data_1BTS
# 
_entry.id   1BTS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.397 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1BTS         pdb_00001bts 10.2210/pdb1bts/pdb 
WWPDB D_1000172080 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-11-01 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-02-16 
5 'Structure model' 1 4 2024-10-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' Other                       
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' database_2                
2  4 'Structure model' pdbx_database_status      
3  4 'Structure model' pdbx_struct_assembly      
4  4 'Structure model' pdbx_struct_oper_list     
5  4 'Structure model' struct_conn               
6  4 'Structure model' struct_site               
7  5 'Structure model' chem_comp_atom            
8  5 'Structure model' chem_comp_bond            
9  5 'Structure model' pdbx_entry_details        
10 5 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_database_status.process_site'  
4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
5 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
7 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1BTS 
_pdbx_database_status.recvd_initial_deposition_date   1994-08-03 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1BTT 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   ensemble 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gargaro, A.R.'   1 
'Bloomberg, G.B.' 2 
'Dempsey, C.E.'   3 
'Murray, M.'      4 
'Tanner, M.J.A.'  5 
# 
_citation.id                        primary 
_citation.title                     'The solution structures of the first and second transmembrane-spanning segments of band 3.' 
_citation.journal_abbrev            Eur.J.Biochem. 
_citation.journal_volume            221 
_citation.page_first                445 
_citation.page_last                 454 
_citation.year                      1994 
_citation.journal_id_ASTM           EJBCAI 
_citation.country                   IX 
_citation.journal_id_ISSN           0014-2956 
_citation.journal_id_CSD            0262 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   8168533 
_citation.pdbx_database_id_DOI      10.1111/j.1432-1033.1994.tb18757.x 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gargaro, A.R.'   1 ? 
primary 'Bloomberg, G.B.' 2 ? 
primary 'Dempsey, C.E.'   3 ? 
primary 'Murray, M.'      4 ? 
primary 'Tanner, M.J.'    5 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'BAND 3 ANION TRANSPORT PROTEIN' 
_entity.formula_weight             2096.491 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       '(ACE)GVSELLISTAVQGILFALLGA(NH2)' 
_entity_poly.pdbx_seq_one_letter_code_can   XGVSELLISTAVQGILFALLGAX 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ACE n 
1 2  GLY n 
1 3  VAL n 
1 4  SER n 
1 5  GLU n 
1 6  LEU n 
1 7  LEU n 
1 8  ILE n 
1 9  SER n 
1 10 THR n 
1 11 ALA n 
1 12 VAL n 
1 13 GLN n 
1 14 GLY n 
1 15 ILE n 
1 16 LEU n 
1 17 PHE n 
1 18 ALA n 
1 19 LEU n 
1 20 LEU n 
1 21 GLY n 
1 22 ALA n 
1 23 NH2 n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'  ? 'C2 H4 O'      44.053  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'   89.093  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3' 146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'   147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'   75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'  131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'  131.173 
