data_1D6B # _entry.id 1D6B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1D6B pdb_00001d6b 10.2210/pdb1d6b/pdb RCSB RCSB009827 ? ? WWPDB D_1000009827 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-06-21 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' pdbx_entry_details 9 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1D6B _pdbx_database_status.recvd_initial_deposition_date 1999-10-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1B8W _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Torres, A.M.' 1 'De Plater, G.M.' 2 'Doverskog, M.' 3 'C Birinyi-Strachan, L.' 4 'Nicholson, G.M.' 5 'Gallagher, C.H.' 6 'Kuchel, P.W.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Defensin-like peptide-2 from platypus venom: member of a class of peptides with a distinct structural fold.' Biochem.J. 348 649 656 2000 BIJOAK UK 0264-6021 0043 ? 10839998 10.1042/0264-6021:3480649 1 'Solution Structure of a Defensin-Like Peptide From Platypus Venom' Biochem.J. 341 785 794 1999 BIJOAK UK 0264-6021 0043 ? ? 10.1042/0264-6021:3410785 2 ;Solution Structure of Bovine Neutrophil Beta-Defensin-12: The Peptide Fold of the Beta-Defensins is Identical to That of the Classical Defensins ; Biochemistry 34 13663 13671 1995 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Torres, A.M.' 1 ? primary 'de Plater, G.M.' 2 ? primary 'Doverskog, M.' 3 ? primary 'Birinyi-Strachan, L.C.' 4 ? primary 'Nicholson, G.M.' 5 ? primary 'Gallagher, C.H.' 6 ? primary 'Kuchel, P.W.' 7 ? 1 'Torres, A.M.' 8 ? 1 'Wang, X.' 9 ? 1 'Fletcher, J.I.' 10 ? 1 'Alewood, D.' 11 ? 1 'Alewood, P.F.' 12 ? 1 'Smith, R.' 13 ? 1 'Simpson, R.J.' 14 ? 1 'Nicholson, G.M.' 15 ? 1 'Sutherland, S.K.' 16 ? 1 'Gallagher, C.H.' 17 ? 1 'King, G.F.' 18 ? 1 'Kuchel, P.W.' 19 ? 2 'Zimmermann, G.R.' 20 ? 2 'Legault, P.' 21 ? 2 'Selsted, M.E.' 22 ? 2 'Pardi, A.' 23 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'DEFENSIN-LIKE PEPTIDE-2' _entity.formula_weight 5121.899 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code IMFFEMQACWSHSGVCRDKSERNCKPMAWTYCENRNQKCCEY _entity_poly.pdbx_seq_one_letter_code_can IMFFEMQACWSHSGVCRDKSERNCKPMAWTYCENRNQKCCEY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 MET n 1 3 PHE n 1 4 PHE n 1 5 GLU n 1 6 MET n 1 7 GLN n 1 8 ALA n 1 9 CYS n 1 10 TRP n 1 11 SER n 1 12 HIS n 1 13 SER n 1 14 GLY n 1 15 VAL n 1 16 CYS n 1 17 ARG n 1 18 ASP n 1 19 LYS n 1 20 SER n 1 21 GLU n 1 22 ARG n 1 23 ASN n 1 24 CYS n 1 25 LYS n 1 26 PRO n 1 27 MET n 1 28 ALA n 1 29 TRP n 1 30 THR n 1 31 TYR n 1 32 CYS n 1 33 GLU n 1 34 ASN n 1 35 ARG n 1 36 ASN n 1 37 GLN n 1 38 LYS n 1 39 CYS n 1 40 CYS n 1 41 GLU