data_1DE2 # _entry.id 1DE2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DE2 pdb_00001de2 10.2210/pdb1de2/pdb RCSB RCSB010007 ? ? WWPDB D_1000010007 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-11-24 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DE2 _pdbx_database_status.recvd_initial_deposition_date 1999-11-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1DE1 _pdbx_database_related.details 'OXIDIZED BACTERIOPHAGE T4 GLUTAREDOXIN' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, Y.' 1 'Wishart, D.S.' 2 # _citation.id primary _citation.title 'Solution structures of reduced and oxidized bacteriophage T4 glutaredoxin.' _citation.journal_abbrev J.Biomol.Nmr _citation.journal_volume 29 _citation.page_first 85 _citation.page_last 90 _citation.year 2004 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15017142 _citation.pdbx_database_id_DOI 10.1023/B:JNMR.0000019506.30351.ca # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, Y.' 1 ? primary 'Amegbey, G.' 2 ? primary 'Wishart, D.S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description GLUTAREDOXIN _entity.formula_weight 10063.631 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details REDUCED # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MFKVYGYDSNIHKCVYCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMPQVFAPDGSHIGGFD QLREYFK ; _entity_poly.pdbx_seq_one_letter_code_can ;MFKVYGYDSNIHKCVYCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMPQVFAPDGSHIGGFD QLREYFK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 LYS n 1 4 VAL n 1 5 TYR n 1 6 GLY n 1 7 TYR n 1 8 ASP n 1 9 SER n 1 10 ASN n 1 11 ILE n 1 12 HIS n 1 13 LYS n 1 14 CYS n 1 15 VAL n 1 16 TYR n 1 17 CYS n 1 18 ASP n 1 19 ASN n 1 20 ALA n 1 21 LYS n 1 22 ARG n 1 23 LEU n 1 24 LEU n 1 25 THR n 1 26 VAL n 1 27 LYS n 1 28 LYS n 1 29 GLN n 1 30 PRO n 1 31 PHE n 1 32 GLU n 1 33 PHE n 1 34 ILE n 1 35 ASN n 1 36 ILE n 1 37 MET n 1 38 PRO n 1 39 GLU n 1 40 LYS n 1 41 GLY n 1 42 VAL n 1 43 PHE n 1 44 ASP n 1 45 ASP n 1 46 GLU n 1 47 LYS n 1 48 ILE n 1 49 ALA n 1 50 GLU n 1 51 LEU n 1 52 LEU n 1 53 THR n 1 54 LYS n 1 55 LEU n 1 56 GLY n 1 57 ARG n 1 58 ASP n 1 59 THR n 1 60 GLN n 1 61 ILE n 1 62 GLY n 1 63 LEU n 1 64 THR n 1 65 MET n 1 66 PRO n 1 67 GLN n 1 68 VAL n 1 69 PHE n 1 70 ALA n 1 71 PRO n 1 72 ASP n 1 73 GLY n 1 74 SER n 1 75 HIS n 1 76 ILE n 1 77 GLY n 1 78 GLY n 1 79 PHE n 1 80 ASP n 1 81 GLN n 1 82 LEU n 1 83 ARG n 1 84 GLU n 1 85 TYR n 1 86 PHE n 1 87 LYS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Enterobacteria phage T4' _entity_src_nat.pdbx_ncbi_taxonomy_id 10665 _entity_src_nat.genus 'T4-like viruses' _entity_src_nat.species 'Enterobacteria phage T4 sensu lato' _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details 'THIS SEQUENCE OCCURS NATURALLY IN BACTERIOPHAGE T4' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 HIS 12 12 12 HIS HIS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 LYS 87 87 87 LYS LYS A . n # _cell.entry_id 1DE2 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DE2 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1DE2 