data_1CCR # _entry.id 1CCR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1CCR WWPDB D_1000172238 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1CCR _pdbx_database_status.recvd_initial_deposition_date 1983-03-14 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ochi, H.' 1 'Hata, Y.' 2 'Tanaka, N.' 3 'Kakudo, M.' 4 'Sakurai, T.' 5 'Aihara, S.' 6 'Morita, Y.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of rice ferricytochrome c at 2.0 A resolution.' J.Mol.Biol. 166 407 418 1983 JMOBAK UK 0022-2836 0070 ? 6304326 '10.1016/S0022-2836(83)80092-8' 1 'Amino Acid Sequence of Cytochrome C from Rice' 'J.Biochem.(Tokyo)' 87 249 ? 1980 JOBIAO JA 0021-924X 0418 ? ? ? 2 'A Preliminary Crystallographic Investigation of Rice Cytochrome C' J.Mol.Biol. 71 807 ? 1972 JMOBAK UK 0022-2836 0070 ? ? ? 3 ;Studies on Respiratory Enzymes in Rice Kernel. Part I. Isolation and Purification of Cytochrome C and Peroxidase 556 from Rice Embryo ; Agric.Biol.Chem. 32 441 ? 1968 ABCHA6 JA 0002-1369 0137 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ochi, H.' 1 ? primary 'Hata, Y.' 2 ? primary 'Tanaka, N.' 3 ? primary 'Kakudo, M.' 4 ? primary 'Sakurai, T.' 5 ? primary 'Aihara, S.' 6 ? primary 'Morita, Y.' 7 ? 1 'Mori, E.' 8 ? 1 'Morita, Y.' 9 ? 2 'Morita, Y.' 10 ? 2 'Ida, S.' 11 ? 3 'Mori, Y.' 12 ? 3 'Ida, S.' 13 ? # _cell.entry_id 1CCR _cell.length_a 43.780 _cell.length_b 43.780 _cell.length_c 110.050 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1CCR _symmetry.space_group_name_H-M 'P 61' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 169 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CYTOCHROME C' 12267.986 1 ? ? ? ? 2 non-polymer syn 'HEME C' 618.503 1 ? ? ? ? 3 water nat water 18.015 46 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(ACE)ASFSEAPPGNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTADKNMAVIWEENTLYDY LLNP(M3L)KYIPGTKMVFPGL(M3L)KPQERADLISYLKEATS ; _entity_poly.pdbx_seq_one_letter_code_can ;XASFSEAPPGNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTADKNMAVIWEENTLYDYLLNP KKYIPGTKMVFPGLKKPQERADLISYLKEATS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 ALA n 1 3 SER n 1 4 PHE n 1 5 SER n 1 6 GLU n 1 7 ALA n 1 8 PRO n 1 9 PRO n 1 10 GLY n 1 11 ASN n 1 12 PRO n 1 13 LYS n 1 14 ALA n 1 15 GLY n 1 16 GLU n 1 17 LYS n 1 18 ILE n 1 19 PHE n 1 20 LYS n 1 21 THR n 1 22 LYS n 1 23 CYS n 1 24 ALA n 1 25 GLN n 1 26 CYS n 1 27 HIS n 1 28 THR n 1 29 VAL n 1 30 ASP n 1 31 LYS n 1 32 GLY n 1 33 ALA n 1 34 GLY n 1 35 HIS n 1 36 LYS n 1 37 GLN n 1 38 GLY n 1 39 PRO n 1 40 ASN n 1 41 LEU n 1 42 ASN n 1 43 GLY n 1 44 LEU n 1 45 PHE n 1 46 GLY n 1 47 ARG n 1 48 GLN n 1 49 SER n 1 50 GLY n 1 51 THR n 1 52 THR n 1 53 PRO n 1 54 GLY n 1 55 TYR n 1 56 SER n 1 57 TYR n 1 58 SER n 1 59 THR n 1 60 ALA n 1 61 ASP n 1 62 LYS n 1 63 ASN n 1 64 MET n 1 65 ALA n 1 66 VAL n 1 67 ILE n 1 68 TRP n 1 69 GLU n 1 70 GLU n 1 71 ASN n 1 72 THR n 1 73 LEU n 1 74 TYR n 1 75 ASP n 1 76 TYR n 1 77 LEU n 1 78 LEU n 1 79 ASN n 1 80 PRO n 1 81 M3L n 1 82 LYS n 1 83 TYR n 1 84 ILE n 1 85 PRO n 1 86 GLY n 1 87 THR n 1 88 LYS n 