? 1_555 PRO A 32 ? 1_555 . . PRO 13 NH2 None 'Terminal amidation' 2 CYS A 1 ? CYS A 7 ? CYS A 1 ? 1_555 CYS A 7 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 33 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 1 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 33' # _struct_site_gen.id 1 _struct_site_gen.site_id AC1 _struct_site_gen.pdbx_num_res 1 _struct_site_gen.label_comp_id PRO _struct_site_gen.label_asym_id A _struct_site_gen.label_seq_id 32 _struct_site_gen.pdbx_auth_ins_code ? _struct_site_gen.auth_comp_id PRO _struct_site_gen.auth_asym_id A _struct_site_gen.auth_seq_id 32 _struct_site_gen.label_atom_id . _struct_site_gen.label_alt_id ? _struct_site_gen.symmetry 1_555 _struct_site_gen.details ? # _pdbx_entry_details.entry_id 1BKU _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 3 ? ? -141.21 -61.30 2 1 LEU A 4 ? ? -155.84 -39.75 3 1 GLN A 20 ? ? 52.94 -71.84 4 1 TYR A 22 ? ? 56.33 71.66 5 1 THR A 25 ? ? 76.18 136.07 6 2 SER A 2 ? ? 57.91 -96.04 7 2 SER A 5 ? ? -145.99 -64.45 8 2 THR A 25 ? ? 50.70 -104.48 9 2 THR A 31 ? ? 55.34 74.50 10 3 SER A 5 ? ? -148.01 -61.19 11 3 GLN A 20 ? ? -95.79 -60.76 12 3 TYR A 22 ? ? 55.89 75.74 13 3 THR A 25 ? ? -139.89 -75.83 14 3 ASP A 26 ? ? -153.49 46.74 15 4 SER A 2 ? ? 69.66 -70.36 16 4 LEU A 4 ? ? -86.27 -132.58 17 4 SER A 5 ? ? 55.02 -92.32 18 4 ARG A 24 ? ? 63.15 -90.76 19 4 ALA A 29 ? ? 61.22 -85.66 20 5 SER A 5 ? ? -147.72 -59.13 21 5 LEU A 19 ? ? -77.66 -111.12 22 5 GLN A 20 ? ? 72.21 -69.59 23 5 TYR A 22 ? ? -163.87 -43.17 24 5 PRO A 23 ? ? -59.36 103.30 25 5 ARG A 24 ? ? -170.86 -166.25 26 5 ASP A 26 ? ? 67.98 66.84 27 5 VAL A 27 ? ? -80.75 -74.75 28 6 SER A 5 ? ? -159.55 -64.49 29 6 THR A 21 ? ? -89.30 45.45 30 6 PRO A 23 ? ? -58.16 96.58 31 6 ARG A 24 ? ? -142.51 -68.79 32 6 ASP A 26 ? ? 72.42 150.17 33 7 SER A 2 ? ? 60.39 -90.46 34 7 SER A 5 ? ? -152.16 -60.46 35 7 LEU A 19 ? ? -68.20 -77.08 36 7 GLN A 20 ? ? 62.78 -81.77 37 7 TYR A 22 ? ? 42.06 75.74 38 7 THR A 25 ? ? 48.89 75.59 39 7 ASP A 26 ? ? 77.20 -57.93 40 7 ALA A 29 ? ? -160.92 68.10 41 8 SER A 5 ? ? -166.79 -63.64 42 8 LEU A 19 ? ? -78.46 -88.93 43 8 GLN A 20 ? ? 74.38 -69.91 44 9 ASN A 3 ? ? 61.52 -139.86 45 9 SER A 5 ? ? -147.55 -62.80 46 9 GLN A 20 ? ? 64.35 -94.63 47 9 TYR A 22 ? ? 125.48 -68.60 48 9 VAL A 27 ? ? 63.08 88.85 49 10 SER A 5 ? ? -161.02 -55.28 50 10 THR A 21 ? ? -74.14 -103.01 51 10 TYR A 22 ? ? -179.00 -39.95 52 10 ARG A 24 ? ? 