data_1DUM # _entry.id 1DUM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1DUM pdb_00001dum 10.2210/pdb1dum/pdb RCSB RCSB010384 ? ? WWPDB D_1000010384 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-06-27 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1DUM _pdbx_database_status.recvd_initial_deposition_date 2000-01-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Takeda, A.' 1 'Wakamatsu, K.' 2 'Tachi, T.' 3 'Matsuzaki, K.' 4 # _citation.id primary _citation.title 'Effects of peptide dimerization on pore formation: Antiparallel disulfide-dimerized magainin 2 analogue.' _citation.journal_abbrev Biopolymers _citation.journal_volume 58 _citation.page_first 437 _citation.page_last 446 _citation.year 2001 _citation.journal_id_ASTM BIPMAA _citation.country US _citation.journal_id_ISSN 0006-3525 _citation.journal_id_CSD 0161 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11180056 _citation.pdbx_database_id_DOI '10.1002/1097-0282(20010405)58:4<437::AID-BIP1019>3.3.CO;2-9' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hara, T.' 1 ? primary 'Kodama, H.' 2 ? primary 'Kondo, M.' 3 ? primary 'Wakamatsu, K.' 4 ? primary 'Takeda, A.' 5 ? primary 'Tachi, T.' 6 ? primary 'Matsuzaki, K.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'MAGAININ 2' _entity.formula_weight 2526.973 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation 'F5Y, F16W' _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GIGKYLHSAKKFGKAWVGEIMNS _entity_poly.pdbx_seq_one_letter_code_can GIGKYLHSAKKFGKAWVGEIMNS _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 GLY n 1 4 LYS n 1 5 TYR n 1 6 LEU n 1 7 HIS n 1 8 SER n 1 9 ALA n 1 10 LYS n 1 11 LYS n 1 12 PHE n 1 13 GLY n 1 14 LYS n 1 15 ALA n 1 16 TRP n 1 17 VAL n 1 18 GLY n 1 19 GLU n 1 20 ILE n 1 21 MET n 1 22 ASN n 1 23 SER n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;The peptide was prepared by solid-phase synthesis. The sequence of this peptide naturally occurs in Xenopus laevis (African clawed frog) ; # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 MET 21 21 21 MET MET A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 SER 23 23 23 SER SER A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 ILE 2 2 2 ILE ILE B . n B 1 3 GLY 3 3 3 GLY GLY B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 TYR 5 5 5 TYR TYR B . n B 1 6 LEU 6 6 6 LEU LEU B . n B 1 7 HIS 7 7 7 HIS HIS B . n B 1 8 SER 8 8 8 SER SER B . n B 1 9 ALA 9 9 9 ALA ALA B . n B 1 10 LYS 10 10 10 LYS LYS B . n B 1 11 LYS 11 11 11 LYS LYS B . n B 1 12 PHE 12 12 12 PHE PHE B . n B 1 13 GLY 13 13 13 GLY GLY B . n B 1 14 LYS 14 14 14 LYS LYS B . n B 1 15 ALA 15 15 15 ALA ALA B . n B 1 16 TRP 16 16 16 TRP TRP B . n B 1 17 VAL 17 17 17 VAL VAL B . n B 1 18 GLY 18 18 18 GLY GLY B . n B 1 19 GLU 19 19 19 GLU GLU B . n B 1 20 ILE 20 20 20 ILE ILE B . n B 1 21 MET 21 21 21 MET MET B . n B 1 22 ASN 22 22 22 ASN ASN B . n B 1 23 SER 23 23 23 SER SER B . n # _cell.entry_id 1DUM _cell.length_a 1.0 _cell.length_b 1.0 _cell.length_c 1.0 _cell.angle_alpha 90.0 _cell.angle_beta 90.0 _cell.angle_gamma 90.0 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1DUM _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1DUM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1DUM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1DUM _struct.title 'NMR STRUCTURE OF [F5Y, F16W] MAGAININ 2 BOUND TO PHOSPHOLIPID VESICLES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1DUM _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'antibiotic, magainin, dimer, amphipathic helix, membrane, vesicle, bilayer, ANTIMICROBIAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MAGA_XENLA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P11006 _struct_ref.pdbx_align_begin 129 _struct_ref.pdbx_seq_one_letter_code ;MFKGLFICSLIAVICANALPQPEASADEDMDEREVRGIGKFLHSAGKFGKAFVGEIMKSKRDAEAVGPEAFADEDLDERE VRGIGKFLHSAKKFGKAFVGEIMNSKRDAEAVGPEAFADEDLDEREVRGIGKFLHSAKKFGKAFVGEIMNSKRDAEAVGP EAFADEDLDEREVRGIGKFLHSAKKFGKAFVGEIMNSKRDAEAVGPEAFADEDFDEREVRGIGKFLHSAKKFGKAFVGEI MNSKRDAEAVGPEAFADEDLDEREVRGIGKFLHSAKKFGKAFVGEIMNSKRDAEAVDDRRWVE ; _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1DUM A 1 ? 23 ? P11006 129 ? 151 ? 1 23 2 1 1DUM B 1 ? 23 ? P11006 129 ? 151 ? 1 23 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1DUM TYR A 5 ? UNP P11006 PHE 133 'engineered mutation' 5 1 1 1DUM TRP A 16 ? UNP P11006 PHE 144 'engineered mutation' 16 2 2 1DUM TYR B 5 ? UNP P11006 PHE 133 'engineered mutation' 5 3 2 1DUM TRP B 16 ? UNP P11006 PHE 144 'engineered mutation' 16 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 8 ? MET A 21 ? SER A 8 MET A 21 1 ? 14 HELX_P HELX_P2 2 SER B 8 ? MET B 21 ? SER B 8 MET B 21 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O B ALA 9 ? ? H B GLY 13 ? ? 1.43 2 1 O A ALA 9 ? ? H A GLY 13 ? ? 1.47 3 1 O B PHE 12 ? ? H B TRP 16 ? ? 1.57 4 1 O A PHE 12 ? ? H A TRP 16 ? ? 1.58 5 1 O B LYS 4 ? ? H B ALA 9 ? ? 1.59 6 2 O A ALA 9 ? ? H A GLY 13 ? ? 1.46 7 2 O A PHE 12 ? ? H A TRP 16 ? ? 1.52 8 2 O B ALA 9 ? ? H B GLY 13 ? ? 1.57 9 3 O B ALA 9 ? ? H B GLY 13 ? ? 1.43 10 3 O A ALA 9 ? ? H A GLY 13 ? ? 1.43 11 4 O B ALA 9 ? ? H B GLY 13 ? ? 1.46 12 4 O A ALA 9 ? ? H A GLY 13 ? ? 1.50 13 4 O A PHE 12 ? ? H A TRP 16 ? ? 1.59 14 5 O A ALA 9 ? ? H A GLY 13 ? ? 1.46 15 5 O B ALA 9 ? ? H B GLY 13 ? ? 1.56 16 5 O B PHE 12 ? ? H B TRP 16 ? ? 1.59 17 6 O A ALA 9 ? ? H A GLY 13 ? ? 1.47 18 6 O B ALA 9 ? ? H B GLY 13 ? ? 1.49 19 6 O B PHE 12 ? ? H B TRP 16 ? ? 