data_1D8Z # _entry.id 1D8Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1D8Z pdb_00001d8z 10.2210/pdb1d8z/pdb RCSB RCSB009903 ? ? WWPDB D_1000009903 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1D9A 'SECOND RNA-BINDING DOMAIN (RBD1) OF HUC' unspecified TargetDB trt001000201.1 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1D8Z _pdbx_database_status.recvd_initial_deposition_date 1999-10-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Inoue, M.' 1 'Muto, Y.' 2 'Sakamoto, H.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'NMR studies on functional structures of the AU-rich element-binding domains of Hu antigen C.' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 28 _citation.page_first 1743 _citation.page_last 1750 _citation.year 2000 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10734193 _citation.pdbx_database_id_DOI 10.1093/nar/28.8.1743 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Inoue, M.' 1 ? primary 'Muto, Y.' 2 ? primary 'Sakamoto, H.' 3 ? primary 'Yokoyama, S.' 4 ? # _cell.entry_id 1D8Z _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1D8Z _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HU ANTIGEN C' _entity.formula_weight 9847.118 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'FIRST RNA-BINDING DOMAIN (RBD1)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSY ARPSSASIR ; _entity_poly.pdbx_seq_one_letter_code_can ;MDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKITGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSY ARPSSASIR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier trt001000201.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 SER n 1 4 LYS n 1 5 THR n 1 6 ASN n 1 7 LEU n 1 8 ILE n 1 9 VAL n 1 10 ASN n 1 11 TYR n 1 12 LEU n 1 13 PRO n 1 14 GLN n 1 15 ASN n 1 16 MET n 1 17 THR n 1 18 GLN n 1 19 ASP n 1 20 GLU n 1 21 PHE n 1 22 LYS n 1 23 SER n 1 24 LEU n 1 25 PHE n 1 26 GLY n 1 27 SER n 1 28 ILE n 1 29 GLY n 1 30 ASP n 1 31 ILE n 1 32 GLU n 1 33 SER n 1 34 CYS n 1 35 LYS n 1 36 LEU n 1 37 VAL n 1 38 ARG n 1 39 ASP n 1 40 LYS n 1 41 ILE n 1 42 THR n 1 43 GLY n 1 44 GLN n 1 45 SER n 1 46 LEU n 1 47 GLY n 1 48 TYR n 1 49 GLY n 1 50 PHE n 1 51 VAL n 1 52 ASN n 1 53 TYR n 1 54 SER n 1 55 ASP n 1 56 PRO n 1 57 ASN n 1 58 ASP n 1 59 ALA n 1 60 ASP n 1 61 LYS n 1 62 ALA n 1 63 ILE n 1 64 ASN n 1 65 THR n 1 66 LEU n 1 67 ASN n 1 68 GLY n 1 69 LEU n 1 70 LYS n 1 71 LEU n 1 72 GLN n 1 73 THR n 1 74 LYS n 1 75 THR n 1 76 ILE n 1 77 LYS n 1 78 VAL n 1 79 SER n 1 80 TYR n 1 81 ALA n 1 82 ARG n 1 83 PRO n 1 84 SER n 1 85 SER n 1 86 ALA n 1 87 SER n 1 88 ILE n 1 89 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PK7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ELAV3_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q60900 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1D8Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q60900 _struct_ref_seq.db_align_beg 36 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 88 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1D8Z _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q60900 _struct_ref_seq_dif.db_mon_id ASP _struct_ref_seq_dif.pdbx_seq_db_seq_num 35 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 3D_15N-SEPARATED_NOESY 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 3.