71.87 -70.73 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 6 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 22 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.091 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1BKU _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEATEST RESTRAINT VIOLATION' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 COSY 1 # _pdbx_nmr_details.entry_id 1BKU _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TWO DIMENSIONAL NMR SPECTROSCOPY.' # _pdbx_nmr_refine.entry_id 1BKU _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DGII ? HAVEL 1 'structure solution' Felix ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 LEU N N N N 158 LEU CA C N S 159 LEU C C N N 160 LEU O O N N 161 LEU CB C N N 162 LEU CG C N N 163 LEU CD1 C N N 164 LEU CD2 C N N 165 LEU OXT O N N 166 LEU H H N N 167 LEU H2 H N N 168 LEU HA H N N 169 LEU HB2 H N N 170 LEU HB3 H N N 171 LEU HG H N N 172 LEU HD11 H N N 173 LEU HD12 H N N 174 LEU HD13 H N N 175 LEU HD21 H N N 176 LEU HD22 H N N 177 LEU HD23 H N N 178 LEU HXT H N N 179 LYS N N N N 180 LYS CA C N S 181 LYS C C N N 182 LYS O O N N 183 LYS CB C N N 184 LYS CG C N N 185 LYS CD C N N 186 LYS CE C N N 187 LYS NZ N N N 188 LYS OXT O N N 189 LYS H H N N 190 LYS H2 H N N 191 LYS HA H N N 192 LYS HB2 H N N 193 LYS HB3 H N N 194 LYS HG2 H N N 195 LYS HG3 H N N 196 LYS HD2 H N N 197 LYS HD3 H N N 198 LYS HE2 H N N 199 LYS HE3 H N N 200 LYS HZ1 H N N 201 LYS HZ2 H N N 202 LYS HZ3 H N N 203 LYS HXT H N N 204 NH2 N N N N 205 NH2 HN1 H N N 206 NH2 HN2 H N N 207 PRO N N N N 208 PRO CA C N S 209 PRO C C N N 210 PRO O O N N 211 PRO CB C N N 212 PRO CG C N N 213 PRO CD C N N 214 PRO OXT O N N 215 PRO H H N N 216 PRO HA H N N 217 PRO HB2 H N N 218 PRO HB3 H N N 219 PRO HG2 H N N 220 PRO HG3 H N N 221 PRO HD2 H N N 222 PRO HD3 H N N 223 PRO HXT H N N 224 SER N N N N 225 SER CA C N S 226 SER C C N N 227 SER O O N N 228 SER CB C N N 229 SER OG O N N 230 SER OXT O N N 231 SER H H N N 232 SER H2 H N N 233 SER HA H N N 234 SER HB2 H N N 235 SER HB3 H N N 236 SER HG H N N 237 SER HXT H N N 238 THR N N N N 239 THR CA C N S 240 THR C C N N 241 THR O O N N 242 THR CB C N R 243 THR OG1 O N N 244 THR CG2 C N N 245 THR OXT O N N 246 THR H H N N 247 THR H2 H N N 248 THR HA H N N 249 THR HB H N N 250 THR HG1 H N N 251 THR HG21 H N N 252 THR HG22 H N N 253 THR HG23 H N N 254 THR HXT H N N 255 TYR N N N N 256 TYR CA C N S 257 TYR C C N N 258 TYR O O N N 259 TYR CB C N N 260 TYR CG C Y N 261 TYR CD1 C Y N 262 TYR CD2 C Y N 263 TYR CE1 C Y N 264 TYR CE2 C Y N 265 TYR CZ C Y N 266 TYR OH O N N 267 TYR OXT O N N 268 TYR H H N N 269 TYR H2 H N N 270 TYR HA H N N 271 TYR HB2 H N N 272 TYR HB3 H N N 273 TYR HD1 H N N 274 TYR HD2 H N N 275 TYR HE1 H N N 276 TYR HE2 H N N 277 TYR HH H N N 278 TYR HXT H N N 279 VAL N N N N 280 VAL CA C N S 281 VAL C C N N 282 