1.57 20 6 O A PHE 12 ? ? H A TRP 16 ? ? 1.58 21 7 O A ALA 9 ? ? H A GLY 13 ? ? 1.45 22 7 O A PHE 12 ? ? H A TRP 16 ? ? 1.48 23 7 O B PHE 12 ? ? H B TRP 16 ? ? 1.58 24 7 O B ALA 9 ? ? H B GLY 13 ? ? 1.58 25 8 O A ALA 9 ? ? H A GLY 13 ? ? 1.42 26 8 O B ALA 9 ? ? H B GLY 13 ? ? 1.45 27 8 O B LYS 4 ? ? H B ALA 9 ? ? 1.46 28 8 O B PHE 12 ? ? H B TRP 16 ? ? 1.53 29 9 O A ALA 9 ? ? H A GLY 13 ? ? 1.41 30 9 O A LYS 4 ? ? H A ALA 9 ? ? 1.54 31 9 O A PHE 12 ? ? H A TRP 16 ? ? 1.57 32 9 O B ALA 9 ? ? H B GLY 13 ? ? 1.58 33 10 O B ALA 9 ? ? H B GLY 13 ? ? 1.43 34 10 O A ALA 9 ? ? H A GLY 13 ? ? 1.44 35 10 O A LYS 4 ? ? H A SER 8 ? ? 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 2 ? ? 64.19 131.40 2 1 HIS A 7 ? ? -149.39 13.48 3 1 SER A 8 ? ? -165.39 -37.49 4 1 ILE B 2 ? ? 62.44 91.72 5 1 LYS B 4 ? ? -146.36 -41.37 6 2 LYS A 4 ? ? -158.87 -41.34 7 2 HIS A 7 ? ? -131.14 -31.64 8 2 ALA A 9 ? ? -51.19 -75.72 9 2 LYS A 10 ? ? -29.16 -42.66 10 2 LYS B 4 ? ? -148.61 -46.03 11 2 HIS B 7 ? ? -141.29 12.91 12 2 SER B 8 ? ? -164.89 -35.72 13 2 GLU B 19 ? ? -91.89 -68.82 14 3 LYS A 4 ? ? 175.84 -48.45 15 3 SER A 8 ? ? -157.98 -37.66 16 3 GLU A 19 ? ? -91.32 -64.11 17 3 LYS B 4 ? ? 175.31 -46.22 18 3 HIS B 7 ? ? -142.36 -32.97 19 3 LYS B 10 ? ? -30.85 -39.20 20 4 LYS A 4 ? ? -136.22 -41.56 21 4 HIS A 7 ? ? -151.61 -28.42 22 4 ALA A 9 ? ? -92.24 -63.80 23 4 GLU A 19 ? ? -86.65 -72.44 24 4 LYS B 4 ? ? -137.10 -45.94 25 4 SER B 8 ? ? -168.94 -35.26 26 5 LYS A 4 ? ? -147.26 -41.78 27 5 HIS A 7 ? ? -140.31 12.51 28 5 SER A 8 ? ? -165.85 -36.55 29 5 ALA A 9 ? ? -60.40 -70.89 30 5 GLU A 19 ? ? -91.32 -65.75 31 5 HIS B 7 ? ? -152.81 -30.41 32 5 LYS B 10 ? ? -39.64 -34.78 33 6 LYS A 4 ? ? -144.05 -41.89 34 6 SER A 8 ? ? -163.23 -36.32 35 6 ILE B 2 ? ? 51.66 78.65 36 6 LYS B 4 ? ? -135.67 -44.68 37 6 SER B 8 ? ? -158.24 -37.38 38 6 GLU B 19 ? ? -86.82 -72.50 39 7 LYS A 4 ? ? -136.77 -39.69 40 7 SER A 8 ? ? -169.49 -37.93 41 7 GLU A 19 ? ? -87.22 -71.32 42 7 LYS B 4 ? ? -136.91 -39.35 43 7 SER B 8 ? ? -171.16 -34.22 44 7 GLU B 19 ? ? -87.69 -71.90 45 8 ILE A 2 ? ? 59.40 75.38 46 8 LYS A 4 ? ? -137.70 -40.64 47 8 SER A 8 ? ? -165.26 -36.26 48 8 LYS A 10 ? ? -28.67 -48.05 49 8 GLU A 19 ? ? -92.92 -61.57 50 8 SER B 8 ? ? -141.90 -38.19 51 8 GLU B 19 ? ? -90.63 -67.85 52 9 ILE A 2 ? ? -153.66 70.51 53 9 LYS A 4 ? ? -133.39 -35.01 54 9 HIS A 7 ? ? -147.84 14.78 55 9 SER A 8 ? ? -159.95 -39.42 56 9 LYS A 10 ? ? -25.00 -54.15 57 9 GLU A 19 ? ? -88.58 -71.61 58 9 ILE B 2 ? ? 