NH2 non-polymer         . 'AMINO GROUP'   ? 'H2 N'         16.023  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'  165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'   105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'   119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'  117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ACE 1  1  1  ACE ACE A . n 
A 1 2  GLY 2  2  2  GLY GLY A . n 
A 1 3  VAL 3  3  3  VAL VAL A . n 
A 1 4  SER 4  4  4  SER SER A . n 
A 1 5  GLU 5  5  5  GLU GLU A . n 
A 1 6  LEU 6  6  6  LEU LEU A . n 
A 1 7  LEU 7  7  7  LEU LEU A . n 
A 1 8  ILE 8  8  8  ILE ILE A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 THR 10 10 10 THR THR A . n 
A 1 11 ALA 11 11 11 ALA ALA A . n 
A 1 12 VAL 12 12 12 VAL VAL A . n 
A 1 13 GLN 13 13 13 GLN GLN A . n 
A 1 14 GLY 14 14 14 GLY GLY A . n 
A 1 15 ILE 15 15 15 ILE ILE A . n 
A 1 16 LEU 16 16 16 LEU LEU A . n 
A 1 17 PHE 17 17 17 PHE PHE A . n 
A 1 18 ALA 18 18 18 ALA ALA A . n 
A 1 19 LEU 19 19 19 LEU LEU A . n 
A 1 20 LEU 20 20 20 LEU LEU A . n 
A 1 21 GLY 21 21 21 GLY GLY A . n 
A 1 22 ALA 22 22 22 ALA ALA A . n 
A 1 23 NH2 23 23 23 NH2 NH2 A . n 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
_cell.entry_id           1BTS 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1BTS 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          1BTS 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_database_PDB_matrix.entry_id          1BTS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1BTS 
_struct.title                     'THE SOLUTION STRUCTURES OF THE FIRST AND SECOND TRANSMEMBRANE-SPANNING SEGMENTS OF BAND 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1BTS 
_struct_keywords.pdbx_keywords   'TRANSMEMBRANE PROTEIN' 
_struct_keywords.text            'TRANSMEMBRANE PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    B3AT_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P02730 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAAR
WVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLK
HSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQP
VLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLV
LPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDA
FSPQVLAAVIFIYFAALSPAITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFCE
TNGLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKLIKIFQDHPLQKTYNYNVLMV
PKPQGPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPGKLRRVIGDFGVPISILIMVLVDFFIQDTYTQKLSVPDGFKV
SNSSARGWVIHPLGLRSEFPIWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLLVVGMGGVAALFG
MPWLSATTVRSVTHANALTVMGKASTPGAAAQIQEVKEQRISGLLVAVLVGLSILMEPILSRIPLAVLFGIFLYMGVTSL
SGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGIQIICLAVLWVVKSTPASLALPFVLILTVPLRRVLLPLIFRN
VELQCLDADDAKATFDEEEGRDEYDEVAMPV
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1BTS 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 22 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02730 
_struct_ref_seq.db_align_beg                  436 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  456 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       22 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       A 
