data_1DOX
# 
_entry.id   1DOX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.390 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1DOX         pdb_00001dox 10.2210/pdb1dox/pdb 
WWPDB D_1000172880 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-03-08 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2024-04-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Source and taxonomy'       
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Database references'       
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp_atom       
2 4 'Structure model' chem_comp_bond       
3 4 'Structure model' database_2           
4 4 'Structure model' pdbx_database_status 
5 4 'Structure model' struct_site          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_database_status.process_site'  
4 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DOX 
_pdbx_database_status.recvd_initial_deposition_date   1995-09-14 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lelong, C.'    1 
'Setif, P.'     2 
'Bottin, H.'    3 
'Andre, F.'     4 
'Neumann, J.M.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;1H and 15N NMR sequential assignment, secondary structure, and tertiary fold of [2Fe-2S] ferredoxin from Synechocystis sp. PCC 6803.
;
Biochemistry         34   14462 14473 1995 BICHAW US 0006-2960 0033 ? 7578051 10.1021/bi00044a024 
1       'Ferredoxin and Flavodoxin from the Cyanobacterium Synechocystis Sp. Pcc 6803' Biochim.Biophys.Acta 1101 48    ?     1992 
BBACAQ NE 0006-3002 0113 ? ?       ?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lelong, C.'    1 ? 
primary 'Setif, P.'     2 ? 
primary 'Bottin, H.'    3 ? 
primary 'Andre, F.'     4 ? 
primary 'Neumann, J.M.' 5 ? 
1       'Bottin, H.'    6 ? 
1       'Lagoutte, B.'  7 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'FERREDOXIN [2FE-2S]'        10237.038 1 ? ? ? 'PLANT TYPE FERREDOXIN, NO DISULFIDE BOND' 
2 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820   1 ? ? ? ?                                          
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAY
PTSDCTIETHKEEDLY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAY
PTSDCTIETHKEEDLY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'FE2/S2 (INORGANIC) CLUSTER' 
_pdbx_entity_nonpoly.comp_id     FES 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  SER n 
1 3  TYR n 
1 4  THR n 
1 5  VAL n 
1 6  LYS n 
1 7  LEU n 
1 8  ILE n 
1 9  THR n 
1 10 PRO n 
1 11 ASP n 
1 12 GLY n 
1 13 GLU n 
1 14 SER n 
1 15 SER n 
1 16 ILE n 
1 17 GLU n 
1 18 CYS n 
1 19 SER n 
1 20 ASP n 
1 21 ASP n 
1 22 THR n 
1 23 TYR n 
1 24 ILE n 
1 25 LEU n 
1 26 ASP n 
1 27 ALA n 
1 28 ALA n 
1 29 GLU n 
1 30 GLU n 
1 31 ALA n 
1 32 GLY n 
1 33 LEU n 
1 34 ASP n 
1 35 LEU n 
1 36 PRO n 
1 37 TYR n 
1 38 SER n 
1 39 CYS n 
1 40 ARG n 
1 41 ALA n 
1 42 GLY n 
1 43 ALA n 
1 44 CYS n 
1 45 SER n 
1 46 THR n 
1 47 CYS n 
1 48 ALA n 
1 49 GLY n 
1 50 LYS n 
1 51 ILE n 
1 52 THR n 
1 53 ALA n 
1 54 GLY n 
1 55 SER n 
1 56 VAL n 
1 57 ASP n 
1 58 GLN n 
1 59 SER n 
1 60 ASP n 
1 61 GLN n 
1 62 SER n 
1 63 PHE n 
1 64 LEU n 
1 65 ASP n 
1 66 ASP n 
1 67 ASP n 
1 68 GLN n 
1 69 ILE n 
1 70 GLU n 
1 71 ALA n 
1 72 GLY n 
1 73 TYR n 
1 74 VAL n 
1 75 LEU n 
1 76 THR n 
1 77 CYS n 
1 78 VAL n 
1 79 ALA n 
1 80 TYR n 
1 81 PRO n 
1 82 THR n 
1 83 SER n 
1 84 ASP n 
1 85 CYS n 
1 86 THR n 
1 87 ILE n 
1 88 GLU n 
1 89 THR n 
1 90 HIS n 
1 91 LYS n 
1 92 GLU n 
1 93 GLU n 
1 94 ASP n 
1 95 LEU n 
1 96 TYR n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Synechocystis sp.' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      1148 
_entity_src_nat.genus                      Synechocystis 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     'PCC 6803' 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'   121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2'         175.820 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  SER 2  2  2  SER SER A . n 
A 1 3  TYR 3  3  3  TYR TYR A . n 
A 1 4  THR 4  4  4  THR THR A . n 
A 1 5  VAL 5  5  5  VAL VAL A . n 
A 1 6  LYS 6  6  6  LYS LYS A . n 
A 1 7  LEU 7  7  7  LEU LEU A . n 
A 1 8  ILE 8  8  8  ILE ILE A . n 