62.67 63.39 59 9 LYS B 4 ? ? -142.97 -47.54 60 9 SER B 8 ? ? -167.27 -37.67 61 9 GLU B 19 ? ? -105.94 -68.52 62 10 ILE A 2 ? ? -163.44 63.85 63 10 LYS A 4 ? ? -134.12 -43.81 64 10 HIS A 7 ? ? -136.84 -30.87 65 10 GLU A 19 ? ? -90.01 -63.93 66 10 HIS B 7 ? ? -152.66 16.95 67 10 SER B 8 ? ? -165.60 -38.99 68 10 GLU B 19 ? ? -93.90 -65.43 # _pdbx_nmr_ensemble.entry_id 1DUM _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1DUM _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;5mM [F5Y, F16W] magainin 2, 0.5mM DLPC-d64 ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 318 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '2D NOESY' # _pdbx_nmr_details.entry_id 1DUM _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_refine.entry_id 1DUM _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'The structures are based on 466 NOE-derived distance constraints (per protomer), 32 of which are treated as ambiguous.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal UXNMR 1.3 collection Bruker 1 X-PLOR 3.1 refinement Brunger 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 GLU N N N N 31 GLU CA C N S 32 GLU C C N N 33 GLU O O N N 34 GLU CB C N N 35 GLU CG C N N 36 GLU CD C N N 37 GLU OE1 O N N 38 GLU OE2 O N N 39 GLU OXT O N N 40 GLU H H N N 41 GLU H2 H N N 42 GLU HA H N N 43 GLU HB2 H N N 44 GLU HB3 H N N 45 GLU HG2 H N N 46 GLU HG3 H N N 47 GLU HE2 H N N 48 GLU HXT H N N 49 GLY N N N N 50 GLY CA C N N 51 GLY C C N N 52 GLY O O N N 53 GLY OXT O N N 54 GLY H H N N 55 GLY H2 H N N 56 GLY HA2 H N N 57 GLY HA3 H N N 58 GLY HXT H N N 59 HIS N N N N 60 HIS CA C N S 61 HIS C C N N 62 HIS O O N N 63 HIS CB C N N 64 HIS CG C Y N 65 HIS ND1 N Y N 66 HIS CD2 C Y N 67 HIS CE1 C Y N 68 HIS NE2 N Y N 69 HIS OXT O N N 70 HIS H H N N 71 HIS H2 H N N 72 HIS HA H N N 73 HIS HB2 H N N 74 HIS HB3 H N N 75 HIS HD1 H N N 76 HIS HD2 H N N 77 HIS HE1 H N N 78 HIS HE2 H N N 79 HIS HXT H N N 80 ILE N N N N 81 ILE CA C N S 82 ILE C C N N 83 ILE O O N N 84 ILE CB C N S 85 ILE CG1 C N N 86 ILE CG2 C N N 87 ILE CD1 C N N 88 ILE OXT O N N 89 ILE H H N N 90 ILE H2 H N N 91 ILE HA H N N 92 ILE HB H N N 93 ILE HG12 H N N 94 ILE HG13 H N N 95 ILE HG21 H N N 96 ILE HG22 H N N 97 ILE HG23 H N N 98 ILE HD11 H N N 99 ILE HD12 H N N 100 ILE HD13 H N N 101 ILE HXT H N N 102 LEU N N N N 103 LEU CA C N S 104 LEU C C N N 105 LEU O O N N 106 LEU CB C N N 107 LEU CG C N N 108 LEU CD1 C N N 109 LEU CD2 C N N 110 LEU OXT O N N 111 LEU H H N N 112 LEU H2 H N N 113 LEU HA H N N 114 LEU HB2 H N N 115 LEU HB3 H N N 116 LEU HG H N N 117 LEU HD11 H N N 118 LEU HD12 H N N 119 LEU HD13 H N N 120 LEU HD21 H N N 121 LEU HD22 H N N 122 LEU HD23 H N N 123 LEU HXT H N N 124 LYS N N N N 125 LYS CA C N S 126 LYS C C N N 127 LYS O O N N 128 LYS CB C N N 129 LYS CG C N N 130 LYS CD C N N 131 LYS CE C N N 132 LYS NZ N N N 133 LYS OXT O N N 134 LYS H H N N 135 LYS H2 H N N 136 LYS HA H N N 137 LYS HB2 H N N 138 LYS HB3 H N N 139 LYS HG2 H