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2MM PROTEIN; 20 MM POTASSIUM OXALATE BUFFER; 90% H2O; 10% D2O' ? 2 '2MM PROTEIN U-15N; 20 MM POTASSIUM OXALATE BUFFER; 90% H2O; 10% D2O' ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1D8Z _pdbx_nmr_refine.method 'DISTANCE GEOMETRY AND SIMULATED ANNEALING' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1D8Z _pdbx_nmr_details.text ;THIS STRUCTURE WAS DETERMINED USING STANDARD 2D HOMONUCLEAR AND 15N-SEPARATED HETERONUCLEAR TECHNIQUES. ; # _pdbx_nmr_ensemble.entry_id 1D8Z _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' X-PLOR 3.1 BRUNGER 1 refinement X-PLOR 3.1 BRUNGER 2 # _exptl.entry_id 1D8Z _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1D8Z _struct.title 'SOLUTION STRUCTURE OF THE FIRST RNA-BINDING DOMAIN (RBD1) OF HU ANTIGEN C (HUC)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1D8Z _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'RNA-BINDING DOMAIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 17 ? SER A 27 ? THR A 16 SER A 26 1 ? 11 HELX_P HELX_P2 2 ASP A 55 ? ASN A 67 ? ASP A 54 ASN A 66 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 33 ? LEU A 36 ? SER A 32 LEU A 35 A 2 TYR A 48 ? ASN A 52 ? TYR A 47 ASN A 51 A 3 LEU A 7 ? ASN A 10 ? LEU A 6 ASN A 9 A 4 THR A 75 ? SER A 79 ? THR A 74 SER A 78 A 5 LEU A 69 ? LYS A 70 ? LEU A 68 LYS A 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 35 ? N LYS A 34 O PHE A 50 ? O PHE A 49 A 2 3 O VAL A 51 ? O VAL A 50 N LEU A 7 ? N LEU A 6 A 3 4 O ASN A 10 ? O ASN A 9 N LYS A 77 ? N LYS A 76 A 4 5 N ILE A 76 ? N ILE A 75 O LEU A 69 ? O LEU A 68 # _database_PDB_matrix.entry_id 1D8Z _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1D8Z _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 ASP 2 1 1 ASP ASP A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 LYS 4 3 3 LYS LYS A . n A 1 5 THR 5 4 4 THR THR A . n A 1 6 ASN 6 5 5 ASN ASN A . n A 1 7 LEU 7 6 6 LEU LEU A . n A 1 8 ILE 8 7 7 ILE ILE A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 ASN 10 9 9 ASN ASN A . n A 1 11 TYR 11 10 10 TYR TYR A . n A 1 12 LEU 12 11 11 LEU LEU A . n A 1 13 PRO 13 12 12 PRO PRO A . n A 1 14 GLN 14 13 13 GLN GLN A . n A 1 15 ASN 15 14 14 ASN ASN A . n A 1 16 MET 16 15 15 MET MET A . n A 1 17 THR 17 16 16 THR THR A . n A 1 18 GLN 18 17 17 GLN GLN A . n A 1 19 ASP 19 18 18 ASP ASP A . n A 1 20 GLU 20 19 19 GLU GLU A . n A 1 21 PHE 21 20 20 PHE PHE A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 SER 23 22 22 SER SER A . n A 1 24 LEU 24 23 23 LEU LEU A . n A 1 25 PHE 25 24 24 PHE PHE A . n A 1 26 GLY 26 25 25 GLY GLY A . n A 1 27 