n 1 42 TYR n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name platypus _entity_src_nat.pdbx_organism_scientific 'Ornithorhynchus anatinus' _entity_src_nat.pdbx_ncbi_taxonomy_id 9258 _entity_src_nat.genus Ornithorhynchus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue 'VENOM GLAND' _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion VENOM _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ SPUR _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 1 ILE ILE A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 TYR 42 42 42 TYR TYR A . n # _cell.entry_id 1D6B _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1D6B _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1D6B _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1D6B _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1D6B _struct.title 'SOLUTION STRUCTURE OF DEFENSIN-LIKE PEPTIDE-2 (DLP-2) FROM PLATYPUS VENOM' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1D6B _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'HELIX, ANTIPARALLEL BETA-SHEET, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DLP2_ORNAN _struct_ref.pdbx_db_accession P82140 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1D6B _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 42 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P82140 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 42 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 42 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 8 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 13 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 8 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 13 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 9 A CYS 39 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 16 A CYS 32 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 24 A CYS 40 1_555 ? ? ? ? ? ? ? 2.030 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 9 ? CYS A 39 ? CYS A 9 ? 1_555 CYS A 39 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 16 ? CYS A 32 ? CYS A 16 ? 1_555 CYS A 32 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 24 ? CYS A 40 ? CYS A 24 ? 1_555 CYS A 40 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 15 ? ASP A 18 ? VAL A 15 ASP A 18 A 2 GLN A 37 ? CYS A 40 ? GLN A 37 CYS A 40 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 17 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 17 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 38 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 38 # _pdbx_entry_details.entry_id 1D6B _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG2 A GLU 21 ? ? HB2 A CYS 24 ? ? 