VAL O O N N 283 VAL CB C N N 284 VAL CG1 C N N 285 VAL CG2 C N N 286 VAL OXT O N N 287 VAL H H N N 288 VAL H2 H N N 289 VAL HA H N N 290 VAL HB H N N 291 VAL HG11 H N N 292 VAL HG12 H N N 293 VAL HG13 H N N 294 VAL HG21 H N N 295 VAL HG22 H N N 296 VAL HG23 H N N 297 VAL HXT H N N 298 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 NH2 N HN1 sing N N 195 NH2 N HN2 sing N N 196 PRO N CA sing N N 197 PRO N CD sing N N 198 PRO N H sing N N 199 PRO CA C sing N N 200 PRO CA CB sing N N 201 PRO CA HA sing N N 202 PRO C O doub N N 203 PRO C OXT sing N N 204 PRO CB CG sing N N 205 PRO CB HB2 sing N N 206 PRO CB HB3 sing N N 207 PRO CG CD sing N N 208 PRO CG HG2 sing N N 209 PRO CG HG3 sing N N 210 PRO CD HD2 sing N N 211 PRO CD HD3 sing N N 212 PRO OXT HXT sing N N 213 SER N CA sing N N 214 SER N H sing N N 215 SER N H2 sing N N 216 SER CA C sing N N 217 SER CA CB sing N N 218 SER CA HA sing N N 219 SER C O doub N N 220 SER C OXT sing N N 221 SER CB OG sing N N 222 SER CB HB2 sing N N 223 SER CB HB3 sing N N 224 SER OG HG sing N N 225 SER OXT HXT sing N N 226 THR N CA sing N N 227 THR N H sing N N 228 THR N H2 sing N N 229 THR CA C sing N N 230 THR CA CB sing N N 231 THR CA HA sing N N 232 THR C O doub N N 233 THR C OXT sing N N 234 THR CB OG1 sing N N 235 THR CB CG2 sing N N 236 THR CB HB sing N N 237 THR OG1 HG1 sing N N 238 THR CG2 HG21 sing N N 239 THR CG2 HG22 sing N N 240 THR CG2 HG23 sing N N 241 THR OXT HXT sing N N 242 TYR N CA sing N N 243 TYR N H sing N N 244 TYR N H2 sing N N 245 TYR CA C sing N N 246 TYR CA CB sing N N 247 TYR CA HA sing N N 248 TYR C O doub N N 249 TYR C OXT sing N N 250 TYR CB CG sing N N 251 TYR CB HB2 sing N N 252 TYR CB HB3 sing N N 253 TYR CG CD1 doub Y N 254 TYR CG CD2 sing Y N 255 TYR CD1 CE1 sing Y N 256 TYR CD1 HD1 sing N N 257 TYR CD2 CE2 doub Y N 258 TYR CD2 HD2 sing N N 259 TYR CE1 CZ doub Y N 260 TYR CE1 HE1 sing N N 261 TYR CE2 CZ sing Y N 262 TYR CE2 HE2 sing N N 263 TYR CZ OH sing N N 264 TYR OH HH sing N N 265 TYR OXT HXT sing N N 266 VAL N CA sing N N 267 VAL N H sing N N 268 VAL N H2 sing N N 269 VAL CA C sing N N 270 VAL CA CB sing N N 271 VAL CA HA sing N N 272 VAL C O doub N N 273 VAL C OXT sing N N 274 VAL CB CG1 sing N N 275 VAL CB CG2 sing N N 276 VAL CB HB sing N N 277 VAL CG1 HG11 sing N N 278 VAL CG1 HG12 sing N N 279 VAL CG1 HG13 sing N N 280 VAL CG2 HG21 sing N N 281 VAL CG2 HG22 sing N N 282 VAL CG2 HG23 sing N N 283 VAL OXT HXT sing N N 284 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX750 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 750 # _atom_sites.entry_id 1BKU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_