N N 140 LYS HG3 H N N 141 LYS HD2 H N N 142 LYS HD3 H N N 143 LYS HE2 H N N 144 LYS HE3 H N N 145 LYS HZ1 H N N 146 LYS HZ2 H N N 147 LYS HZ3 H N N 148 LYS HXT H N N 149 MET N N N N 150 MET CA C N S 151 MET C C N N 152 MET O O N N 153 MET CB C N N 154 MET CG C N N 155 MET SD S N N 156 MET CE C N N 157 MET OXT O N N 158 MET H H N N 159 MET H2 H N N 160 MET HA H N N 161 MET HB2 H N N 162 MET HB3 H N N 163 MET HG2 H N N 164 MET HG3 H N N 165 MET HE1 H N N 166 MET HE2 H N N 167 MET HE3 H N N 168 MET HXT H N N 169 PHE N N N N 170 PHE CA C N S 171 PHE C C N N 172 PHE O O N N 173 PHE CB C N N 174 PHE CG C Y N 175 PHE CD1 C Y N 176 PHE CD2 C Y N 177 PHE CE1 C Y N 178 PHE CE2 C Y N 179 PHE CZ C Y N 180 PHE OXT O N N 181 PHE H H N N 182 PHE H2 H N N 183 PHE HA H N N 184 PHE HB2 H N N 185 PHE HB3 H N N 186 PHE HD1 H N N 187 PHE HD2 H N N 188 PHE HE1 H N N 189 PHE HE2 H N N 190 PHE HZ H N N 191 PHE HXT H N N 192 SER N N N N 193 SER CA C N S 194 SER C C N N 195 SER O O N N 196 SER CB C N N 197 SER OG O N N 198 SER OXT O N N 199 SER H H N N 200 SER H2 H N N 201 SER HA H N N 202 SER HB2 H N N 203 SER HB3 H N N 204 SER HG H N N 205 SER HXT H N N 206 TRP N N N N 207 TRP CA C N S 208 TRP C C N N 209 TRP O O N N 210 TRP CB C N N 211 TRP CG C Y N 212 TRP CD1 C Y N 213 TRP CD2 C Y N 214 TRP NE1 N Y N 215 TRP CE2 C Y N 216 TRP CE3 C Y N 217 TRP CZ2 C Y N 218 TRP CZ3 C Y N 219 TRP CH2 C Y N 220 TRP OXT O N N 221 TRP H H N N 222 TRP H2 H N N 223 TRP HA H N N 224 TRP HB2 H N N 225 TRP HB3 H N N 226 TRP HD1 H N N 227 TRP HE1 H N N 228 TRP HE3 H N N 229 TRP HZ2 H N N 230 TRP HZ3 H N N 231 TRP HH2 H N N 232 TRP HXT H N N 233 TYR N N N N 234 TYR CA C N S 235 TYR C C N N 236 TYR O O N N 237 TYR CB C N N 238 TYR CG C Y N 239 TYR CD1 C Y N 240 TYR CD2 C Y N 241 TYR CE1 C Y N 242 TYR CE2 C Y N 243 TYR CZ C Y N 244 TYR OH O N N 245 TYR OXT O N N 246 TYR H H N N 247 TYR H2 H N N 248 TYR HA H N N 249 TYR HB2 H N N 250 TYR HB3 H N N 251 TYR HD1 H N N 252 TYR HD2 H N N 253 TYR HE1 H N N 254 TYR HE2 H N N 255 TYR HH H N N 256 TYR HXT H N N 257 VAL N N N N 258 VAL CA C N S 259 VAL C C N N 260 VAL O O N N 261 VAL CB C N N 262 VAL CG1 C N N 263 VAL CG2 C N N 264 VAL OXT O N N 265 VAL H H N N 266 VAL H2 H N N 267 VAL HA H N N 268 VAL HB H N N 269 VAL HG11 H N N 270 VAL HG12 H N N 271 VAL HG13 H N N 272 VAL HG21 H N N 273 VAL HG22 H N N 274 VAL HG23 H N N 275 VAL HXT H N N 276 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 GLU N CA sing N N 29 GLU N H sing N N 30 GLU N H2 sing N N 31 GLU CA C sing N N 32 GLU CA CB sing N N 33 GLU CA HA sing N N 34 GLU C O doub N N 35 GLU C OXT sing N N 36 GLU CB CG sing N N 37 GLU CB HB2 sing N N 38 GLU CB HB3 sing N N 39 GLU CG CD sing N N 40 GLU CG HG2 sing N N 41 GLU CG HG3 