1.18 2 1 HG3 A GLU 21 ? ? H A ASN 23 ? ? 1.25 3 1 HG12 A VAL 15 ? ? H A CYS 16 ? ? 1.28 4 3 HG2 A GLU 21 ? ? HB2 A CYS 24 ? ? 1.19 5 3 HB3 A MET 6 ? ? H A GLN 7 ? ? 1.28 6 3 HA A CYS 9 ? ? HE2 A HIS 12 ? ? 1.32 7 3 HG3 A GLU 21 ? ? H A ASN 23 ? ? 1.33 8 4 HG3 A GLU 21 ? ? H A ASN 23 ? ? 1.23 9 4 HA A LYS 19 ? ? HG3 A LYS 38 ? ? 1.24 10 5 HG2 A GLU 21 ? ? HB2 A CYS 24 ? ? 1.16 11 5 HG3 A GLU 21 ? ? H A ASN 23 ? ? 1.22 12 5 OE2 A GLU 21 ? ? O A ASN 23 ? ? 2.18 13 6 HG2 A GLU 21 ? ? HB2 A CYS 24 ? ? 1.19 14 6 HG3 A GLU 21 ? ? H A ASN 23 ? ? 1.28 15 6 OE2 A GLU 21 ? ? O A ASN 23 ? ? 2.17 16 7 HG3 A LYS 25 ? ? HB2 A GLU 41 ? ? 1.28 17 9 HB3 A LYS 19 ? ? HD3 A LYS 38 ? ? 1.20 18 9 HE2 A MET 27 ? ? HA A GLU 41 ? ? 1.20 19 9 HB2 A LYS 25 ? ? H A GLU 41 ? ? 1.22 20 11 HD21 A ASN 34 ? ? H A ASN 36 ? ? 1.26 21 12 HB3 A PHE 3 ? ? H A PHE 4 ? ? 1.26 22 13 HB3 A CYS 24 ? ? HZ1 A LYS 38 ? ? 1.34 23 14 HB2 A CYS 16 ? ? HB2 A CYS 32 ? ? 1.34 24 17 HB2 A LYS 25 ? ? H A GLU 41 ? ? 1.18 25 17 HD3 A LYS 19 ? ? H A SER 20 ? ? 1.28 26 18 H A GLN 7 ? ? HA A THR 30 ? ? 1.22 27 18 HG3 A LYS 25 ? ? HB3 A GLU 41 ? ? 1.26 28 18 HB2 A GLN 7 ? ? HG23 A THR 30 ? ? 1.27 29 20 HG2 A LYS 19 ? ? HG2 A LYS 38 ? ? 1.20 30 20 HG2 A MET 6 ? ? H A THR 30 ? ? 1.27 31 20 HB3 A ASN 34 ? ? HB2 A GLN 37 ? ? 1.27 32 20 HG12 A VAL 15 ? ? H A CYS 16 ? ? 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 2 ? ? 70.75 -165.70 2 1 PHE A 4 ? ? 154.55 -119.04 3 1 GLU A 5 ? ? 13.82 84.26 4 1 MET A 6 ? ? -43.99 -108.66 5 1 ALA A 8 ? ? -23.11 115.83 6 1 SER A 13 ? ? 81.05 72.82 7 1 ASP A 18 ? ? -35.54 133.30 8 1 ALA A 28 ? ? -47.04 176.26 9 1 TRP A 29 ? ? 40.17 73.81 10 1 THR A 30 ? ? 159.14 137.01 11 1 ARG A 35 ? ? -67.06 12.88 12 1 GLU A 41 ? ? -50.69 -73.01 13 2 MET A 2 ? ? -51.73 77.58 14 2 PHE A 3 ? ? -137.50 -126.66 15 2 PHE A 4 ? ? 86.22 76.50 16 2 GLU A 5 ? ? -1.85 69.28 17 2 MET A 6 ? ? -36.74 -93.83 18 2 ALA A 8 ? ? -21.78 129.69 19 2 PRO A 26 ? ? -44.22 96.29 20 2 ALA A 28 ? ? -62.71 -171.58 21 2 TRP A 29 ? ? 40.10 75.44 22 2 THR A 30 ? ? 162.88 157.49 23 2 ARG A 35 ? ? -60.12 17.52 24 2 GLU A 41 ? ? -42.63 -74.01 25 3 PHE A 3 ? ? -102.22 65.29 26 3 MET A 6 ? ? -52.91 -134.66 27 3 ALA A 8 ? ? -30.80 103.35 28 3 CYS A 9 ? ? -31.20 -25.95 29 3 SER A 13 ? ? 61.78 77.43 30 3 PRO A 26 ? ? -47.66 99.92 31 3 ALA A 28 ? ? -52.44 177.58 32 3 TRP A 29 ? ? 39.76 72.89 33 3 THR A 30 ? ? 165.11 150.06 34 3 ARG A 35 ? ? -64.99 12.48 35 3 GLU A 41 ? ? -56.24 -76.10 36 4 PHE A 4 ? ? 67.32 109.89 37 4 GLU A 5 ? ? 170.70 83.45 38 4 MET A 6 ? ? -54.60 -138.70 39 4 GLN A 7 ? ? -127.18 -149.59 40 4 CYS A 9 ? ? -33.60 -24.60 41 4 SER A 11 ? ? -56.30 10.05 42 4 SER A 13 ? ? 