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1DE2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1DE2 _struct.title 'NMR STRUCTURES OF REDUCED BACTERIOPHAGE T4 GLUTAREDOXIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DE2 _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'GLUTAREDOXIN, ELECTRON TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GLRX_BPT4 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00276 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1DE2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00276 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 87 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 87 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 15 ? LYS A 28 ? VAL A 15 LYS A 28 1 ? 14 HELX_P HELX_P2 2 ASP A 44 ? GLY A 56 ? ASP A 44 GLY A 56 1 ? 13 HELX_P HELX_P3 3 GLY A 78 ? LYS A 87 ? GLY A 78 LYS A 87 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 1 0.14 2 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 2 0.23 3 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 3 0.25 4 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 4 0.36 5 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 5 0.35 6 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 6 0.49 7 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 7 0.55 8 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 8 0.31 9 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 9 0.24 10 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 10 0.55 11 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 11 0.36 12 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 12 0.47 13 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 13 0.42 14 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 14 0.27 15 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 15 0.43 16 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 16 0.24 17 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 17 0.52 18 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 18 0.38 19 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 19 0.61 20 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 20 0.40 21 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 21 0.61 22 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 22 0.43 23 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 23 0.53 24 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 24 0.53 25 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 25 0.46 26 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 26 0.35 27 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 27 0.47 28 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 28 0.28 29 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 29 0.53 30 MET 65 A . ? MET 65 A PRO 66 A ? PRO 66 A 30 0.47 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 31 ? ASN A 35 ? PHE A 31 ASN A 35 A 2 PHE A 2 ? GLY A 6 ? PHE A 2 GLY A 6 A 3 GLN A 67 ? PHE A 69 ? GLN A 67 PHE A 69 A 4 HIS A 75 ? GLY A 77 ? HIS A 75 GLY A 77 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 32 ? N GLU A 32 O PHE A 2 ? O PHE A 2 A 2 3 N TYR A 5 ? N TYR A 5 O GLN A 67 ? O GLN A 67 A 3 4 O VAL A 68 ? O VAL A 68 N ILE A 76 ? N ILE A 76 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A ILE 36 ? ? H A ASP 44 ? ? 