sing N N 42 GLU CD OE1 doub N N 43 GLU CD OE2 sing N N 44 GLU OE2 HE2 sing N N 45 GLU OXT HXT sing N N 46 GLY N CA sing N N 47 GLY N H sing N N 48 GLY N H2 sing N N 49 GLY CA C sing N N 50 GLY CA HA2 sing N N 51 GLY CA HA3 sing N N 52 GLY C O doub N N 53 GLY C OXT sing N N 54 GLY OXT HXT sing N N 55 HIS N CA sing N N 56 HIS N H sing N N 57 HIS N H2 sing N N 58 HIS CA C sing N N 59 HIS CA CB sing N N 60 HIS CA HA sing N N 61 HIS C O doub N N 62 HIS C OXT sing N N 63 HIS CB CG sing N N 64 HIS CB HB2 sing N N 65 HIS CB HB3 sing N N 66 HIS CG ND1 sing Y N 67 HIS CG CD2 doub Y N 68 HIS ND1 CE1 doub Y N 69 HIS ND1 HD1 sing N N 70 HIS CD2 NE2 sing Y N 71 HIS CD2 HD2 sing N N 72 HIS CE1 NE2 sing Y N 73 HIS CE1 HE1 sing N N 74 HIS NE2 HE2 sing N N 75 HIS OXT HXT sing N N 76 ILE N CA sing N N 77 ILE N H sing N N 78 ILE N H2 sing N N 79 ILE CA C sing N N 80 ILE CA CB sing N N 81 ILE CA HA sing N N 82 ILE C O doub N N 83 ILE C OXT sing N N 84 ILE CB CG1 sing N N 85 ILE CB CG2 sing N N 86 ILE CB HB sing N N 87 ILE CG1 CD1 sing N N 88 ILE CG1 HG12 sing N N 89 ILE CG1 HG13 sing N N 90 ILE CG2 HG21 sing N N 91 ILE CG2 HG22 sing N N 92 ILE CG2 HG23 sing N N 93 ILE CD1 HD11 sing N N 94 ILE CD1 HD12 sing N N 95 ILE CD1 HD13 sing N N 96 ILE OXT HXT sing N N 97 LEU N CA sing N N 98 LEU N H sing N N 99 LEU N H2 sing N N 100 LEU CA C sing N N 101 LEU CA CB sing N N 102 LEU CA HA sing N N 103 LEU C O doub N N 104 LEU C OXT sing N N 105 LEU CB CG sing N N 106 LEU CB HB2 sing N N 107 LEU CB HB3 sing N N 108 LEU CG CD1 sing N N 109 LEU CG CD2 sing N N 110 LEU CG HG sing N N 111 LEU CD1 HD11 sing N N 112 LEU CD1 HD12 sing N N 113 LEU CD1 HD13 sing N N 114 LEU CD2 HD21 sing N N 115 LEU CD2 HD22 sing N N 116 LEU CD2 HD23 sing N N 117 LEU OXT HXT sing N N 118 LYS N CA sing N N 119 LYS N H sing N N 120 LYS N H2 sing N N 121 LYS CA C sing N N 122 LYS CA CB sing N N 123 LYS CA HA sing N N 124 LYS C O doub N N 125 LYS C OXT sing N N 126 LYS CB CG sing N N 127 LYS CB HB2 sing N N 128 LYS CB HB3 sing N N 129 LYS CG CD sing N N 130 LYS CG HG2 sing N N 131 LYS CG HG3 sing N N 132 LYS CD CE sing N N 133 LYS CD HD2 sing N N 134 LYS CD HD3 sing N N 135 LYS CE NZ sing N N 136 LYS CE HE2 sing N N 137 LYS CE HE3 sing N N 138 LYS NZ HZ1 sing N N 139 LYS NZ HZ2 sing N N 140 LYS NZ HZ3 sing N N 141 LYS OXT HXT sing N N 142 MET N CA sing N N 143 MET N H sing N N 144 MET N H2 sing N N 145 MET CA C sing N N 146 MET CA CB sing N N 147 MET CA HA sing N N 148 MET C O doub N N 149 MET C OXT sing N N 150 MET CB CG sing N N 151 MET CB HB2 sing N N 152 MET CB HB3 sing N N 153 MET CG SD sing N N 154 MET CG HG2 sing N N 155 MET CG HG3 sing N N 156 MET SD CE sing N N 157 MET CE HE1 sing N N 158 MET CE HE2 sing N N 159 MET CE HE3 sing