89.51 65.51 43 4 PRO A 26 ? ? -52.86 108.49 44 4 MET A 27 ? ? -103.39 76.15 45 4 ALA A 28 ? ? -46.54 -166.74 46 4 TRP A 29 ? ? 36.34 66.11 47 4 THR A 30 ? ? 153.09 147.87 48 4 ARG A 35 ? ? -66.52 15.65 49 5 PHE A 3 ? ? -98.49 39.46 50 5 PHE A 4 ? ? -93.90 56.51 51 5 MET A 6 ? ? -50.01 -157.35 52 5 ALA A 8 ? ? -35.11 126.08 53 5 PRO A 26 ? ? -37.13 110.19 54 5 ALA A 28 ? ? -51.62 -176.41 55 5 TRP A 29 ? ? 37.43 72.16 56 5 THR A 30 ? ? 160.72 133.25 57 5 TYR A 31 ? ? -117.84 -169.93 58 5 GLU A 41 ? ? -51.53 -72.14 59 6 MET A 2 ? ? 44.19 99.87 60 6 PHE A 4 ? ? 18.13 81.14 61 6 GLU A 5 ? ? 162.30 122.36 62 6 MET A 6 ? ? -77.79 -126.96 63 6 SER A 13 ? ? 39.29 63.42 64 6 ASP A 18 ? ? -30.80 148.52 65 6 PRO A 26 ? ? -37.68 99.19 66 6 ALA A 28 ? ? -66.09 -174.08 67 6 TRP A 29 ? ? 37.84 74.63 68 6 THR A 30 ? ? 154.55 148.60 69 6 GLU A 41 ? ? -50.70 -90.94 70 7 MET A 2 ? ? 88.13 151.47 71 7 PHE A 3 ? ? -145.09 -85.94 72 7 PHE A 4 ? ? -144.11 -139.29 73 7 GLU A 5 ? ? 48.40 100.53 74 7 MET A 6 ? ? -66.63 -113.07 75 7 ALA A 8 ? ? -29.22 118.61 76 7 SER A 13 ? ? 40.02 73.71 77 7 ASP A 18 ? ? -35.67 133.33 78 7 LYS A 25 ? ? -39.43 102.69 79 7 PRO A 26 ? ? -58.90 107.59 80 7 TRP A 29 ? ? 39.09 72.91 81 7 THR A 30 ? ? 165.65 145.13 82 8 PHE A 3 ? ? -119.94 -99.59 83 8 GLU A 5 ? ? 171.10 50.61 84 8 MET A 6 ? ? -67.93 -99.06 85 8 SER A 13 ? ? 72.40 76.67 86 8 ARG A 17 ? ? -128.48 -166.28 87 8 LYS A 19 ? ? -58.95 15.27 88 8 GLU A 21 ? ? -36.24 148.65 89 8 ASN A 23 ? ? -141.94 44.04 90 8 PRO A 26 ? ? -42.16 108.11 91 8 ALA A 28 ? ? -54.96 -170.67 92 8 TRP A 29 ? ? 40.21 74.03 93 8 THR A 30 ? ? 160.41 157.33 94 9 MET A 2 ? ? 24.80 88.56 95 9 PHE A 4 ? ? -27.26 88.08 96 9 GLU A 5 ? ? 170.89 119.69 97 9 MET A 6 ? ? -69.18 -119.76 98 9 ALA A 8 ? ? -23.43 105.56 99 9 CYS A 9 ? ? -29.78 -28.98 100 9 SER A 13 ? ? 83.61 64.60 101 9 SER A 20 ? ? -60.47 10.30 102 9 LYS A 25 ? ? -51.44 99.33 103 9 PRO A 26 ? ? -41.99 93.50 104 9 TRP A 29 ? ? 37.87 73.04 105 9 THR A 30 ? ? 172.79 135.52 106 10 PHE A 4 ? ? -71.18 37.64 107 10 GLU A 5 ? ? -99.90 59.03 108 10 MET A 6 ? ? -59.52 -113.33 109 10 ALA A 8 ? ? -23.50 139.95 110 10 SER A 13 ? ? 25.60 61.85 111 10 ASP A 18 ? ? -30.33 127.66 112 10 LYS A 19 ? ? -43.82 -13.77 113 10 ASN A 23 ? ? -109.51 71.16 114 10 LYS A 25 ? ? -55.57 109.83 115 10 PRO A 26 ? ? -40.92 94.89 116 10 ALA A 28 ? ? -56.99 -168.93 117 10 TRP A 29 ? ? 39.90 74.30 118 10 THR A 30 ? ? 162.89 148.11 119 10 CYS A 32 ? ? -109.38 -162.21 120 11 PHE A 4 ? ? -162.38 58.40 121 11 GLU A 5 ? ? -166.87 91.54 122 11 MET A 6 ? ? -74.98 -150.54 123 11 GLN A 7 ? ? -141.89 -125.11 124 11 CYS A 9 ? ? -35.62 -25.36 125 11 SER A 11 ? ? -48.61 -19.77 126 11 SER A 13 ? ? 