A 1 9  THR 9  9  9  THR THR A . n 
A 1 10 PRO 10 10 10 PRO PRO A . n 
A 1 11 ASP 11 11 11 ASP ASP A . n 
A 1 12 GLY 12 12 12 GLY GLY A . n 
A 1 13 GLU 13 13 13 GLU GLU A . n 
A 1 14 SER 14 14 14 SER SER A . n 
A 1 15 SER 15 15 15 SER SER A . n 
A 1 16 ILE 16 16 16 ILE ILE A . n 
A 1 17 GLU 17 17 17 GLU GLU A . n 
A 1 18 CYS 18 18 18 CYS CYS A . n 
A 1 19 SER 19 19 19 SER SER A . n 
A 1 20 ASP 20 20 20 ASP ASP A . n 
A 1 21 ASP 21 21 21 ASP ASP A . n 
A 1 22 THR 22 22 22 THR THR A . n 
A 1 23 TYR 23 23 23 TYR TYR A . n 
A 1 24 ILE 24 24 24 ILE ILE A . n 
A 1 25 LEU 25 25 25 LEU LEU A . n 
A 1 26 ASP 26 26 26 ASP ASP A . n 
A 1 27 ALA 27 27 27 ALA ALA A . n 
A 1 28 ALA 28 28 28 ALA ALA A . n 
A 1 29 GLU 29 29 29 GLU GLU A . n 
A 1 30 GLU 30 30 30 GLU GLU A . n 
A 1 31 ALA 31 31 31 ALA ALA A . n 
A 1 32 GLY 32 32 32 GLY GLY A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 ASP 34 34 34 ASP ASP A . n 
A 1 35 LEU 35 35 35 LEU LEU A . n 
A 1 36 PRO 36 36 36 PRO PRO A . n 
A 1 37 TYR 37 37 37 TYR TYR A . n 
A 1 38 SER 38 38 38 SER SER A . n 
A 1 39 CYS 39 39 39 CYS CYS A . n 
A 1 40 ARG 40 40 40 ARG ARG A . n 
A 1 41 ALA 41 41 41 ALA ALA A . n 
A 1 42 GLY 42 42 42 GLY GLY A . n 
A 1 43 ALA 43 43 43 ALA ALA A . n 
A 1 44 CYS 44 44 44 CYS CYS A . n 
A 1 45 SER 45 45 45 SER SER A . n 
A 1 46 THR 46 46 46 THR THR A . n 
A 1 47 CYS 47 47 47 CYS CYS A . n 
A 1 48 ALA 48 48 48 ALA ALA A . n 
A 1 49 GLY 49 49 49 GLY GLY A . n 
A 1 50 LYS 50 50 50 LYS LYS A . n 
A 1 51 ILE 51 51 51 ILE ILE A . n 
A 1 52 THR 52 52 52 THR THR A . n 
A 1 53 ALA 53 53 53 ALA ALA A . n 
A 1 54 GLY 54 54 54 GLY GLY A . n 
A 1 55 SER 55 55 55 SER SER A . n 
A 1 56 VAL 56 56 56 VAL VAL A . n 
A 1 57 ASP 57 57 57 ASP ASP A . n 
A 1 58 GLN 58 58 58 GLN GLN A . n 
A 1 59 SER 59 59 59 SER SER A . n 
A 1 60 ASP 60 60 60 ASP ASP A . n 
A 1 61 GLN 61 61 61 GLN GLN A . n 
A 1 62 SER 62 62 62 SER SER A . n 
A 1 63 PHE 63 63 63 PHE PHE A . n 
A 1 64 LEU 64 64 64 LEU LEU A . n 
A 1 65 ASP 65 65 65 ASP ASP A . n 
A 1 66 ASP 66 66 66 ASP ASP A . n 
A 1 67 ASP 67 67 67 ASP ASP A . n 
A 1 68 GLN 68 68 68 GLN GLN A . n 
A 1 69 ILE 69 69 69 ILE ILE A . n 
A 1 70 GLU 70 70 70 GLU GLU A . n 
A 1 71 ALA 71 71 71 ALA ALA A . n 
A 1 72 GLY 72 72 72 GLY GLY A . n 
A 1 73 TYR 73 73 73 TYR TYR A . n 
A 1 74 VAL 74 74 74 VAL VAL A . n 
A 1 75 LEU 75 75 75 LEU LEU A . n 
A 1 76 THR 76 76 76 THR THR A . n 
A 1 77 CYS 77 77 77 CYS CYS A . n 
A 1 78 VAL 78 78 78 VAL VAL A . n 
A 1 79 ALA 79 79 79 ALA ALA A . n 
A 1 80 TYR 80 80 80 TYR TYR A . n 
A 1 81 PRO 81 81 81 PRO PRO A . n 
A 1 82 THR 82 82 82 THR THR A . n 
A 1 83 SER 83 83 83 SER SER A . n 
A 1 84 ASP 84 84 84 ASP ASP A . n 
A 1 85 CYS 85 85 85 CYS CYS A . n 
A 1 86 THR 86 86 86 THR THR A . n 
A 1 87 ILE 87 87 87 ILE ILE A . n 
A 1 88 GLU 88 88 88 GLU GLU A . n 
A 1 89 THR 89 89 89 THR THR A . n 
A 1 90 HIS 90 90 90 HIS HIS A . n 
A 1 91 LYS 91 91 91 LYS LYS A . n 
A 1 92 GLU 92 92 92 GLU GLU A . n 
A 1 93 GLU 93 93 93 GLU GLU A . n 
A 1 94 ASP 94 94 94 ASP ASP A . n 
A 1 95 LEU 95 95 95 LEU LEU A . n 
A 1 96 TYR 96 96 96 TYR TYR A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          FES 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     97 
_pdbx_nonpoly_scheme.auth_seq_num    97 
_pdbx_nonpoly_scheme.pdb_mon_id      FES 
_pdbx_nonpoly_scheme.auth_mon_id     FES 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.0 ? 1 
X-PLOR refinement       3.0 ? 2 
X-PLOR phasing          3.0 ? 3 
# 
_cell.entry_id           1DOX 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DOX 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          1DOX 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_database_PDB_matrix.entry_id          1DOX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1DOX 
_struct.title                     
'1H AND 15N SEQUENTIAL ASSIGNMENT, SECONDARY STRUCTURE AND TERTIARY FOLD OF [2FE-2S] FERREDOXIN FROM SYNECHOCYSTIS SP. PCC 6803' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DOX 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            'IRON-SULFUR PROTEIN, ELECTRON TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A Y N 1 ? 