1 89 MET n 1 90 VAL n 1 91 PHE n 1 92 PRO n 1 93 GLY n 1 94 LEU n 1 95 M3L n 1 96 LYS n 1 97 PRO n 1 98 GLN n 1 99 GLU n 1 100 ARG n 1 101 ALA n 1 102 ASP n 1 103 LEU n 1 104 ILE n 1 105 SER n 1 106 TYR n 1 107 LEU n 1 108 LYS n 1 109 GLU n 1 110 ALA n 1 111 THR n 1 112 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name rice _entity_src_gen.gene_src_genus Oryza _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Oryza sativa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4530 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYC_ORYSA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00055 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;ASFSEAPPGNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTANKNMAVIWEENTLYDYLLNPK KYIPGTKMVFPGLKKPQERADLISYLKEATS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1CCR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 112 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00055 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 111 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 111 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1CCR _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 61 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00055 _struct_ref_seq_dif.db_mon_id ASN _struct_ref_seq_dif.pdbx_seq_db_seq_num 60 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 60 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 M3L 'L-peptide linking' n N-TRIMETHYLLYSINE ? 'C9 H21 N2 O2 1' 189.275 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1CCR _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_percent_sol 50.74 _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1CCR _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 1.5 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1900000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 858 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 49 _refine_hist.number_atoms_solvent 46 _refine_hist.number_atoms_total 953 _refine_hist.d_res_high 1.5 _refine_hist.d_res_low . # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function o_bond_d 0.02 ? ? ? 'X-RAY DIFFRACTION' ? o_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? o_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? o_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? o_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? o_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? o_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1CCR _struct.title 'STRUCTURE OF RICE FERRICYTOCHROME C AT 2.0 ANGSTROMS RESOLUTION' _struct.pdbx_descriptor 'CYTOCHROME C' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1CCR _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT(CYTOCHROME)' _struct_keywords.text 'ELECTRON TRANSPORT(CYTOCHROME)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 ASN A 11 ? CYS A 23 ? ASN A 10 CYS A 22 1 ? 13 HELX_P HELX_P2 H2 SER A 58 ? MET A 64 ? SER A 57 MET A 63 1 ? 7 HELX_P HELX_P3 H3 GLU A 69 ? ASN A 79 ? GLU A 68 ASN A 78 1 ? 11 HELX_P HELX_P4 H4 ASN A 79 ? ILE A 84 ? ASN A 78 ILE A 83 1 ? 