N N 160 MET OXT HXT sing N N 161 PHE N CA sing N N 162 PHE N H sing N N 163 PHE N H2 sing N N 164 PHE CA C sing N N 165 PHE CA CB sing N N 166 PHE CA HA sing N N 167 PHE C O doub N N 168 PHE C OXT sing N N 169 PHE CB CG sing N N 170 PHE CB HB2 sing N N 171 PHE CB HB3 sing N N 172 PHE CG CD1 doub Y N 173 PHE CG CD2 sing Y N 174 PHE CD1 CE1 sing Y N 175 PHE CD1 HD1 sing N N 176 PHE CD2 CE2 doub Y N 177 PHE CD2 HD2 sing N N 178 PHE CE1 CZ doub Y N 179 PHE CE1 HE1 sing N N 180 PHE CE2 CZ sing Y N 181 PHE CE2 HE2 sing N N 182 PHE CZ HZ sing N N 183 PHE OXT HXT sing N N 184 SER N CA sing N N 185 SER N H sing N N 186 SER N H2 sing N N 187 SER CA C sing N N 188 SER CA CB sing N N 189 SER CA HA sing N N 190 SER C O doub N N 191 SER C OXT sing N N 192 SER CB OG sing N N 193 SER CB HB2 sing N N 194 SER CB HB3 sing N N 195 SER OG HG sing N N 196 SER OXT HXT sing N N 197 TRP N CA sing N N 198 TRP N H sing N N 199 TRP N H2 sing N N 200 TRP CA C sing N N 201 TRP CA CB sing N N 202 TRP CA HA sing N N 203 TRP C O doub N N 204 TRP C OXT sing N N 205 TRP CB CG sing N N 206 TRP CB HB2 sing N N 207 TRP CB HB3 sing N N 208 TRP CG CD1 doub Y N 209 TRP CG CD2 sing Y N 210 TRP CD1 NE1 sing Y N 211 TRP CD1 HD1 sing N N 212 TRP CD2 CE2 doub Y N 213 TRP CD2 CE3 sing Y N 214 TRP NE1 CE2 sing Y N 215 TRP NE1 HE1 sing N N 216 TRP CE2 CZ2 sing Y N 217 TRP CE3 CZ3 doub Y N 218 TRP CE3 HE3 sing N N 219 TRP CZ2 CH2 doub Y N 220 TRP CZ2 HZ2 sing N N 221 TRP CZ3 CH2 sing Y N 222 TRP CZ3 HZ3 sing N N 223 TRP CH2 HH2 sing N N 224 TRP OXT HXT sing N N 225 TYR N CA sing N N 226 TYR N H sing N N 227 TYR N H2 sing N N 228 TYR CA C sing N N 229 TYR CA CB sing N N 230 TYR CA HA sing N N 231 TYR C O doub N N 232 TYR C OXT sing N N 233 TYR CB CG sing N N 234 TYR CB HB2 sing N N 235 TYR CB HB3 sing N N 236 TYR CG CD1 doub Y N 237 TYR CG CD2 sing Y N 238 TYR CD1 CE1 sing Y N 239 TYR CD1 HD1 sing N N 240 TYR CD2 CE2 doub Y N 241 TYR CD2 HD2 sing N N 242 TYR CE1 CZ doub Y N 243 TYR CE1 HE1 sing N N 244 TYR CE2 CZ sing Y N 245 TYR CE2 HE2 sing N N 246 TYR CZ OH sing N N 247 TYR OH HH sing N N 248 TYR OXT HXT sing N N 249 VAL N CA sing N N 250 VAL N H sing N N 251 VAL N H2 sing N N 252 VAL CA C sing N N 253 VAL CA CB sing N N 254 VAL CA HA sing N N 255 VAL C O doub N N 256 VAL C OXT sing N N 257 VAL CB CG1 sing N N 258 VAL CB CG2 sing N N 259 VAL CB HB sing N N 260 VAL CG1 HG11 sing N N 261 VAL CG1 HG12 sing N N 262 VAL CG1 HG13 sing N N 263 VAL CG2 HG21 sing N N 264 VAL CG2 HG22 sing N N 265 VAL CG2 HG23 sing N N 266 VAL OXT HXT sing N N 267 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model ARX _pdbx_nmr_spectrometer.field_strength 400 # _atom_sites.entry_id 1DUM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_