B N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FER_SYNY3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P27320 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAY
PTSDCTIETHKEEDLY
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1DOX 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 96 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P27320 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  96 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       96 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 26 ? ASP A 34 ? ASP A 26 ASP A 34 1 ? 9 
HELX_P HELX_P2 2 ASP A 66 ? GLU A 70 ? ASP A 66 GLU A 70 1 ? 5 
HELX_P HELX_P3 3 GLU A 93 ? TYR A 96 ? GLU A 93 TYR A 96 1 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 39 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 39 A FES 97 1_555 ? ? ? ? ? ? ? 2.296 ? ? 
metalc2 metalc ? ? A CYS 44 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 44 A FES 97 1_555 ? ? ? ? ? ? ? 2.293 ? ? 
metalc3 metalc ? ? A CYS 47 SG ? ? ? 1_555 B FES . FE2 ? ? A CYS 47 A FES 97 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc4 metalc ? ? A CYS 77 SG ? ? ? 1_555 B FES . FE2 ? ? A CYS 77 A FES 97 1_555 ? ? ? ? ? ? ? 2.291 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? A CYS 39 ? A CYS 39 ? 1_555 FE1 ? B FES . ? A FES 97 ? 1_555 SG ? A CYS 44 ? A CYS 44 ? 1_555 117.2 ? 
2 SG ? A CYS 47 ? A CYS 47 ? 1_555 FE2 ? B FES . ? A FES 97 ? 1_555 SG ? A CYS 77 ? A CYS 77 ? 1_555 119.2 ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 6  ? ILE A 8  ? LYS A 6  ILE A 8  
A 2 GLU A 13 ? SER A 15 ? GLU A 13 SER A 15 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   LEU 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    7 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    LEU 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     7 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   SER 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    14 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    SER 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     14 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
S2  Unknown  ? ?   ?  ? 4 ?                                   
AC1 Software A FES 97 ? 4 'BINDING SITE FOR RESIDUE FES A 97' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 S2  4 CYS A 39 ? CYS A 39 . ? 1_555 ? 
2 S2  4 CYS A 44 ? CYS A 44 . ? 1_555 ? 
3 S2  4 CYS A 47 ? CYS A 47 . ? 1_555 ? 
4 S2  4 CYS A 77 ? CYS A 77 . ? 1_555 ? 
5 AC1 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 
6 AC1 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 
7 AC1 4 CYS A 47 ? CYS A 47 . ? 1_555 ? 
8 AC1 4 CYS A 77 ? CYS A 77 . ? 1_555 ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    3 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    55 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   TYR 
_pdbx_validate_close_contact.auth_seq_id_2    80 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.13 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 TYR A 3  ? ? 39.45   85.95   
2   1 THR A 4  ? ? -153.61 -35.31  
3   1 VAL A 5  ? ? -45.08  176.04  
4   1 GLU A 17 ? ? -159.57 39.82   
5   1 CYS A 18 ? ? -21.18  -45.39  
6   1 SER A 19 ? ? 45.98   28.81   
7   1 ASP A 20 ? ? -167.45 56.51   
8   1 ASP A 21 ? ? 73.37   115.49  
9   1 THR A 22 ? ? -42.65  106.53  
10  1 ILE A 24 ? ? -53.70  -91.82  
11  1 LEU A 33 ? ? 32.82   33.48   
12  1 LEU A 35 ? ? 47.98   70.34   
13  1 PRO A 36 ? ? -59.65  83.78   
14  1 SER A 38 ? ? -82.87  -70.55  
15  1 ARG A 40 ? ? 81.84   -21.93  
16  1 ALA A 41 ? ? -107.37 -67.38  
17  1 ALA A 43 ? ? -153.72 -23.92  
18  1 CYS A 44 ? ? -111.41 -166.59 
19  1 CYS A 47 ? ? -102.81 64.72   
20  1 ALA A 48 ? ? -76.08  -139.50 