6 HELX_P HELX_P5 H5 LYS A 96 ? SER A 112 ? LYS A 95 SER A 111 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ACE 1 C ? ? ? 1_555 A ALA 2 N ? ? A ACE 0 A ALA 1 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale2 covale none ? A CYS 23 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 22 A HEC 112 1_555 ? ? ? ? ? ? ? 1.914 ? ? covale3 covale none ? A CYS 26 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 25 A HEC 112 1_555 ? ? ? ? ? ? ? 1.965 ? ? covale4 covale both ? A PRO 80 C ? ? ? 1_555 A M3L 81 N ? ? A PRO 79 A M3L 80 1_555 ? ? ? ? ? ? ? 1.295 ? ? covale5 covale both ? A M3L 81 C ? ? ? 1_555 A LYS 82 N ? ? A M3L 80 A LYS 81 1_555 ? ? ? ? ? ? ? 1.311 ? ? covale6 covale both ? A LEU 94 C ? ? ? 1_555 A M3L 95 N ? ? A LEU 93 A M3L 94 1_555 ? ? ? ? ? ? ? 1.300 ? ? covale7 covale both ? A M3L 95 C ? ? ? 1_555 A LYS 96 N ? ? A M3L 94 A LYS 95 1_555 ? ? ? ? ? ? ? 1.311 ? ? metalc1 metalc ? ? A HIS 27 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 26 A HEC 112 1_555 ? ? ? ? ? ? ? 2.037 ? ? metalc2 metalc ? ? A MET 89 SD ? ? ? 1_555 B HEC . FE ? ? A MET 88 A HEC 112 1_555 ? ? ? ? ? ? ? 2.351 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEC _struct_site.pdbx_auth_seq_id 112 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 23 _struct_site.details 'BINDING SITE FOR RESIDUE HEC A 112' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 23 LYS A 22 ? LYS A 21 . ? 1_555 ? 2 AC1 23 CYS A 23 ? CYS A 22 . ? 1_555 ? 3 AC1 23 CYS A 26 ? CYS A 25 . ? 1_555 ? 4 AC1 23 HIS A 27 ? HIS A 26 . ? 1_555 ? 5 AC1 23 GLN A 37 ? GLN A 36 . ? 1_555 ? 6 AC1 23 GLY A 38 ? GLY A 37 . ? 1_555 ? 7 AC1 23 PRO A 39 ? PRO A 38 . ? 1_555 ? 8 AC1 23 SER A 49 ? SER A 48 . ? 1_555 ? 9 AC1 23 GLY A 50 ? GLY A 49 . ? 1_555 ? 10 AC1 23 TYR A 55 ? TYR A 54 . ? 1_555 ? 11 AC1 23 TYR A 57 ? TYR A 56 . ? 1_555 ? 12 AC1 23 SER A 58 ? SER A 57 . ? 1_555 ? 13 AC1 23 ASP A 61 ? ASP A 60 . ? 1_555 ? 14 AC1 23 TRP A 68 ? TRP A 67 . ? 1_555 ? 15 AC1 23 TYR A 76 ? TYR A 75 . ? 1_555 ? 16 AC1 23 THR A 87 ? THR A 86 . ? 1_555 ? 17 AC1 23 LYS A 88 ? LYS A 87 . ? 1_555 ? 18 AC1 23 MET A 89 ? MET A 88 . ? 1_555 ? 19 AC1 23 VAL A 90 ? VAL A 89 . ? 1_555 ? 20 AC1 23 PHE A 91 ? PHE A 90 . ? 1_555 ? 21 AC1 23 LEU A 103 ? LEU A 102 . ? 1_555 ? 22 AC1 23 HOH C . ? HOH A 123 . ? 1_555 ? 23 AC1 23 HOH C . ? HOH A 135 . ? 1_555 ? # _database_PDB_matrix.entry_id 1CCR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1CCR _atom_sites.fract_transf_matrix[1][1] .022841 _atom_sites.fract_transf_matrix[1][2] .013188 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] .026375 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] .009087 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 'RESIDUE LYS 80 AND TML 2 FORM EPSILON-N-TRIMETHYLLYSINE. SEE REMARK 4 ABOVE.' 