_struct_conf.beg_label_comp_id       VAL 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        3 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LEU 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        20 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        VAL 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         3 
_struct_conf.end_auth_comp_id        LEU 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         20 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A ACE 1  C ? ? ? 1_555 A GLY 2  N ? ? A ACE 1  A GLY 2  1_555 ? ? ? ? ? ? ? 1.309 ? ? 
covale2 covale both ? A ALA 22 C ? ? ? 1_555 A NH2 23 N ? ? A ALA 22 A NH2 23 1_555 ? ? ? ? ? ? ? 1.304 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 ACE A 1  ? GLY A 2  ? ACE A 1  ? 1_555 GLY A 2  ? 1_555 . . GLY 12 ACE None 'Terminal acetylation' 
2 NH2 A 23 ? ALA A 22 ? NH2 A 23 ? 1_555 ALA A 22 ? 1_555 . . ALA 1  NH2 None 'Terminal amidation'   
# 
_struct_site.id                   AC2 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    NH2 
_struct_site.pdbx_auth_seq_id     23 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'BINDING SITE FOR RESIDUE NH2 A 23' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC2 2 GLY A 21 ? GLY A 21 . ? 1_555 ? 
2 AC2 2 ALA A 22 ? ALA A 22 . ? 1_555 ? 
# 
_pdbx_entry_details.entry_id                   1BTS 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
_pdbx_nmr_ensemble.entry_id                             1BTS 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ACE C    C N N 1   
ACE O    O N N 2   
ACE CH3  C N N 3   
ACE H    H N N 4   
ACE H1   H N N 5   
ACE H2   H N N 6   
ACE H3   H N N 7   
ALA N    N N N 8   
ALA CA   C N S 9   
ALA C    C N N 10  
ALA O    O N N 11  
ALA CB   C N N 12  
ALA OXT  O N N 13  
ALA H    H N N 14  
ALA H2   H N N 15  
ALA HA   H N N 16  
ALA HB1  H N N 17  
ALA HB2  H N N 18  
ALA HB3  H N N 19  
ALA HXT  H N N 20  
GLN N    N N N 21  
GLN CA   C N S 22  
GLN C    C N N 23  
GLN O    O N N 24  
GLN CB   C N N 25  
GLN CG   C N N 26  
GLN CD   C N N 27  
GLN OE1  O N N 28  
GLN NE2  N N N 29  
GLN OXT  O N N 30  
GLN H    H N N 31  
GLN H2   H N N 32  
GLN HA   H N N 33  
GLN HB2  H N N 34  
GLN HB3  H N N 35  
GLN HG2  H N N 36  
GLN HG3  H N N 37  
GLN HE21 H N N 38  
GLN HE22 H N N 39  
GLN HXT  H N N 40  
GLU N    N N N 41  
GLU CA   C N S 42  
GLU C    C N N 43  
GLU O    O N N 44  
GLU CB   C N N 45  
GLU CG   C N N 46  
GLU CD   C N N 47  
GLU OE1  O N N 48  
GLU OE2  O N N 49  
GLU OXT  O N N 50  
GLU H    H N N 51  
GLU H2   H N N 52  
GLU HA   H N N 53  
GLU HB2  H N N 54  
GLU HB3  H N N 55  
GLU HG2  H N N 56  
GLU HG3  H N N 57  
GLU HE2  H N N 58  
GLU HXT  H N N 59  
GLY N    N N N 60  
GLY CA   C N N 61  
GLY C    C N N 62  
GLY O    O N N 63  
GLY OXT  O N N 64  
GLY H    H N N 65  
GLY H2   H N N 66  
GLY HA2  H N N 67  
GLY HA3  H N N 68  
GLY HXT  H N N 69  
ILE N    N N N 70  
ILE CA   C N S 71  
ILE C    C N N 72  
ILE O    O N N 73  
ILE CB   C N S 74  
ILE CG1  C N N 75  
ILE CG2  C N N 76  
ILE CD1  C N N 77  
ILE OXT  O N N 78  
ILE H    H N N 79  
ILE H2   H N N 80  
ILE HA   H N N 81  
ILE HB   H N N 82  
ILE HG12 H N N 83  
ILE HG13 H N N 84  
ILE HG21 H N N 85  
ILE HG22 H N N 86  
ILE HG23 H N N 87  
ILE HD11 H N N 88  
ILE HD12 H N N 89  
ILE HD13 H N N 90  
ILE HXT  H N N 91  
LEU N    N N N 92  
LEU CA   C N S 93  
LEU C    C N N 94  
LEU O    O N N 95  
LEU CB   C N N 96  
LEU CG   C N N 97  