21  1 ILE A 51 ? ? 69.21   67.57   
22  1 ALA A 53 ? ? -33.02  -72.48  
23  1 VAL A 56 ? ? 38.91   85.36   
24  1 ASP A 57 ? ? -178.95 115.34  
25  1 GLN A 58 ? ? 169.75  39.02   
26  1 SER A 59 ? ? -141.19 26.14   
27  1 GLN A 61 ? ? -118.66 -90.17  
28  1 SER A 62 ? ? -43.18  168.91  
29  1 LEU A 64 ? ? 171.17  123.79  
30  1 ASP A 65 ? ? 65.67   151.71  
31  1 ASP A 66 ? ? 94.21   71.96   
32  1 GLN A 68 ? ? 179.97  -17.47  
33  1 ILE A 69 ? ? 160.61  94.38   
34  1 ALA A 71 ? ? -166.70 78.57   
35  1 TYR A 73 ? ? 27.99   -85.87  
36  1 VAL A 74 ? ? -138.23 -43.32  
37  1 CYS A 77 ? ? -66.26  17.12   
38  1 TYR A 80 ? ? -117.91 -154.02 
39  1 PRO A 81 ? ? -46.97  -92.84  
40  1 THR A 82 ? ? 125.47  86.98   
41  1 THR A 86 ? ? -170.09 116.42  
42  1 LYS A 91 ? ? 82.97   -33.39  
43  1 ASP A 94 ? ? -143.38 -47.87  
44  1 LEU A 95 ? ? -160.70 -68.01  
45  2 SER A 2  ? ? -94.72  -61.87  
46  2 TYR A 3  ? ? -101.89 -97.71  
47  2 THR A 4  ? ? 168.28  30.58   
48  2 VAL A 5  ? ? -88.99  -126.07 
49  2 LYS A 6  ? ? 86.69   -99.15  
50  2 LEU A 7  ? ? 106.51  -54.05  
51  2 ILE A 8  ? ? 68.31   -121.88 
52  2 ASP A 11 ? ? -101.37 71.41   
53  2 ILE A 16 ? ? -151.74 -58.74  
54  2 GLU A 17 ? ? 83.96   -38.52  
55  2 CYS A 18 ? ? 54.50   19.51   
56  2 ASP A 20 ? ? 44.38   26.26   
57  2 ASP A 21 ? ? 64.66   116.79  
58  2 THR A 22 ? ? -165.00 -76.51  
59  2 ILE A 24 ? ? -40.34  -169.84 
60  2 LEU A 25 ? ? -38.28  -29.06  
61  2 ALA A 28 ? ? -61.89  -98.77  
62  2 ASP A 34 ? ? 30.97   96.71   
63  2 LEU A 35 ? ? -142.72 -69.10  
64  2 PRO A 36 ? ? -55.13  86.90   
65  2 TYR A 37 ? ? -162.56 24.59   
66  2 ARG A 40 ? ? 57.57   84.17   
67  2 ALA A 41 ? ? 71.54   60.29   
68  2 ALA A 43 ? ? -149.17 57.88   
69  2 CYS A 44 ? ? -110.98 -158.39 
70  2 SER A 45 ? ? -151.75 35.08   
71  2 CYS A 47 ? ? -86.28  43.94   
72  2 ALA A 48 ? ? -42.37  162.06  
73  2 LYS A 50 ? ? -67.69  96.00   
74  2 ILE A 51 ? ? 6.12    114.55  
75  2 THR A 52 ? ? 140.47  6.54    
76  2 ALA A 53 ? ? -55.80  -7.76   
77  2 SER A 55 ? ? 130.80  -150.94 
78  2 ASP A 57 ? ? -140.05 -85.95  
79  2 GLN A 58 ? ? 81.04   72.67   
80  2 GLN A 61 ? ? -109.25 -87.39  
81  2 SER A 62 ? ? 172.25  -54.03  
82  2 LEU A 64 ? ? -127.74 -84.32  
83  2 ASP A 65 ? ? -176.68 146.16  
84  2 ASP A 66 ? ? 51.63   97.47   
85  2 ASP A 67 ? ? -34.43  -32.13  
86  2 GLN A 68 ? ? -172.56 48.09   
87  2 ILE A 69 ? ? 90.71   24.39   
88  2 GLU A 70 ? ? -178.19 74.17   
89  2 ALA A 71 ? ? 162.34  62.09   
90  2 TYR A 73 ? ? -9.07   -68.39  
91  2 VAL A 74 ? ? -60.16  -144.37 
92  2 ALA A 79 ? ? 73.64   165.48  
93  2 TYR A 80 ? ? 166.91  146.45  
94  2 PRO A 81 ? ? -32.24  96.63   
95  2 THR A 82 ? ? 0.70    67.48   
96  2 ASP A 84 ? ? 75.38   122.73  
97  2 THR A 86 ? ? 178.60  106.72  
98  2 THR A 89 ? ? 74.31   -78.19  
99  2 LYS A 91 ? ? 63.23   88.28   
100 2 ASP A 94 ? ? -148.03 -37.85  
101 3 SER A 2  ? ? -64.93  -150.22 
102 3 THR A 4  ? ? -154.11 -7.72   
103 3 VAL A 5  ? ? -65.00  -90.78  
104 3 LYS A 6  ? ? 49.72   -131.71 
105 3 LEU A 7  ? ? 174.79  -81.86  
106 3 ILE A 8  ? ? 151.95  151.64  
107 3 THR A 9  ? ? 151.72  -91.44  
108 3 ILE A 16 ? ? -146.32 -48.72  
109 3 GLU A 17 ? ? 63.33   -1.83   
110 3 CYS A 18 ? ? 31.15   -87.95  
111 3 ASP A 20 ? ? 164.16  35.35   
112 3 ASP A 21 ? ? 55.74   105.49  
113 3 THR A 22 ? ? -179.93 -97.66  
114 3 TYR A 23 ? ? 23.33   46.56   
115 3 ILE A 24 ? ? -56.25  -146.08 
116 3 LEU A 25 ? ? -38.95  -26.02  
117 3 LEU A 33 ? ? 33.66   33.77   
118 3 ASP A 34 ? ? -117.58 -115.01 
119 3 LEU A 35 ? ? 179.56  -61.63  
120 3 PRO A 36 ? ? -52.99  -161.52 
121 3 SER A 38 ? ? -163.34 -122.97 
122 3 ALA A 41 ? ? -121.17 -151.68 
123 3 CYS A 44 ? ? 179.22  165.27  
124 3 SER A 45 ? ? -150.87 43.01   