2 'RESIDUE LYS 94 AND TML 3 FORM EPSILON-N-TRIMETHYLLYSINE. SEE REMARK 4 ABOVE.' # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 0 0 ACE ACE A . n A 1 2 ALA 2 1 1 ALA ALA A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 PHE 4 3 3 PHE PHE A . n A 1 5 SER 5 4 4 SER SER A . n A 1 6 GLU 6 5 5 GLU GLU A . n A 1 7 ALA 7 6 6 ALA ALA A . n A 1 8 PRO 8 7 7 PRO PRO A . n A 1 9 PRO 9 8 8 PRO PRO A . n A 1 10 GLY 10 9 9 GLY GLY A . n A 1 11 ASN 11 10 10 ASN ASN A . n A 1 12 PRO 12 11 11 PRO PRO A . n A 1 13 LYS 13 12 12 LYS LYS A . n A 1 14 ALA 14 13 13 ALA ALA A . n A 1 15 GLY 15 14 14 GLY GLY A . n A 1 16 GLU 16 15 15 GLU GLU A . n A 1 17 LYS 17 16 16 LYS LYS A . n A 1 18 ILE 18 17 17 ILE ILE A . n A 1 19 PHE 19 18 18 PHE PHE A . n A 1 20 LYS 20 19 19 LYS LYS A . n A 1 21 THR 21 20 20 THR THR A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 CYS 23 22 22 CYS CYS A . n A 1 24 ALA 24 23 23 ALA ALA A . n A 1 25 GLN 25 24 24 GLN GLN A . n A 1 26 CYS 26 25 25 CYS CYS A . n A 1 27 HIS 27 26 26 HIS HIS A . n A 1 28 THR 28 27 27 THR THR A . n A 1 29 VAL 29 28 28 VAL VAL A . n A 1 30 ASP 30 29 29 ASP ASP A . n A 1 31 LYS 31 30 30 LYS LYS A . n A 1 32 GLY 32 31 31 GLY GLY A . n A 1 33 ALA 33 32 32 ALA ALA A . n A 1 34 GLY 34 33 33 GLY GLY A . n A 1 35 HIS 35 34 34 HIS HIS A . n A 1 36 LYS 36 35 35 LYS LYS A . n A 1 37 GLN 37 36 36 GLN GLN A . n A 1 38 GLY 38 37 37 GLY GLY A . n A 1 39 PRO 39 38 38 PRO PRO A . n A 1 40 ASN 40 39 39 ASN ASN A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 ASN 42 41 41 ASN ASN A . n A 1 43 GLY 43 42 42 GLY GLY A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 PHE 45 44 44 PHE PHE A . n A 1 46 GLY 46 45 45 GLY GLY A . n A 1 47 ARG 47 46 46 ARG ARG A . n A 1 48 GLN 48 47 47 GLN GLN A . n A 1 49 SER 49 48 48 SER SER A . n A 1 50 GLY 50 49 49 GLY GLY A . n A 1 51 THR 51 50 50 THR THR A . n A 1 52 THR 52 51 51 THR THR A . n A 1 53 PRO 53 52 52 PRO PRO A . n A 1 54 GLY 54 53 53 GLY GLY A . n A 1 55 TYR 55 54 54 TYR TYR A . n A 1 56 SER 56 55 55 SER SER A . n A 1 57 TYR 57 56 56 TYR TYR A . n A 1 58 SER 58 57 57 SER SER A . n A 1 59 THR 59 58 58 THR THR A . n A 1 60 ALA 60 59 59 ALA ALA A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 LYS 62 61 61 LYS LYS A . n A 1 63 ASN 63 62 62 ASN ASN A . n A 1 64 MET 64 63 63 MET MET A . n A 1 65 ALA 65 64 64 ALA ALA A . n A 1 66 VAL 66 65 65 VAL VAL A . n A 1 67 ILE 67 66 66 ILE ILE A . n A 1 68 TRP 68 67 67 TRP TRP A . n A 1 69 GLU 69 68 68 GLU GLU A . n A 1 70 GLU 70 69 69 GLU GLU A . n A 1 71 ASN 71 70 70 ASN ASN A . n A 1 72 THR 72 71 71 THR THR A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 TYR 74 73 73 TYR TYR A . n A 1 75 ASP 75 74 74 ASP ASP A . n A 1 76 TYR 76 75 75 TYR TYR A . n A 1 77 LEU 77 76 76 LEU LEU A . n A 1 78 LEU 78 77 77 LEU LEU A . n A 1 79 ASN 79 78 78 ASN ASN A . n A 1 80 PRO 80 79 79 PRO PRO A . n A 1 81 M3L 81 80 80 M3L LYS A . n A 1 82 LYS 82 81 81 LYS LYS A . n A 1 83 TYR 83 82 82 TYR TYR A . n A 1 84 ILE 84 83 83 ILE ILE A . n A 1 85 PRO 85 84 84 PRO PRO A . n A 1 86 GLY 86 85 85 GLY GLY A . n A 1 87 THR 87 86 86 THR THR A . n A 1 88 LYS 88 87 87 LYS LYS A . n A 1 89 MET 89 88 88 MET MET A . n A 1 90 VAL 90 89 89 VAL VAL A . n A 1 91 PHE 91 90 90 PHE PHE A . n A 1 92 PRO 92 91 91 PRO PRO A . n A 1 93 GLY 93 92 92 GLY GLY A . n A 1 94 LEU 94 93 93 LEU LEU A . n A 1 95 M3L 95 94 94 