82.32 70.23 127 11 ASP A 18 ? ? -35.47 134.20 128 11 LYS A 25 ? ? -57.25 102.22 129 11 PRO A 26 ? ? -43.64 98.72 130 11 MET A 27 ? ? -105.54 78.11 131 11 ALA A 28 ? ? -48.68 -171.06 132 11 TRP A 29 ? ? 38.34 73.83 133 11 THR A 30 ? ? 159.41 142.36 134 11 CYS A 32 ? ? -111.56 -159.36 135 11 GLU A 41 ? ? -29.73 -55.85 136 12 MET A 2 ? ? -20.17 141.06 137 12 PHE A 3 ? ? -124.12 -125.77 138 12 PHE A 4 ? ? -158.25 12.73 139 12 GLU A 5 ? ? -107.57 59.98 140 12 MET A 6 ? ? -70.50 -100.77 141 12 ALA A 8 ? ? -32.91 120.37 142 12 CYS A 9 ? ? -33.63 -28.44 143 12 SER A 11 ? ? -36.56 -32.62 144 12 SER A 13 ? ? 76.33 81.87 145 12 LYS A 19 ? ? -49.65 -4.14 146 12 CYS A 24 ? ? -107.61 78.92 147 12 LYS A 25 ? ? -47.08 104.09 148 12 PRO A 26 ? ? -45.85 100.90 149 12 ALA A 28 ? ? -65.51 -179.87 150 12 TRP A 29 ? ? 37.16 71.49 151 12 THR A 30 ? ? 162.69 136.69 152 12 ARG A 35 ? ? -58.33 14.90 153 12 GLU A 41 ? ? -30.77 -84.40 154 13 PHE A 3 ? ? -126.48 -124.70 155 13 GLU A 5 ? ? -160.87 106.78 156 13 MET A 6 ? ? -55.71 -111.44 157 13 ALA A 8 ? ? -32.48 114.58 158 13 CYS A 9 ? ? -36.29 -28.05 159 13 SER A 11 ? ? -39.35 -26.87 160 13 SER A 13 ? ? 78.84 67.71 161 13 LYS A 19 ? ? -31.51 -37.08 162 13 SER A 20 ? ? -78.15 21.56 163 13 ASN A 23 ? ? -116.69 69.83 164 13 LYS A 25 ? ? -42.85 104.74 165 13 PRO A 26 ? ? -45.44 98.55 166 13 ALA A 28 ? ? -57.09 -175.37 167 13 TRP A 29 ? ? 37.78 73.50 168 13 THR A 30 ? ? 160.38 138.08 169 13 ARG A 35 ? ? -63.40 11.59 170 13 GLU A 41 ? ? -41.58 -72.60 171 14 PHE A 4 ? ? -167.45 -128.94 172 14 GLU A 5 ? ? 64.01 108.19 173 14 MET A 6 ? ? -70.49 -166.11 174 14 SER A 13 ? ? 59.32 78.12 175 14 ASP A 18 ? ? -32.91 140.31 176 14 LYS A 19 ? ? -59.36 8.42 177 14 LYS A 25 ? ? -58.65 100.73 178 14 PRO A 26 ? ? -43.41 95.38 179 14 ALA A 28 ? ? -50.15 -168.98 180 14 TRP A 29 ? ? 34.31 66.73 181 14 THR A 30 ? ? 150.21 140.42 182 14 TYR A 31 ? ? -112.07 -158.94 183 14 ARG A 35 ? ? -61.91 17.62 184 15 MET A 2 ? ? 69.21 64.31 185 15 PHE A 3 ? ? -93.55 -80.75 186 15 PHE A 4 ? ? -108.23 -153.61 187 15 GLU A 5 ? ? 66.38 106.89 188 15 MET A 6 ? ? -59.64 -154.93 189 15 ALA A 8 ? ? -12.79 110.66 190 15 CYS A 9 ? ? -26.59 -32.02 191 15 SER A 11 ? ? -49.53 3.92 192 15 SER A 13 ? ? 91.99 70.63 193 15 LYS A 19 ? ? -58.38 -1.47 194 15 PRO A 26 ? ? -48.82 99.25 195 15 TRP A 29 ? ? 36.85 71.78 196 15 ARG A 35 ? ? -67.21 16.17 197 15 GLU A 41 ? ? -26.12 -55.41 198 16 MET A 2 ? ? 175.47 -149.27 199 16 PHE A 3 ? ? -149.00 -127.45 200 16 PHE A 4 ? ? 