1.56 2 4 O A ILE 36 ? ? H A ASP 44 ? ? 1.51 3 6 O A PHE 2 ? ? H A GLU 32 ? ? 1.59 4 7 H A TYR 5 ? ? O A GLN 67 ? ? 1.60 5 9 O A ILE 36 ? ? H A ASP 44 ? ? 1.51 6 12 O A ILE 36 ? ? H A ASP 44 ? ? 1.53 7 13 O A ILE 36 ? ? H A ASP 44 ? ? 1.57 8 14 O A PHE 2 ? ? H A GLU 32 ? ? 1.59 9 17 O A ILE 36 ? ? H A ASP 44 ? ? 1.54 10 19 O A ILE 36 ? ? H A ASP 44 ? ? 1.57 11 19 H A TYR 5 ? ? O A GLN 67 ? ? 1.59 12 20 O A ASP 8 ? ? O A HIS 12 ? ? 2.19 13 22 HA A TYR 7 ? ? HD2 A HIS 12 ? ? 1.06 14 26 O A ILE 36 ? ? H A ASP 44 ? ? 1.51 15 30 O A ILE 36 ? ? H A ASP 44 ? ? 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 9 ? ? -172.78 -172.10 2 1 CYS A 14 ? ? -177.88 110.59 3 1 LYS A 28 ? ? 77.93 52.70 4 1 MET A 37 ? ? -155.70 77.39 5 1 LYS A 40 ? ? -47.40 -8.87 6 1 ARG A 57 ? ? -150.48 30.46 7 1 ASP A 58 ? ? -121.08 -143.62 8 1 ASP A 72 ? ? -161.61 41.14 9 1 PHE A 79 ? ? -72.42 -70.64 10 2 ASP A 8 ? ? -84.73 -73.70 11 2 SER A 9 ? ? 167.83 -33.84 12 2 CYS A 14 ? ? -167.98 112.12 13 2 LYS A 28 ? ? 74.49 55.95 14 2 PRO A 38 ? ? -80.96 43.65 15 2 ARG A 57 ? ? -150.33 31.46 16 2 ASP A 58 ? ? -121.01 -147.19 17 2 SER A 74 ? ? 179.85 159.85 18 2 PHE A 79 ? ? -65.96 -70.58 19 2 PHE A 86 ? ? -96.71 -70.61 20 3 SER A 9 ? ? 166.31 -38.27 21 3 CYS A 14 ? ? -174.30 117.75 22 3 PHE A 79 ? ? -72.27 -70.98 23 4 SER A 9 ? ? -175.36 -171.62 24 4 CYS A 14 ? ? -177.11 92.83 25 4 LYS A 28 ? ? 76.13 45.59 26 4 PHE A 43 ? ? -56.99 170.14 27 4 ARG A 57 ? ? -150.55 26.78 28 4 ASP A 58 ? ? -121.67 -153.71 29 4 SER A 74 ? ? 179.58 118.97 30 5 SER A 9 ? ? 81.82 -22.85 31 5 HIS A 12 ? ? -166.64 108.48 32 5 LYS A 13 ? ? -39.39 134.23 33 5 CYS A 14 ? ? -166.23 109.23 34 5 LYS A 28 ? ? 72.53 57.32 35 5 LEU A 63 ? ? -49.84 171.40 36 5 ASP A 72 ? ? -165.43 38.80 37 5 PHE A 86 ? ? -92.08 -70.31 38 6 PHE A 2 ? ? -39.85 120.92 39 6 CYS A 14 ? ? 174.00 95.08 40 6 PRO A 30 ? ? -45.72 174.83 41 6 ALA A 70 ? ? -47.88 156.46 42 6 SER A 74 ? ? -164.55 116.51 43 7 SER A 9 ? ? 166.28 -37.49 44 7 CYS A 14 ? ? 179.98 107.83 45 7 LYS A 28 ? ? 76.16 38.70 46 7 ARG A 57 ? ? -150.33 31.74 47 7 ASP A 58 ? ? -121.01 -146.52 48 7 PHE A 79 ? ? -80.88 -70.35 49 8 PHE A 2 ? ? -39.78 110.06 50 8 ASP A 8 ? ? -64.91 -76.98 51 8 SER A 9 ? ? 170.32 -34.81 52 8 LYS A 28 ? ? 76.32 67.95 53 8 PRO A 30 ? ? -49.75 167.41 54 8 ARG A 57 ? ? -150.58 26.87 55 8 ASP A 58 ? ? -121.58 -149.28 56 8 PRO A 71 ? ? -34.88 -35.31 57 8 ASP A 72 ? ? -170.43 33.65 58 8 PHE A 79 ? ? -76.49 -70.65 59 9 CYS A 14 ? ? 174.70 96.11 60 9 LYS A 28 ? ? 77.47 53.20 61 9 ARG A 57 ? ? -94.39 31.49 62 9 ASP A 58 ? ? -121.11 -150.81 63 9 ASP A 72 ? ? -160.06 38.38 64 9 PHE A 79 ? ? -75.43 -70.21 65 9 PHE A 86 ? ? -88.90 -70.52 66 10 ASP A 8 ? ? -78.84 -75.08 67 10 SER A 9 ? ? 170.99 -41.98 68 10 CYS A 14 ? ? -178.54 102.57 69 10 LYS A 28 ? ? 74.09 55.57 70 10 PHE A 43 ? ? -59.56 170.43 71 10 ARG A 57 ? ? -150.33 31.32 72 10 ASP A 58 ? ? -121.01 -148.53 73 10 PHE A 79 ? ? -75.71 -70.11 74 10 PHE A 86 ? ? -96.61 -70.74 75 11 ASP A 8 ? ? -96.84 -73.20 76 11 SER A 9 ? ? 170.64 -42.08 77 11 CYS A 14 ? ? -165.98 118.89 78 11 LYS A 28 ? ? 