M3L LYS A . n A 1 96 LYS 96 95 95 LYS LYS A . n A 1 97 PRO 97 96 96 PRO PRO A . n A 1 98 GLN 98 97 97 GLN GLN A . n A 1 99 GLU 99 98 98 GLU GLU A . n A 1 100 ARG 100 99 99 ARG ARG A . n A 1 101 ALA 101 100 100 ALA ALA A . n A 1 102 ASP 102 101 101 ASP ASP A . n A 1 103 LEU 103 102 102 LEU LEU A . n A 1 104 ILE 104 103 103 ILE ILE A . n A 1 105 SER 105 104 104 SER SER A . n A 1 106 TYR 106 105 105 TYR TYR A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 LYS 108 107 107 LYS LYS A . n A 1 109 GLU 109 108 108 GLU GLU A . n A 1 110 ALA 110 109 109 ALA ALA A . n A 1 111 THR 111 110 110 THR THR A . n A 1 112 SER 112 111 111 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEC 1 112 1 HEC HEM A . C 3 HOH 1 113 4 HOH HOH A . C 3 HOH 2 114 5 HOH HOH A . C 3 HOH 3 115 6 HOH HOH A . C 3 HOH 4 116 7 HOH HOH A . C 3 HOH 5 117 8 HOH HOH A . C 3 HOH 6 118 9 HOH HOH A . C 3 HOH 7 119 10 HOH HOH A . C 3 HOH 8 120 11 HOH HOH A . C 3 HOH 9 121 12 HOH HOH A . C 3 HOH 10 122 13 HOH HOH A . C 3 HOH 11 123 14 HOH HOH A . C 3 HOH 12 124 15 HOH HOH A . C 3 HOH 13 125 16 HOH HOH A . C 3 HOH 14 126 17 HOH HOH A . C 3 HOH 15 127 18 HOH HOH A . C 3 HOH 16 128 19 HOH HOH A . C 3 HOH 17 129 20 HOH HOH A . C 3 HOH 18 130 21 HOH HOH A . C 3 HOH 19 131 22 HOH HOH A . C 3 HOH 20 132 23 HOH HOH A . C 3 HOH 21 133 24 HOH HOH A . C 3 HOH 22 134 25 HOH HOH A . C 3 HOH 23 135 26 HOH HOH A . C 3 HOH 24 136 27 HOH HOH A . C 3 HOH 25 137 28 HOH HOH A . C 3 HOH 26 138 29 HOH HOH A . C 3 HOH 27 139 30 HOH HOH A . C 3 HOH 28 140 31 HOH HOH A . C 3 HOH 29 141 32 HOH HOH A . C 3 HOH 30 142 33 HOH HOH A . C 3 HOH 31 143 34 HOH HOH A . C 3 HOH 32 144 35 HOH HOH A . C 3 HOH 33 145 36 HOH HOH A . C 3 HOH 34 146 37 HOH HOH A . C 3 HOH 35 147 38 HOH HOH A . C 3 HOH 36 148 39 HOH HOH A . C 3 HOH 37 149 40 HOH HOH A . C 3 HOH 38 150 41 HOH HOH A . C 3 HOH 39 151 42 HOH HOH A . C 3 HOH 40 152 43 HOH HOH A . C 3 HOH 41 153 44 HOH HOH A . C 3 HOH 42 154 45 HOH HOH A . C 3 HOH 43 155 46 HOH HOH A . C 3 HOH 44 156 47 HOH HOH A . C 3 HOH 45 157 48 HOH HOH A . C 3 HOH 46 158 49 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A M3L 81 A M3L 80 ? LYS N-TRIMETHYLLYSINE 2 A M3L 95 A M3L 94 ? LYS N-TRIMETHYLLYSINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 27 ? A HIS 26 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 NA ? B HEC . ? A HEC 112 ? 1_555 91.3 ? 2 NE2 ? A HIS 27 ? A HIS 26 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 NB ? B HEC . ? A HEC 112 ? 1_555 86.1 ? 3 NA ? B HEC . ? A HEC 112 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 NB ? B HEC . ? A HEC 112 ? 1_555 91.3 ? 4 NE2 ? A HIS 27 ? A HIS 26 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 NC ? B HEC . ? A HEC 112 ? 1_555 85.7 ? 5 NA ? B HEC . ? A HEC 112 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 NC ? B HEC . ? A HEC 112 ? 1_555 176.7 ? 6 NB ? B HEC . ? A HEC 112 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 NC ? B HEC . ? A HEC 112 ? 1_555 89.9 ? 7 NE2 ? A HIS 27 ? A HIS 26 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 ND ? B HEC . ? A HEC 112 ? 1_555 90.2 ? 