28.39 52.23 201 16 GLU A 5 ? ? -157.93 67.04 202 16 MET A 6 ? ? -62.07 -155.96 203 16 CYS A 9 ? ? -35.29 -25.29 204 16 SER A 11 ? ? -29.86 -27.24 205 16 SER A 13 ? ? 85.85 80.09 206 16 ASP A 18 ? ? -29.77 134.71 207 16 LYS A 19 ? ? -60.90 12.27 208 16 PRO A 26 ? ? -41.03 103.29 209 16 ALA A 28 ? ? -56.08 -176.44 210 16 TRP A 29 ? ? 36.25 72.56 211 16 THR A 30 ? ? 152.80 145.61 212 16 CYS A 32 ? ? -100.65 -169.63 213 16 ARG A 35 ? ? -60.07 14.90 214 16 GLU A 41 ? ? -53.84 -82.40 215 17 PHE A 3 ? ? -134.62 -65.25 216 17 MET A 6 ? ? -96.34 -155.17 217 17 ALA A 8 ? ? -27.47 121.95 218 17 SER A 11 ? ? -51.80 -3.43 219 17 SER A 13 ? ? 29.72 64.46 220 17 ASP A 18 ? ? -39.51 140.07 221 17 LYS A 25 ? ? -58.21 105.79 222 17 PRO A 26 ? ? -44.99 86.48 223 17 ALA A 28 ? ? -66.57 -172.58 224 17 TRP A 29 ? ? 38.43 73.91 225 17 THR A 30 ? ? 172.68 146.15 226 18 PHE A 4 ? ? -46.50 75.38 227 18 MET A 6 ? ? -56.71 -172.98 228 18 ALA A 8 ? ? -43.14 109.61 229 18 CYS A 9 ? ? -29.32 -28.17 230 18 SER A 11 ? ? -49.40 1.15 231 18 SER A 13 ? ? 77.41 71.86 232 18 LYS A 19 ? ? -48.89 -2.31 233 18 ASN A 23 ? ? -114.35 70.50 234 18 LYS A 25 ? ? -54.98 106.74 235 18 PRO A 26 ? ? -50.28 108.66 236 18 ALA A 28 ? ? -75.64 -156.45 237 18 TRP A 29 ? ? 21.28 39.91 238 18 ARG A 35 ? ? -61.89 7.18 239 19 MET A 2 ? ? 69.76 139.66 240 19 GLU A 5 ? ? -107.02 75.04 241 19 MET A 6 ? ? -79.65 -115.40 242 19 ALA A 8 ? ? -37.67 115.13 243 19 CYS A 9 ? ? -33.11 -33.04 244 19 SER A 11 ? ? -60.06 0.67 245 19 PRO A 26 ? ? -50.19 99.23 246 19 TRP A 29 ? ? 38.13 74.49 247 19 THR A 30 ? ? 162.73 153.34 248 20 MET A 2 ? ? 23.96 52.78 249 20 PHE A 3 ? ? -145.52 -13.63 250 20 PHE A 4 ? ? 73.19 49.18 251 20 GLU A 5 ? ? -103.43 46.16 252 20 MET A 6 ? ? -48.55 -173.61 253 20 ALA A 8 ? ? -33.35 117.25 254 20 CYS A 9 ? ? -34.82 -29.03 255 20 SER A 13 ? ? 85.99 65.09 256 20 LYS A 19 ? ? -34.16 -20.62 257 20 LYS A 25 ? ? -54.97 104.96 258 20 PRO A 26 ? ? -45.87 93.37 259 20 ALA A 28 ? ? -67.31 -170.72 260 20 TRP A 29 ? ? 38.21 73.60 261 20 THR A 30 ? ? 159.22 138.51 262 20 CYS A 32 ? ? -101.65 -167.87 # _pdbx_nmr_ensemble.entry_id 1D6B _pdbx_nmr_ensemble.conformers_calculated_total_number 4800 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1D6B _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1MM DLP-2' _pdbx_nmr_sample_details.solvent_system ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 3.