71.33 55.04 79 11 PRO A 30 ? ? -48.53 159.33 80 11 ARG A 57 ? ? -124.11 -165.45 81 11 ILE A 61 ? ? -66.60 82.45 82 11 PHE A 79 ? ? -67.79 -70.46 83 12 PHE A 2 ? ? -39.70 127.59 84 12 SER A 9 ? ? 162.08 -29.85 85 12 CYS A 14 ? ? -176.89 98.18 86 12 PRO A 30 ? ? -49.25 178.10 87 12 ARG A 57 ? ? -150.44 31.39 88 12 ASP A 58 ? ? -120.96 -145.87 89 12 GLN A 60 ? ? -69.80 98.27 90 12 ALA A 70 ? ? -46.90 164.97 91 12 SER A 74 ? ? -56.69 109.32 92 13 ASP A 8 ? ? -79.10 -78.97 93 13 SER A 9 ? ? 166.43 -35.14 94 13 CYS A 14 ? ? 169.69 106.83 95 13 LYS A 28 ? ? 73.91 54.52 96 13 ARG A 57 ? ? -150.63 30.83 97 13 ASP A 58 ? ? -121.13 -149.20 98 13 PHE A 79 ? ? -64.75 -70.16 99 14 PHE A 2 ? ? -39.50 119.01 100 14 CYS A 14 ? ? 173.74 109.27 101 14 PRO A 30 ? ? -47.08 176.51 102 14 ASP A 72 ? ? -167.86 34.08 103 14 PHE A 79 ? ? -76.07 -70.22 104 14 PHE A 86 ? ? -90.10 -69.80 105 15 SER A 9 ? ? 80.00 -5.73 106 15 LYS A 28 ? ? 71.13 45.21 107 15 ILE A 36 ? ? -97.07 33.19 108 15 MET A 37 ? ? -160.59 82.59 109 15 ASP A 58 ? ? -121.25 -156.72 110 15 LEU A 63 ? ? -57.46 -179.80 111 15 ASP A 72 ? ? -165.73 39.84 112 15 PHE A 79 ? ? -69.61 -70.88 113 16 ASP A 8 ? ? -144.83 38.67 114 16 SER A 9 ? ? -163.94 -162.82 115 16 HIS A 12 ? ? -170.17 144.07 116 16 CYS A 14 ? ? 168.82 82.82 117 16 LYS A 28 ? ? 79.79 71.00 118 16 PHE A 43 ? ? -58.83 170.30 119 16 LEU A 55 ? ? -59.60 -70.15 120 16 ARG A 57 ? ? -150.35 32.35 121 16 ASP A 58 ? ? -120.97 -145.42 122 16 HIS A 75 ? ? -58.54 108.94 123 17 CYS A 14 ? ? 176.75 123.54 124 17 LYS A 28 ? ? 70.34 42.28 125 17 PHE A 43 ? ? -58.76 170.33 126 17 PHE A 86 ? ? -95.51 -70.72 127 18 ASP A 8 ? ? -81.59 -78.19 128 18 SER A 9 ? ? 170.49 -35.12 129 18 CYS A 14 ? ? 175.38 113.90 130 18 LYS A 28 ? ? 75.82 42.82 131 18 ILE A 36 ? ? -87.18 49.53 132 18 MET A 37 ? ? -171.38 98.81 133 18 ARG A 57 ? ? -129.05 -165.50 134 18 ILE A 61 ? ? -58.80 82.32 135 18 ASP A 72 ? ? -160.57 39.52 136 18 PHE A 86 ? ? -100.11 -70.86 137 19 CYS A 14 ? ? -166.62 119.07 138 19 ARG A 57 ? ? -97.56 31.24 139 19 GLN A 60 ? ? -69.89 97.63 140 19 LEU A 63 ? ? -55.23 173.28 141 19 ASP A 72 ? ? -168.98 39.16 142 19 PHE A 79 ? ? -71.85 -70.53 143 20 LYS A 28 ? ? 71.35 37.25 144 20 ARG A 57 ? ? -150.50 32.53 145 20 ASP A 58 ? ? -120.98 -152.09 146 20 SER A 74 ? ? 176.29 158.24 147 20 PHE A 79 ? ? -71.11 -70.72 148 21 ASP A 8 ? ? -86.43 -70.39 149 21 SER A 9 ? ? 170.97 -37.06 150 21 CYS A 14 ? ? 179.12 86.52 151 21 LYS A 28 ? ? 73.49 51.41 152 21 ARG A 57 ? ? -150.41 29.52 153 21 ASP A 58 ? ? -121.37 -154.76 154 21 SER A 74 ? ? 179.39 158.49 155 21 PHE A 79 ? ? -77.55 -70.15 156 22 ASP A 8 ? ? -156.47 -51.33 157 22 SER A 9 ? ? -52.84 -174.86 158 22 CYS A 14 ? ? 169.96 111.83 159 22 ILE A 36 ? ? -101.42 67.99 160 22 MET A 37 ? ? -168.15 85.26 161 22 PHE A 43 ? ? -59.91 170.27 162 22 ARG A 57 ? ? -150.49 33.00 163 22 ASP A 58 ? ? -120.73 -146.87 164 22 LEU A 63 ? ? -43.74 153.39 165 22 PHE A 79 ? ? -70.21 -70.42 166 23 CYS A 14 ? ? -159.01 89.29 167 23 PRO A 30 ? ? -45.23 168.43 168 23 ARG A 57 ? ? -150.55 32.50 169 23 ASP A 58 ? ? -120.89 -146.75 170 23 LEU A 63 ? ? -46.73 152.55 171 23 PRO A 71 ? ? -37.78 -31.96 172 23 ASP A 72 ? ? -170.82 36.10 173 23 PHE A 79 ? ? -80.09 -70.46 174 23 PHE A 86 ? ? -90.80 -71.03 175 24 ASP A 8 ? ? -99.79 -72.99 176 24 SER A 9 ? ? 