125 3 ALA A 48 ? ? -116.38 55.22   
126 3 ILE A 51 ? ? 58.06   81.72   
127 3 THR A 52 ? ? -68.40  24.60   
128 3 ALA A 53 ? ? 67.70   105.28  
129 3 SER A 55 ? ? -175.70 -171.43 
130 3 ASP A 57 ? ? 161.21  -65.95  
131 3 GLN A 58 ? ? 56.75   71.90   
132 3 GLN A 61 ? ? -164.90 -145.46 
133 3 SER A 62 ? ? 79.73   -169.83 
134 3 LEU A 64 ? ? 75.36   140.69  
135 3 ASP A 67 ? ? 149.25  -24.73  
136 3 GLN A 68 ? ? 163.41  -9.00   
137 3 ILE A 69 ? ? 160.72  92.48   
138 3 GLU A 70 ? ? 73.51   75.09   
139 3 ALA A 71 ? ? -159.46 68.67   
140 3 TYR A 73 ? ? 11.39   -79.07  
141 3 VAL A 74 ? ? -88.22  -141.68 
142 3 ALA A 79 ? ? 82.96   125.05  
143 3 TYR A 80 ? ? -165.18 -166.98 
144 3 THR A 82 ? ? -73.22  -92.83  
145 3 SER A 83 ? ? 79.98   -7.60   
146 3 ASP A 84 ? ? 149.96  145.33  
147 3 CYS A 85 ? ? -103.34 -160.22 
148 3 THR A 86 ? ? 160.66  121.51  
149 3 GLU A 88 ? ? 108.28  -136.33 
150 3 LYS A 91 ? ? -175.82 91.39   
151 3 GLU A 93 ? ? 77.58   -2.97   
152 3 ASP A 94 ? ? -147.79 -61.56  
153 3 LEU A 95 ? ? 168.02  -35.24  
# 
_pdbx_nmr_ensemble.entry_id                             1DOX 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    3 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          3.0 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASP N    N  N N 41  
ASP CA   C  N S 42  
ASP C    C  N N 43  
ASP O    O  N N 44  
ASP CB   C  N N 45  
ASP CG   C  N N 46  
ASP OD1  O  N N 47  
ASP OD2  O  N N 48  
ASP OXT  O  N N 49  
ASP H    H  N N 50  
ASP H2   H  N N 51  
ASP HA   H  N N 52  
ASP HB2  H  N N 53  
ASP HB3  H  N N 54  
ASP HD2  H  N N 55  
ASP HXT  H  N N 56  
CYS N    N  N N 57  
CYS CA   C  N R 58  
CYS C    C  N N 59  
CYS O    O  N N 60  
CYS CB   C  N N 61  
CYS SG   S  N N 62  
CYS OXT  O  N N 63  
CYS H    H  N N 64  
CYS H2   H  N N 65  
CYS HA   H  N N 66  
CYS HB2  H  N N 67  
CYS HB3  H  N N 68  
CYS HG   H  N N 69  
CYS HXT  H  N N 70  
FES FE1  FE N N 71  
FES FE2  FE N N 72  
FES S1   S  N N 73  
FES S2   S  N N 74  
GLN N    N  N N 75  
GLN CA   C  N S 76  
GLN C    C  N N 77  
GLN O    O  N N 78  
GLN CB   C  N N 79  
GLN CG   C  N N 80  
GLN CD   C  N N 81  
GLN OE1  O  N N 82  
GLN NE2  N  N N 83  
GLN OXT  O  N N 84  
GLN H    H  N N 85  
GLN H2   H  N N 86  
GLN HA   H  N N 87  
GLN HB2  H  N N 88  
GLN HB3  H  N N 89  
GLN HG2  H  N N 90  
GLN HG3  H  N N 91  
GLN HE21 H  N N 92  
GLN HE22 H  N N 93  
GLN HXT  H  N N 94  
GLU N    N  N N 95  
GLU CA   C  N S 96  
GLU C    C  N N 97  
GLU O    O  N N 98  
GLU CB   C  N N 99  
GLU CG   C  N N 100 
GLU CD   C  N N 101 
GLU OE1  O  N N 102 
GLU OE2  O  N N 103 
GLU OXT  O  N N 104 
GLU H    H  N N 105 
GLU H2   H  N N 106 
GLU HA   H  N N 107 
GLU HB2  H  N N 108 
GLU HB3  H  N N 109 
GLU HG2  H  N N 110 
GLU HG3  H  N N 111 
GLU HE2  H  N N 112 
GLU HXT  H  N N 113 
GLY N    N  N N 114 
GLY CA   C  N N 115 
GLY C    C  N N 116 
GLY O    O  N N 117 
GLY OXT  O  N N 118 
GLY H    H  N N 119 
GLY H2   H  N N 120 
GLY HA2  H  N N 121 
GLY HA3  H  N N 122 
GLY HXT  H  N N 123 
HIS N    N  N N 124 
HIS CA   C  N S 125 
HIS C    C  N N 126 
HIS O    O  N N 127 
HIS CB   C  N N 128 
HIS CG   C  Y N 129 
HIS ND1  N  Y N 130 
HIS CD2  C  Y N 131 
HIS CE1  C  Y N 132 
HIS NE2  N  Y N 133 
HIS OXT  O  N N 134 
HIS H    H  N N 135 
HIS H2   H  N N 136 
HIS HA   H  N N 137 
HIS HB2  H  N N 138 
HIS HB3  H  N N 139 
HIS HD1  H  N N 140 
HIS HD2  H  N N 141 
HIS HE1  H  N N 142 
HIS HE2  H  N N 143 
HIS HXT  H  N N 144 
ILE N    N  N N 145 
ILE CA   C  N S 146 
ILE C    C  N N 147 
ILE O    O  N N 148 
ILE CB   C  N S 149 
ILE CG1  C  N N 150 
ILE CG2  C  N N 151 
ILE CD1  C  N N 152 
ILE OXT  O  N N 153 
ILE H    H  N N 154 
ILE H2   H  N N 155 
ILE HA   H  N N 156 