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 'NO SALT ADDED' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '2D NOESY' _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_details.entry_id 1D6B _pdbx_nmr_details.text 'THE STRUCTURES WERE DETERMINED USING STANDARD 2D HOMONUCLEAR TECHNIQUES.' # _pdbx_nmr_refine.entry_id 1D6B _pdbx_nmr_refine.method ;DISTANCE GEOMETRY, SIMULATED ANNEALING, MOLECULAR DYNAMICS, TORSION ANGLE DYNAMICS ; _pdbx_nmr_refine.details ;THE STRUCTURES ARE BASED ON A TOTAL OF 739 RESTRAINTS, 699 ARE NOE-DERIVED DISTANCE RESTRAINTS, 24 DIHEDRAL ANGLE RESTRAINTS, 16 DISTANCE RESTRAINTS FROM HYDROGEN BONDS. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing XwinNMR 2.5 BRUKER 1 'data analysis' XEASY 1.3.13 'BARTELS, C., XIA, T., BILLETER, M., GUNTERT, P., WUTHRICH, K.' 2 'structure solution' DYANA 1.5 'GUNTERT, P., MUMENTHALER, C., WUHTRICH, K.' 3 refinement X-PLOR 3.843 BRUNGER 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LYS N N N N 180 LYS CA C N S 181 LYS C C N N 182 LYS O O N N 183 LYS CB C N N 184 LYS CG C N N 185 LYS CD C N N 186 LYS CE C N N 187 LYS NZ N N N 188 LYS OXT O N N 189 LYS H H N N 190 LYS H2 H N N 191 LYS HA H N N 192 LYS HB2 H N N 193 LYS HB3 H N N 194 LYS HG2 H N N 195 LYS HG3 H N N 196 LYS HD2 H N N 197 LYS HD3 H N N 198 LYS HE2 H N N 199 LYS HE3 H N N 200 LYS HZ1 H N N 201 LYS HZ2 H N N 202 LYS HZ3 H N N 203 LYS HXT H N N 204 MET N N N N 205 MET CA C N S 206 MET C C N N 207 MET O O N N 208 MET CB C N N 209 MET CG C N N 210 MET SD S N N 211 MET CE C N N 212 MET OXT O N N 213 MET H H N N 214 MET H2 H N N 215 MET HA H N N 216 MET HB2 H N N 217 MET HB3 H N N 218 MET HG2 H N N 219 MET HG3 H N N 220 MET HE1 H N N 221 MET HE2 H N N 222 MET HE3 H N N 223 MET HXT H N N 224 PHE N N N N 225 PHE CA C N S 226 PHE C C N N 227 PHE O O N N 228 PHE CB C N N 229 PHE CG C Y N 230 PHE CD1 C Y N 231 PHE CD2 C Y N 232 PHE CE1 C Y N 233 PHE CE2 C Y N 234 PHE CZ C Y N 235 PHE OXT O N N 236 PHE H H N N 237 PHE H2 H N N 238 PHE HA H N N 239 PHE HB2 H N N 240 PHE HB3 H N N 241 PHE HD1 H N N 242 PHE HD2 H N N 243 PHE HE1 H N N 244 PHE HE2 H N N 245 PHE HZ H N N 246 PHE HXT H N N 247 PRO N N N N 248 PRO CA C N S 249 PRO C C N N 250 PRO O O N N 251 PRO CB C N N 252 PRO CG C N N 253 PRO CD C N N 254 PRO OXT O N N 255 PRO H H N N 256 PRO HA H N N 257 PRO HB2 H N N 258 PRO HB3 H N N 259 PRO HG2 H N N 260 PRO HG3 H N N 261 PRO HD2 H N N 262 PRO HD3 H N N 263 PRO HXT H N N 264 SER N N N N 265 SER CA C N S 266 SER C C N N 267 SER O O N N 268 SER CB C N N 269 SER OG O N N 270 SER OXT O N N 271 SER H H N N 272 SER H2 H N N 273 SER HA H N N 274 SER HB2 H N N 275 SER HB3 H N N 276 SER HG H N N 277 SER HXT H N N 278 THR N N N N 279 THR CA C N S 280 THR C C N N 281 THR O O N N 282 THR CB C N R 283 THR OG1 O N N 284 THR CG2 C N N 285 THR OXT O N N 286 THR H H N N 287 THR H2 H N N 288 THR HA H N N 289 THR HB H