LEU CD1  C N N 98  
LEU CD2  C N N 99  
LEU OXT  O N N 100 
LEU H    H N N 101 
LEU H2   H N N 102 
LEU HA   H N N 103 
LEU HB2  H N N 104 
LEU HB3  H N N 105 
LEU HG   H N N 106 
LEU HD11 H N N 107 
LEU HD12 H N N 108 
LEU HD13 H N N 109 
LEU HD21 H N N 110 
LEU HD22 H N N 111 
LEU HD23 H N N 112 
LEU HXT  H N N 113 
NH2 N    N N N 114 
NH2 HN1  H N N 115 
NH2 HN2  H N N 116 
PHE N    N N N 117 
PHE CA   C N S 118 
PHE C    C N N 119 
PHE O    O N N 120 
PHE CB   C N N 121 
PHE CG   C Y N 122 
PHE CD1  C Y N 123 
PHE CD2  C Y N 124 
PHE CE1  C Y N 125 
PHE CE2  C Y N 126 
PHE CZ   C Y N 127 
PHE OXT  O N N 128 
PHE H    H N N 129 
PHE H2   H N N 130 
PHE HA   H N N 131 
PHE HB2  H N N 132 
PHE HB3  H N N 133 
PHE HD1  H N N 134 
PHE HD2  H N N 135 
PHE HE1  H N N 136 
PHE HE2  H N N 137 
PHE HZ   H N N 138 
PHE HXT  H N N 139 
SER N    N N N 140 
SER CA   C N S 141 
SER C    C N N 142 
SER O    O N N 143 
SER CB   C N N 144 
SER OG   O N N 145 
SER OXT  O N N 146 
SER H    H N N 147 
SER H2   H N N 148 
SER HA   H N N 149 
SER HB2  H N N 150 
SER HB3  H N N 151 
SER HG   H N N 152 
SER HXT  H N N 153 
THR N    N N N 154 
THR CA   C N S 155 
THR C    C N N 156 
THR O    O N N 157 
THR CB   C N R 158 
THR OG1  O N N 159 
THR CG2  C N N 160 
THR OXT  O N N 161 
THR H    H N N 162 
THR H2   H N N 163 
THR HA   H N N 164 
THR HB   H N N 165 
THR HG1  H N N 166 
THR HG21 H N N 167 
THR HG22 H N N 168 
THR HG23 H N N 169 
THR HXT  H N N 170 
VAL N    N N N 171 
VAL CA   C N S 172 
VAL C    C N N 173 
VAL O    O N N 174 
VAL CB   C N N 175 
VAL CG1  C N N 176 
VAL CG2  C N N 177 
VAL OXT  O N N 178 
VAL H    H N N 179 
VAL H2   H N N 180 
VAL HA   H N N 181 
VAL HB   H N N 182 
VAL HG11 H N N 183 
VAL HG12 H N N 184 
VAL HG13 H N N 185 
VAL HG21 H N N 186 
VAL HG22 H N N 187 
VAL HG23 H N N 188 
VAL HXT  H N N 189 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ACE C   O    doub N N 1   
ACE C   CH3  sing N N 2   
ACE C   H    sing N N 3   
ACE CH3 H1   sing N N 4   
ACE CH3 H2   sing N N 5   
ACE CH3 H3   sing N N 6   
ALA N   CA   sing N N 7   
ALA N   H    sing N N 8   
ALA N   H2   sing N N 9   
ALA CA  C    sing N N 10  
ALA CA  CB   sing N N 11  
ALA CA  HA   sing N N 12  
ALA C   O    doub N N 13  
ALA C   OXT  sing N N 14  
ALA CB  HB1  sing N N 15  
ALA CB  HB2  sing N N 16  
ALA CB  HB3  sing N N 17  
ALA OXT HXT  sing N N 18  
GLN N   CA   sing N N 19  
GLN N   H    sing N N 20  
GLN N   H2   sing N N 21  
GLN CA  C    sing N N 22  
GLN CA  CB   sing N N 23  
GLN CA  HA   sing N N 24  
GLN C   O    doub N N 25  
GLN C   OXT  sing N N 26  
GLN CB  CG   sing N N 27  
GLN CB  HB2  sing N N 28  
GLN CB  HB3  sing N N 29  
GLN CG  CD   sing N N 30  
GLN CG  HG2  sing N N 31  
GLN CG  HG3  sing N N 32  
GLN CD  OE1  doub N N 33  
GLN CD  NE2  sing N N 34  
GLN NE2 HE21 sing N N 35  
GLN NE2 HE22 sing N N 36  
GLN OXT HXT  sing N N 37  
GLU N   CA   sing N N 38  
GLU N   H    sing N N 39  
GLU N   H2   sing N N 40  
GLU CA  C    sing N N 41  
GLU CA  CB   sing N N 42  
GLU CA  HA   sing N N 43  
GLU C   O    doub N N 44  
GLU C   OXT  sing N N 45  
GLU CB  CG   sing N N 46  
GLU CB  HB2  sing N N 47  
GLU CB  HB3  sing N N 48  
GLU CG  CD   sing N N 49  
GLU CG  HG2  sing N N 50  
GLU CG  HG3  sing N N 51  
GLU CD  OE1  doub N N 52  
GLU CD  OE2  sing N N 53  
GLU OE2 HE2  sing N N 54  
GLU OXT HXT  sing N N 55  
GLY N   CA   sing N N 56  