ILE HB   H  N N 157 
ILE HG12 H  N N 158 
ILE HG13 H  N N 159 
ILE HG21 H  N N 160 
ILE HG22 H  N N 161 
ILE HG23 H  N N 162 
ILE HD11 H  N N 163 
ILE HD12 H  N N 164 
ILE HD13 H  N N 165 
ILE HXT  H  N N 166 
LEU N    N  N N 167 
LEU CA   C  N S 168 
LEU C    C  N N 169 
LEU O    O  N N 170 
LEU CB   C  N N 171 
LEU CG   C  N N 172 
LEU CD1  C  N N 173 
LEU CD2  C  N N 174 
LEU OXT  O  N N 175 
LEU H    H  N N 176 
LEU H2   H  N N 177 
LEU HA   H  N N 178 
LEU HB2  H  N N 179 
LEU HB3  H  N N 180 
LEU HG   H  N N 181 
LEU HD11 H  N N 182 
LEU HD12 H  N N 183 
LEU HD13 H  N N 184 
LEU HD21 H  N N 185 
LEU HD22 H  N N 186 
LEU HD23 H  N N 187 
LEU HXT  H  N N 188 
LYS N    N  N N 189 
LYS CA   C  N S 190 
LYS C    C  N N 191 
LYS O    O  N N 192 
LYS CB   C  N N 193 
LYS CG   C  N N 194 
LYS CD   C  N N 195 
LYS CE   C  N N 196 
LYS NZ   N  N N 197 
LYS OXT  O  N N 198 
LYS H    H  N N 199 
LYS H2   H  N N 200 
LYS HA   H  N N 201 
LYS HB2  H  N N 202 
LYS HB3  H  N N 203 
LYS HG2  H  N N 204 
LYS HG3  H  N N 205 
LYS HD2  H  N N 206 
LYS HD3  H  N N 207 
LYS HE2  H  N N 208 
LYS HE3  H  N N 209 
LYS HZ1  H  N N 210 
LYS HZ2  H  N N 211 
LYS HZ3  H  N N 212 
LYS HXT  H  N N 213 
PHE N    N  N N 214 
PHE CA   C  N S 215 
PHE C    C  N N 216 
PHE O    O  N N 217 
PHE CB   C  N N 218 
PHE CG   C  Y N 219 
PHE CD1  C  Y N 220 
PHE CD2  C  Y N 221 
PHE CE1  C  Y N 222 
PHE CE2  C  Y N 223 
PHE CZ   C  Y N 224 
PHE OXT  O  N N 225 
PHE H    H  N N 226 
PHE H2   H  N N 227 
PHE HA   H  N N 228 
PHE HB2  H  N N 229 
PHE HB3  H  N N 230 
PHE HD1  H  N N 231 
PHE HD2  H  N N 232 
PHE HE1  H  N N 233 
PHE HE2  H  N N 234 
PHE HZ   H  N N 235 
PHE HXT  H  N N 236 
PRO N    N  N N 237 
PRO CA   C  N S 238 
PRO C    C  N N 239 
PRO O    O  N N 240 
PRO CB   C  N N 241 
PRO CG   C  N N 242 
PRO CD   C  N N 243 
PRO OXT  O  N N 244 
PRO H    H  N N 245 
PRO HA   H  N N 246 
PRO HB2  H  N N 247 
PRO HB3  H  N N 248 
PRO HG2  H  N N 249 
PRO HG3  H  N N 250 
PRO HD2  H  N N 251 
PRO HD3  H  N N 252 
PRO HXT  H  N N 253 
SER N    N  N N 254 
SER CA   C  N S 255 
SER C    C  N N 256 
SER O    O  N N 257 
SER CB   C  N N 258 
SER OG   O  N N 259 
SER OXT  O  N N 260 
SER H    H  N N 261 
SER H2   H  N N 262 
SER HA   H  N N 263 
SER HB2  H  N N 264 
SER HB3  H  N N 265 
SER HG   H  N N 266 
SER HXT  H  N N 267 
THR N    N  N N 268 
THR CA   C  N S 269 
THR C    C  N N 270 
THR O    O  N N 271 
THR CB   C  N R 272 
THR OG1  O  N N 273 
THR CG2  C  N N 274 
THR OXT  O  N N 275 
THR H    H  N N 276 
THR H2   H  N N 277 
THR HA   H  N N 278 
THR HB   H  N N 279 
THR HG1  H  N N 280 
THR HG21 H  N N 281 
THR HG22 H  N N 282 
THR HG23 H  N N 283 
THR HXT  H  N N 284 
TYR N    N  N N 285 
TYR CA   C  N S 286 
TYR C    C  N N 287 
TYR O    O  N N 288 
TYR CB   C  N N 289 
TYR CG   C  Y N 290 
TYR CD1  C  Y N 291 
TYR CD2  C  Y N 292 
TYR CE1  C  Y N 293 
TYR CE2  C  Y N 294 
TYR CZ   C  Y N 295 
TYR OH   O  N N 296 
TYR OXT  O  N N 297 
TYR H    H  N N 298 
TYR H2   H  N N 299 
TYR HA   H  N N 300 
TYR HB2  H  N N 301 
TYR HB3  H  N N 302 
TYR HD1  H  N N 303 
TYR HD2  H  N N 304 
TYR HE1  H  N N 305 
TYR HE2  H  N N 306 
TYR HH   H  N N 307 
TYR HXT  H  N N 308 
VAL N    N  N N 309 
VAL CA   C  N S 310 
VAL C    C  N N 311 
VAL O    O  N N 312 
VAL CB   C  N N 313 
VAL CG1  C  N N 314 
VAL CG2  C  N N 315 
VAL OXT  O  N N 316 
VAL H    H  N N 317 
VAL H2   H  N N 318 
VAL HA   H  N N 319 
VAL HB   H  N N 320 
VAL HG11 H  N N 321 
VAL HG12 H  N N 322 
VAL HG13 H  N N 323 
VAL HG21 H  N N 324 
VAL HG22 H  N N 325 
VAL HG23 H  N N 326 
VAL HXT  H  N N 327 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASP N   CA   sing N N 39  
ASP N   H    sing N N 40  
ASP N   H2   sing N N 41  
ASP CA  C    sing N N 42  