N N 290 THR HG1 H N N 291 THR HG21 H N N 292 THR HG22 H N N 293 THR HG23 H N N 294 THR HXT H N N 295 TRP N N N N 296 TRP CA C N S 297 TRP C C N N 298 TRP O O N N 299 TRP CB C N N 300 TRP CG C Y N 301 TRP CD1 C Y N 302 TRP CD2 C Y N 303 TRP NE1 N Y N 304 TRP CE2 C Y N 305 TRP CE3 C Y N 306 TRP CZ2 C Y N 307 TRP CZ3 C Y N 308 TRP CH2 C Y N 309 TRP OXT O N N 310 TRP H H N N 311 TRP H2 H N N 312 TRP HA H N N 313 TRP HB2 H N N 314 TRP HB3 H N N 315 TRP HD1 H N N 316 TRP HE1 H N N 317 TRP HE3 H N N 318 TRP HZ2 H N N 319 TRP HZ3 H N N 320 TRP HH2 H N N 321 TRP HXT H N N 322 TYR N N N N 323 TYR CA C N S 324 TYR C C N N 325 TYR O O N N 326 TYR CB C N N 327 TYR CG C Y N 328 TYR CD1 C Y N 329 TYR CD2 C Y N 330 TYR CE1 C Y N 331 TYR CE2 C Y N 332 TYR CZ C Y N 333 TYR OH O N N 334 TYR OXT O N N 335 TYR H H N N 336 TYR H2 H N N 337 TYR HA H N N 338 TYR HB2 H N N 339 TYR HB3 H N N 340 TYR HD1 H N N 341 TYR HD2 H N N 342 TYR HE1 H N N 343 TYR HE2 H N N 344 TYR HH H N N 345 TYR HXT H N N 346 VAL N N N N 347 VAL CA C N S 348 VAL C C N N 349 VAL O O N N 350 VAL CB C N N 351 VAL CG1 C N N 352 VAL CG2 C N N 353 VAL OXT O N N 354 VAL H H N N 355 VAL H2 H N N 356 VAL HA H N N 357 VAL HB H N N 358 VAL HG11 H N N 359 VAL HG12 H N N 360 VAL HG13 H N N 361 VAL HG21 H N N 362 VAL HG22 H N N 363 VAL HG23 H N N 364 VAL HXT H N N 365 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TRP N CA sing N N 283 TRP N H sing N N 284 TRP N H2 sing N N 285 TRP CA C sing N N 286 TRP CA CB sing N N 287 TRP CA HA sing N N 288 TRP C O doub N N 289 TRP C OXT sing N N 290 TRP CB CG sing N N 291 TRP CB HB2 sing N N 292 TRP CB HB3 sing N N 293 TRP CG CD1 doub Y N 294 TRP CG CD2 sing Y N 295 TRP CD1 NE1 sing Y N 296 TRP CD1 HD1 sing N N 297 TRP CD2 CE2 doub Y N 298 TRP CD2 CE3 sing Y N 299 TRP NE1 CE2 sing Y N 300 TRP NE1 HE1 sing N N 301 TRP CE2 CZ2 sing Y N 302 TRP CE3 CZ3 doub Y N 303 TRP CE3 HE3 sing N N 304 TRP CZ2 CH2 doub Y N 305 TRP CZ2 HZ2 sing N N 306 TRP CZ3 CH2 sing Y N 307 TRP CZ3 HZ3 sing N N 308 TRP CH2 HH2 sing N N 309 TRP OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 VAL N CA sing N N 335 VAL N H sing N N 336 VAL N H2 sing N N 337 VAL CA C sing N N 338 VAL CA CB sing N N 339 VAL CA HA sing N N 340 VAL C O doub N N 341 VAL C OXT sing N N 342 VAL CB CG1 sing N N 343 VAL CB CG2 sing N N 344 VAL CB HB sing N N 345 VAL CG1 HG11 sing N N 346 VAL CG1 HG12 sing N N 347 VAL CG1 HG13 sing N N 348 VAL CG2 HG21 sing N N 349 VAL CG2 HG22 sing N N 350 VAL CG2 HG23 sing N N 351 VAL OXT HXT sing N N 352 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 1D6B _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_