GLY N   H    sing N N 57  
GLY N   H2   sing N N 58  
GLY CA  C    sing N N 59  
GLY CA  HA2  sing N N 60  
GLY CA  HA3  sing N N 61  
GLY C   O    doub N N 62  
GLY C   OXT  sing N N 63  
GLY OXT HXT  sing N N 64  
ILE N   CA   sing N N 65  
ILE N   H    sing N N 66  
ILE N   H2   sing N N 67  
ILE CA  C    sing N N 68  
ILE CA  CB   sing N N 69  
ILE CA  HA   sing N N 70  
ILE C   O    doub N N 71  
ILE C   OXT  sing N N 72  
ILE CB  CG1  sing N N 73  
ILE CB  CG2  sing N N 74  
ILE CB  HB   sing N N 75  
ILE CG1 CD1  sing N N 76  
ILE CG1 HG12 sing N N 77  
ILE CG1 HG13 sing N N 78  
ILE CG2 HG21 sing N N 79  
ILE CG2 HG22 sing N N 80  
ILE CG2 HG23 sing N N 81  
ILE CD1 HD11 sing N N 82  
ILE CD1 HD12 sing N N 83  
ILE CD1 HD13 sing N N 84  
ILE OXT HXT  sing N N 85  
LEU N   CA   sing N N 86  
LEU N   H    sing N N 87  
LEU N   H2   sing N N 88  
LEU CA  C    sing N N 89  
LEU CA  CB   sing N N 90  
LEU CA  HA   sing N N 91  
LEU C   O    doub N N 92  
LEU C   OXT  sing N N 93  
LEU CB  CG   sing N N 94  
LEU CB  HB2  sing N N 95  
LEU CB  HB3  sing N N 96  
LEU CG  CD1  sing N N 97  
LEU CG  CD2  sing N N 98  
LEU CG  HG   sing N N 99  
LEU CD1 HD11 sing N N 100 
LEU CD1 HD12 sing N N 101 
LEU CD1 HD13 sing N N 102 
LEU CD2 HD21 sing N N 103 
LEU CD2 HD22 sing N N 104 
LEU CD2 HD23 sing N N 105 
LEU OXT HXT  sing N N 106 
NH2 N   HN1  sing N N 107 
NH2 N   HN2  sing N N 108 
PHE N   CA   sing N N 109 
PHE N   H    sing N N 110 
PHE N   H2   sing N N 111 
PHE CA  C    sing N N 112 
PHE CA  CB   sing N N 113 
PHE CA  HA   sing N N 114 
PHE C   O    doub N N 115 
PHE C   OXT  sing N N 116 
PHE CB  CG   sing N N 117 
PHE CB  HB2  sing N N 118 
PHE CB  HB3  sing N N 119 
PHE CG  CD1  doub Y N 120 
PHE CG  CD2  sing Y N 121 
PHE CD1 CE1  sing Y N 122 
PHE CD1 HD1  sing N N 123 
PHE CD2 CE2  doub Y N 124 
PHE CD2 HD2  sing N N 125 
PHE CE1 CZ   doub Y N 126 
PHE CE1 HE1  sing N N 127 
PHE CE2 CZ   sing Y N 128 
PHE CE2 HE2  sing N N 129 
PHE CZ  HZ   sing N N 130 
PHE OXT HXT  sing N N 131 
SER N   CA   sing N N 132 
SER N   H    sing N N 133 
SER N   H2   sing N N 134 
SER CA  C    sing N N 135 
SER CA  CB   sing N N 136 
SER CA  HA   sing N N 137 
SER C   O    doub N N 138 
SER C   OXT  sing N N 139 
SER CB  OG   sing N N 140 
SER CB  HB2  sing N N 141 
SER CB  HB3  sing N N 142 
SER OG  HG   sing N N 143 
SER OXT HXT  sing N N 144 
THR N   CA   sing N N 145 
THR N   H    sing N N 146 
THR N   H2   sing N N 147 
THR CA  C    sing N N 148 
THR CA  CB   sing N N 149 
THR CA  HA   sing N N 150 
THR C   O    doub N N 151 
THR C   OXT  sing N N 152 
THR CB  OG1  sing N N 153 
THR CB  CG2  sing N N 154 
THR CB  HB   sing N N 155 
THR OG1 HG1  sing N N 156 
THR CG2 HG21 sing N N 157 
THR CG2 HG22 sing N N 158 
THR CG2 HG23 sing N N 159 
THR OXT HXT  sing N N 160 
VAL N   CA   sing N N 161 
VAL N   H    sing N N 162 
VAL N   H2   sing N N 163 
VAL CA  C    sing N N 164 
VAL CA  CB   sing N N 165 
VAL CA  HA   sing N N 166 
VAL C   O    doub N N 167 
VAL C   OXT  sing N N 168 
VAL CB  CG1  sing N N 169 
VAL CB  CG2  sing N N 170 
VAL CB  HB   sing N N 171 
VAL CG1 HG11 sing N N 172 
VAL CG1 HG12 sing N N 173 
VAL CG1 HG13 sing N N 174 
VAL CG2 HG21 sing N N 175 
VAL CG2 HG22 sing N N 176 
VAL CG2 HG23 sing N N 177 
VAL OXT HXT  sing N N 178 
# 
_atom_sites.entry_id                    1BTS 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_