ASP CA  CB   sing N N 43  
ASP CA  HA   sing N N 44  
ASP C   O    doub N N 45  
ASP C   OXT  sing N N 46  
ASP CB  CG   sing N N 47  
ASP CB  HB2  sing N N 48  
ASP CB  HB3  sing N N 49  
ASP CG  OD1  doub N N 50  
ASP CG  OD2  sing N N 51  
ASP OD2 HD2  sing N N 52  
ASP OXT HXT  sing N N 53  
CYS N   CA   sing N N 54  
CYS N   H    sing N N 55  
CYS N   H2   sing N N 56  
CYS CA  C    sing N N 57  
CYS CA  CB   sing N N 58  
CYS CA  HA   sing N N 59  
CYS C   O    doub N N 60  
CYS C   OXT  sing N N 61  
CYS CB  SG   sing N N 62  
CYS CB  HB2  sing N N 63  
CYS CB  HB3  sing N N 64  
CYS SG  HG   sing N N 65  
CYS OXT HXT  sing N N 66  
FES FE1 S1   sing N N 67  
FES FE1 S2   sing N N 68  
FES FE2 S1   sing N N 69  
FES FE2 S2   sing N N 70  
GLN N   CA   sing N N 71  
GLN N   H    sing N N 72  
GLN N   H2   sing N N 73  
GLN CA  C    sing N N 74  
GLN CA  CB   sing N N 75  
GLN CA  HA   sing N N 76  
GLN C   O    doub N N 77  
GLN C   OXT  sing N N 78  
GLN CB  CG   sing N N 79  
GLN CB  HB2  sing N N 80  
GLN CB  HB3  sing N N 81  
GLN CG  CD   sing N N 82  
GLN CG  HG2  sing N N 83  
GLN CG  HG3  sing N N 84  
GLN CD  OE1  doub N N 85  
GLN CD  NE2  sing N N 86  
GLN NE2 HE21 sing N N 87  
GLN NE2 HE22 sing N N 88  
GLN OXT HXT  sing N N 89  
GLU N   CA   sing N N 90  
GLU N   H    sing N N 91  
GLU N   H2   sing N N 92  
GLU CA  C    sing N N 93  
GLU CA  CB   sing N N 94  
GLU CA  HA   sing N N 95  
GLU C   O    doub N N 96  
GLU C   OXT  sing N N 97  
GLU CB  CG   sing N N 98  
GLU CB  HB2  sing N N 99  
GLU CB  HB3  sing N N 100 
GLU CG  CD   sing N N 101 
GLU CG  HG2  sing N N 102 
GLU CG  HG3  sing N N 103 
GLU CD  OE1  doub N N 104 
GLU CD  OE2  sing N N 105 
GLU OE2 HE2  sing N N 106 
GLU OXT HXT  sing N N 107 
GLY N   CA   sing N N 108 
GLY N   H    sing N N 109 
GLY N   H2   sing N N 110 
GLY CA  C    sing N N 111 
GLY CA  HA2  sing N N 112 
GLY CA  HA3  sing N N 113 
GLY C   O    doub N N 114 
GLY C   OXT  sing N N 115 
GLY OXT HXT  sing N N 116 
HIS N   CA   sing N N 117 
HIS N   H    sing N N 118 
HIS N   H2   sing N N 119 
HIS CA  C    sing N N 120 
HIS CA  CB   sing N N 121 
HIS CA  HA   sing N N 122 
HIS C   O    doub N N 123 
HIS C   OXT  sing N N 124 
HIS CB  CG   sing N N 125 
HIS CB  HB2  sing N N 126 
HIS CB  HB3  sing N N 127 
HIS CG  ND1  sing Y N 128 
HIS CG  CD2  doub Y N 129 
HIS ND1 CE1  doub Y N 130 
HIS ND1 HD1  sing N N 131 
HIS CD2 NE2  sing Y N 132 
HIS CD2 HD2  sing N N 133 
HIS CE1 NE2  sing Y N 134 
HIS CE1 HE1  sing N N 135 
HIS NE2 HE2  sing N N 136 
HIS OXT HXT  sing N N 137 
ILE N   CA   sing N N 138 
ILE N   H    sing N N 139 
ILE N   H2   sing N N 140 
ILE CA  C    sing N N 141 
ILE CA  CB   sing N N 142 
ILE CA  HA   sing N N 143 
ILE C   O    doub N N 144 
ILE C   OXT  sing N N 145 
ILE CB  CG1  sing N N 146 
ILE CB  CG2  sing N N 147 
ILE CB  HB   sing N N 148 
ILE CG1 CD1  sing N N 149 
ILE CG1 HG12 sing N N 150 
ILE CG1 HG13 sing N N 151 
ILE CG2 HG21 sing N N 152 
ILE CG2 HG22 sing N N 153 
ILE CG2 HG23 sing N N 154 
ILE CD1 HD11 sing N N 155 
ILE CD1 HD12 sing N N 156 
ILE CD1 HD13 sing N N 157 
ILE OXT HXT  sing N N 158 
LEU N   CA   sing N N 159 
LEU N   H    sing N N 160 
LEU N   H2   sing N N 161 
LEU CA  C    sing N N 162 
LEU CA  CB   sing N N 163 
LEU CA  HA   sing N N 164 
LEU C   O    doub N N 165 
LEU C   OXT  sing N N 166 
LEU CB  CG   sing N N 167 
LEU CB  HB2  sing N N 168 
LEU CB  HB3  sing N N 169 
LEU CG  CD1  sing N N 170 
LEU CG  CD2  sing N N 171 
LEU CG  HG   sing N N 172 
LEU CD1 HD11 sing N N 173 
LEU CD1 HD12 sing N N 174 
LEU CD1 HD13 sing N N 175 
LEU CD2 HD21 sing N N 176 
LEU CD2 HD22 sing N N 177 
LEU CD2 HD23 sing N N 178 
LEU OXT HXT  sing N N 179 
LYS N   CA   sing N N 180 