8 NA ? B HEC . ? A HEC 112 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 ND ? B HEC . ? A HEC 112 ? 1_555 90.5 ? 9 NB ? B HEC . ? A HEC 112 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 ND ? B HEC . ? A HEC 112 ? 1_555 175.9 ? 10 NC ? B HEC . ? A HEC 112 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 ND ? B HEC . ? A HEC 112 ? 1_555 88.1 ? 11 NE2 ? A HIS 27 ? A HIS 26 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 SD ? A MET 89 ? A MET 88 ? 1_555 178.3 ? 12 NA ? B HEC . ? A HEC 112 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 SD ? A MET 89 ? A MET 88 ? 1_555 88.7 ? 13 NB ? B HEC . ? A HEC 112 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 SD ? A MET 89 ? A MET 88 ? 1_555 95.6 ? 14 NC ? B HEC . ? A HEC 112 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 SD ? A MET 89 ? A MET 88 ? 1_555 94.3 ? 15 ND ? B HEC . ? A HEC 112 ? 1_555 FE ? B HEC . ? A HEC 112 ? 1_555 SD ? A MET 89 ? A MET 88 ? 1_555 88.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1983-04-21 2 'Structure model' 1 1 2008-03-21 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 5 'Structure model' 2 0 2021-03-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other 5 5 'Structure model' 'Atomic model' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' 'Non-polymer description' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' struct_conf 3 4 'Structure model' struct_conf_type 4 5 'Structure model' atom_site 5 5 'Structure model' chem_comp 6 5 'Structure model' entity 7 5 'Structure model' pdbx_entity_nonpoly 8 5 'Structure model' pdbx_nonpoly_scheme 9 5 'Structure model' pdbx_struct_conn_angle 10 5 'Structure model' struct_conn 11 5 'Structure model' struct_ref_seq_dif 12 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.process_site' 2 5 'Structure model' '_atom_site.B_iso_or_equiv' 3 5 'Structure model' '_atom_site.Cartn_x' 4 5 'Structure model' '_atom_site.Cartn_y' 5 5 'Structure model' '_atom_site.Cartn_z' 6 5 'Structure model' '_atom_site.auth_atom_id' 7 5 'Structure model' '_atom_site.auth_comp_id' 8 5 'Structure model' '_atom_site.label_atom_id' 9 5 'Structure model' '_atom_site.label_comp_id' 10 5 'Structure model' '_atom_site.type_symbol' 11 5 'Structure model' '_chem_comp.formula' 12 5 'Structure model' '_chem_comp.formula_weight' 13 5 'Structure model' '_chem_comp.id' 14 5 'Structure model' '_chem_comp.name' 15 5 'Structure model' '_chem_comp.pdbx_synonyms' 16 5 'Structure model' '_entity.formula_weight' 17 5 'Structure model' '_entity.pdbx_description' 18 5 'Structure model' '_pdbx_entity_nonpoly.comp_id' 19 5 'Structure model' '_pdbx_entity_nonpoly.name' 20 5 'Structure model' '_pdbx_nonpoly_scheme.mon_id' 21 5 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id' 22 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 23 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 24 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 25 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 26 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 27 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 