SER 27 26 26 SER SER A . n A 1 28 ILE 28 27 27 ILE ILE A . n A 1 29 GLY 29 28 28 GLY GLY A . n A 1 30 ASP 30 29 29 ASP ASP A . n A 1 31 ILE 31 30 30 ILE ILE A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 SER 33 32 32 SER SER A . n A 1 34 CYS 34 33 33 CYS CYS A . n A 1 35 LYS 35 34 34 LYS LYS A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 VAL 37 36 36 VAL VAL A . n A 1 38 ARG 38 37 37 ARG ARG A . n A 1 39 ASP 39 38 38 ASP ASP A . n A 1 40 LYS 40 39 39 LYS LYS A . n A 1 41 ILE 41 40 40 ILE ILE A . n A 1 42 THR 42 41 41 THR THR A . n A 1 43 GLY 43 42 42 GLY GLY A . n A 1 44 GLN 44 43 43 GLN GLN A . n A 1 45 SER 45 44 44 SER SER A . n A 1 46 LEU 46 45 45 LEU LEU A . n A 1 47 GLY 47 46 46 GLY GLY A . n A 1 48 TYR 48 47 47 TYR TYR A . n A 1 49 GLY 49 48 48 GLY GLY A . n A 1 50 PHE 50 49 49 PHE PHE A . n A 1 51 VAL 51 50 50 VAL VAL A . n A 1 52 ASN 52 51 51 ASN ASN A . n A 1 53 TYR 53 52 52 TYR TYR A . n A 1 54 SER 54 53 53 SER SER A . n A 1 55 ASP 55 54 54 ASP ASP A . n A 1 56 PRO 56 55 55 PRO PRO A . n A 1 57 ASN 57 56 56 ASN ASN A . n A 1 58 ASP 58 57 57 ASP ASP A . n A 1 59 ALA 59 58 58 ALA ALA A . n A 1 60 ASP 60 59 59 ASP ASP A . n A 1 61 LYS 61 60 60 LYS LYS A . n A 1 62 ALA 62 61 61 ALA ALA A . n A 1 63 ILE 63 62 62 ILE ILE A . n A 1 64 ASN 64 63 63 ASN ASN A . n A 1 65 THR 65 64 64 THR THR A . n A 1 66 LEU 66 65 65 LEU LEU A . n A 1 67 ASN 67 66 66 ASN ASN A . n A 1 68 GLY 68 67 67 GLY GLY A . n A 1 69 LEU 69 68 68 LEU LEU A . n A 1 70 LYS 70 69 69 LYS LYS A . n A 1 71 LEU 71 70 70 LEU LEU A . n A 1 72 GLN 72 71 71 GLN GLN A . n A 1 73 THR 73 72 72 THR THR A . n A 1 74 LYS 74 73 73 LYS LYS A . n A 1 75 THR 75 74 74 THR THR A . n A 1 76 ILE 76 75 75 ILE ILE A . n A 1 77 LYS 77 76 76 LYS LYS A . n A 1 78 VAL 78 77 77 VAL VAL A . n A 1 79 SER 79 78 78 SER SER A . n A 1 80 TYR 80 79 79 TYR TYR A . n A 1 81 ALA 81 80 80 ALA ALA A . n A 1 82 ARG 82 81 81 ARG ARG A . n A 1 83 PRO 83 82 82 PRO PRO A . n A 1 84 SER 84 83 83 SER SER A . n A 1 85 SER 85 84 84 SER SER A . n A 1 86 ALA 86 85 85 ALA ALA A . n A 1 87 SER 87 86 86 SER SER A . n A 1 88 ILE 88 87 87 ILE ILE A . n A 1 89 ARG 89 88 88 ARG ARG A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-04-07 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -159.07 -48.80 2 1 LYS A 3 ? ? 61.75 89.79 3 1 THR A 4 ? ? -118.40 71.48 4 1 THR A 16 ? ? -157.89 -154.79 5 1 SER A 26 ? ? -90.02 42.64 6 1 ILE A 27 ? ? -141.20 -39.08 7 1 ILE A 30 ? ? -55.11 90.49 8 1 GLU A 31 ? ? -37.11 -29.66 9 1 SER A 32 ? ? -172.65 115.70 10 1 LYS A 34 ? ? -175.41 71.36 11 1 ASP A 38 ? ? -43.71 161.83 12 1 ILE A 40 ? ? -111.72 -91.65 13 1 TYR A 47 ? ? -179.09 143.56 14 1 THR A 64 ? ? -133.29 -31.58 15 1 THR A 72 ? ? -154.56 21.42 16 1 SER A 83 ? ? -48.70 161.05 17 1 ALA A 85 ? ? 67.58 62.82 18 1 ILE A 87 ? ? -142.90 -62.70 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 37 ? ? 0.316 'SIDE CHAIN' 2 1 ARG A 81 ? ? 0.305 'SIDE CHAIN' 3 1 ARG A 88 ? ? 0.317 'SIDE CHAIN' #