LYS N   H    sing N N 181 
LYS N   H2   sing N N 182 
LYS CA  C    sing N N 183 
LYS CA  CB   sing N N 184 
LYS CA  HA   sing N N 185 
LYS C   O    doub N N 186 
LYS C   OXT  sing N N 187 
LYS CB  CG   sing N N 188 
LYS CB  HB2  sing N N 189 
LYS CB  HB3  sing N N 190 
LYS CG  CD   sing N N 191 
LYS CG  HG2  sing N N 192 
LYS CG  HG3  sing N N 193 
LYS CD  CE   sing N N 194 
LYS CD  HD2  sing N N 195 
LYS CD  HD3  sing N N 196 
LYS CE  NZ   sing N N 197 
LYS CE  HE2  sing N N 198 
LYS CE  HE3  sing N N 199 
LYS NZ  HZ1  sing N N 200 
LYS NZ  HZ2  sing N N 201 
LYS NZ  HZ3  sing N N 202 
LYS OXT HXT  sing N N 203 
PHE N   CA   sing N N 204 
PHE N   H    sing N N 205 
PHE N   H2   sing N N 206 
PHE CA  C    sing N N 207 
PHE CA  CB   sing N N 208 
PHE CA  HA   sing N N 209 
PHE C   O    doub N N 210 
PHE C   OXT  sing N N 211 
PHE CB  CG   sing N N 212 
PHE CB  HB2  sing N N 213 
PHE CB  HB3  sing N N 214 
PHE CG  CD1  doub Y N 215 
PHE CG  CD2  sing Y N 216 
PHE CD1 CE1  sing Y N 217 
PHE CD1 HD1  sing N N 218 
PHE CD2 CE2  doub Y N 219 
PHE CD2 HD2  sing N N 220 
PHE CE1 CZ   doub Y N 221 
PHE CE1 HE1  sing N N 222 
PHE CE2 CZ   sing Y N 223 
PHE CE2 HE2  sing N N 224 
PHE CZ  HZ   sing N N 225 
PHE OXT HXT  sing N N 226 
PRO N   CA   sing N N 227 
PRO N   CD   sing N N 228 
PRO N   H    sing N N 229 
PRO CA  C    sing N N 230 
PRO CA  CB   sing N N 231 
PRO CA  HA   sing N N 232 
PRO C   O    doub N N 233 
PRO C   OXT  sing N N 234 
PRO CB  CG   sing N N 235 
PRO CB  HB2  sing N N 236 
PRO CB  HB3  sing N N 237 
PRO CG  CD   sing N N 238 
PRO CG  HG2  sing N N 239 
PRO CG  HG3  sing N N 240 
PRO CD  HD2  sing N N 241 
PRO CD  HD3  sing N N 242 
PRO OXT HXT  sing N N 243 
SER N   CA   sing N N 244 
SER N   H    sing N N 245 
SER N   H2   sing N N 246 
SER CA  C    sing N N 247 
SER CA  CB   sing N N 248 
SER CA  HA   sing N N 249 
SER C   O    doub N N 250 
SER C   OXT  sing N N 251 
SER CB  OG   sing N N 252 
SER CB  HB2  sing N N 253 
SER CB  HB3  sing N N 254 
SER OG  HG   sing N N 255 
SER OXT HXT  sing N N 256 
THR N   CA   sing N N 257 
THR N   H    sing N N 258 
THR N   H2   sing N N 259 
THR CA  C    sing N N 260 
THR CA  CB   sing N N 261 
THR CA  HA   sing N N 262 
THR C   O    doub N N 263 
THR C   OXT  sing N N 264 
THR CB  OG1  sing N N 265 
THR CB  CG2  sing N N 266 
THR CB  HB   sing N N 267 
THR OG1 HG1  sing N N 268 
THR CG2 HG21 sing N N 269 
THR CG2 HG22 sing N N 270 
THR CG2 HG23 sing N N 271 
THR OXT HXT  sing N N 272 
TYR N   CA   sing N N 273 
TYR N   H    sing N N 274 
TYR N   H2   sing N N 275 
TYR CA  C    sing N N 276 
TYR CA  CB   sing N N 277 
TYR CA  HA   sing N N 278 
TYR C   O    doub N N 279 
TYR C   OXT  sing N N 280 
TYR CB  CG   sing N N 281 
TYR CB  HB2  sing N N 282 
TYR CB  HB3  sing N N 283 
TYR CG  CD1  doub Y N 284 
TYR CG  CD2  sing Y N 285 
TYR CD1 CE1  sing Y N 286 
TYR CD1 HD1  sing N N 287 
TYR CD2 CE2  doub Y N 288 
TYR CD2 HD2  sing N N 289 
TYR CE1 CZ   doub Y N 290 
TYR CE1 HE1  sing N N 291 
TYR CE2 CZ   sing Y N 292 
TYR CE2 HE2  sing N N 293 
TYR CZ  OH   sing N N 294 
TYR OH  HH   sing N N 295 
TYR OXT HXT  sing N N 296 
VAL N   CA   sing N N 297 
VAL N   H    sing N N 298 
VAL N   H2   sing N N 299 
VAL CA  C    sing N N 300 
VAL CA  CB   sing N N 301 
VAL CA  HA   sing N N 302 
VAL C   O    doub N N 303 
VAL C   OXT  sing N N 304 
VAL CB  CG1  sing N N 305 
VAL CB  CG2  sing N N 306 
VAL CB  HB   sing N N 307 
VAL CG1 HG11 sing N N 308 
VAL CG1 HG12 sing N N 309 
VAL CG1 HG13 sing N N 310 
VAL CG2 HG21 sing N N 311 
VAL CG2 HG22 sing N N 312 
VAL CG2 HG23 sing N N 313 
VAL OXT HXT  sing N N 314 
# 
_atom_sites.entry_id                    1DOX 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
H  
N  
O  
S  
# 
loop_