28 5 'Structure model' '_struct_conn.conn_type_id' 29 5 'Structure model' '_struct_conn.id' 30 5 'Structure model' '_struct_conn.pdbx_dist_value' 31 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 32 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 33 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 34 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 35 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 36 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 37 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 38 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 39 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 40 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 41 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 42 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 43 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 44 5 'Structure model' '_struct_ref_seq_dif.details' 45 5 'Structure model' '_struct_site.details' 46 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 47 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 48 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 CE A MET 63 ? ? 1_555 O A HOH 118 ? ? 6_555 1.23 2 1 O A HOH 128 ? ? 1_555 O A HOH 133 ? ? 6_665 2.04 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 ARG _pdbx_validate_rmsd_bond.auth_seq_id_1 99 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 NE _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 ARG _pdbx_validate_rmsd_bond.auth_seq_id_2 99 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.302 _pdbx_validate_rmsd_bond.bond_target_value 1.460 _pdbx_validate_rmsd_bond.bond_deviation -0.158 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.017 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A GLU 5 ? ? CB A GLU 5 ? ? CG A GLU 5 ? ? 129.14 113.40 15.74 2.20 N 2 1 CA A LYS 12 ? ? CB A LYS 12 ? ? CG A LYS 12 ? ? 129.08 113.40 15.68 2.20 N 3 1 NH1 A ARG 46 ? ? CZ A ARG 46 ? ? NH2 A ARG 46 ? ? 108.27 119.40 -11.13 1.10 N 4 1 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 127.24 120.30 6.94 0.50 N 5 1 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH2 A ARG 46 ? ? 123.35 120.30 3.05 0.50 N 6 1 CG A GLU 68 ? ? CD A GLU 68 ? ? OE1 A GLU 68 ? ? 130.40 118.30 12.10 2.00 N 7 1 CG A ARG 99 ? ? CD A ARG 99 ? ? NE A ARG 99 ? ? 134.73 111.80 22.93 2.10 N 8 1 CD A ARG 99 ? ? NE A ARG 99 ? ? CZ A ARG 99 ? ? 156.97 123.60 33.37 1.40 N 9 1 NE A ARG 99 ? ? CZ A ARG 99 ? ? NH1 A ARG 99 ? ? 125.20 120.30 4.90 0.50 N 10 1 NE A ARG 99 ? ? CZ A ARG 99 ? ? NH2 A ARG 99 ? ? 111.63 120.30 -8.67 0.50 N 11 1 CA A GLU 108 ? ? CB A GLU 108 ? ? CG A GLU 108 ? ? 127.10 113.40 13.70 2.20 N 12 1 CB A GLU 108 ? ? CG A GLU 108 ? ? CD A GLU 108 ? ? 130.97 114.20 16.77 2.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 35 ? ? -131.68 -143.07 2 1 ASN A 78 ? ? -166.77 86.27 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 46 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.149 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'HEME C' HEC 3 water HOH #