172.97 -36.45 177 24 CYS A 14 ? ? 173.88 117.20 178 24 LYS A 28 ? ? 112.71 30.13 179 24 ARG A 57 ? ? -150.45 31.42 180 24 ASP A 58 ? ? -120.91 -149.44 181 24 LEU A 63 ? ? -46.57 156.70 182 24 ALA A 70 ? ? -47.08 160.85 183 24 PHE A 79 ? ? -71.62 -70.87 184 25 ASP A 8 ? ? -110.94 51.00 185 25 SER A 9 ? ? -168.44 -169.80 186 25 CYS A 14 ? ? -165.04 89.54 187 25 PRO A 30 ? ? -52.31 -177.90 188 25 PRO A 71 ? ? -39.85 -31.99 189 25 ASP A 72 ? ? -168.43 34.06 190 25 PHE A 79 ? ? -69.43 -70.62 191 26 SER A 9 ? ? 86.28 -36.63 192 26 CYS A 14 ? ? 168.96 91.04 193 26 LYS A 28 ? ? 72.76 60.38 194 26 ARG A 57 ? ? -150.40 33.23 195 26 ASP A 58 ? ? -120.74 -144.56 196 26 LEU A 63 ? ? -48.03 151.32 197 26 ASP A 72 ? ? -164.91 33.55 198 26 PHE A 86 ? ? -90.90 -66.72 199 27 SER A 9 ? ? 170.87 -39.83 200 27 CYS A 14 ? ? -177.06 106.36 201 27 LYS A 28 ? ? 66.31 60.81 202 27 ARG A 57 ? ? -150.65 30.89 203 27 ASP A 58 ? ? -121.03 -148.84 204 27 LEU A 63 ? ? -47.41 154.27 205 27 SER A 74 ? ? -168.78 115.66 206 27 PHE A 86 ? ? -93.34 -70.47 207 28 SER A 9 ? ? 80.97 -15.78 208 28 CYS A 14 ? ? 176.84 108.63 209 28 LYS A 28 ? ? 67.45 61.17 210 28 LYS A 40 ? ? -59.79 -8.28 211 28 ARG A 57 ? ? -109.41 -166.48 212 28 ASP A 72 ? ? -164.38 36.25 213 29 SER A 9 ? ? 160.20 -32.44 214 29 CYS A 14 ? ? 173.80 106.38 215 29 ILE A 36 ? ? -100.21 45.74 216 29 MET A 37 ? ? -162.72 99.79 217 29 ARG A 57 ? ? -146.10 30.14 218 29 ASP A 58 ? ? -120.91 -153.65 219 29 ASP A 72 ? ? -163.74 42.35 220 29 PHE A 79 ? ? -63.14 -70.58 221 29 PHE A 86 ? ? -87.61 -70.28 222 30 PHE A 2 ? ? -49.75 170.40 223 30 SER A 9 ? ? 78.46 -8.86 224 30 CYS A 14 ? ? -178.62 117.18 225 30 LYS A 28 ? ? 67.89 60.82 226 30 PRO A 38 ? ? -88.24 37.46 227 30 LEU A 55 ? ? -69.46 -70.15 # _pdbx_nmr_ensemble.entry_id 1DE2 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria ;BACK CALCULATED DATA AGREE WITH EXPERIMENTAL NOESY SPECTRUM, STRUCTURES WITH ACCEPTABLE COVALENT GEOMETRY,STRUCTURES WITH FAVORABLE NON-BOND ENERGY, STRUCTURES WITH THE LEAST RESTRAINT VIOLATIONS ; _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1DE2 _pdbx_nmr_representative.conformer_id 27 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2MM T4 GLUTAREDOXIN; 10MM DTT,50MM PH7.0 PHOSPHATE BUFFER' _pdbx_nmr_sample_details.solvent_system ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '2D NOESY,TOCSY,DQF_COSY' _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_details.entry_id 1DE2 _pdbx_nmr_details.text 'THE STRUCTURES WERE DETERMINED USING STANDARD 2D HOMONUCLEAR TECHNIQUES' # _pdbx_nmr_refine.entry_id 1DE2 _pdbx_nmr_refine.method 'SIMULATED ANNEALING MOLECULAR DYNAMICS' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'data analysis' VNMR 6.1 VARIAN 1 'structure solution' X-PLOR 3.85 'BRUNGER A. T.' 2 refinement X-PLOR 3.85 'BRUNGER A. T.' 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITY _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 1DE2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_