data_1E0M # _entry.id 1E0M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1E0M PDBE EBI-4804 WWPDB D_1290004804 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1E0L unspecified 'FBP28WW DOMAIN FROM MUS MUSCULUS' PDB 1E0N unspecified 'YJQ8WW DOMAIN FROM SACCHAROMYCES CEREVISAE' BMRB 4713 unspecified 'NMR RESTRAINTS FOR ENTRY 1E0M' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1E0M _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2000-04-01 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Macias, M.J.' 1 'Gervais, V.' 2 'Civera, C.' 3 'Oschkinat, H.' 4 # _citation.id primary _citation.title 'Structural Analysis of Ww Domains and Design of a Ww Prototype' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 7 _citation.page_first 375 _citation.page_last ? _citation.year 2000 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10802733 _citation.pdbx_database_id_DOI 10.1038/75144 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Macias, M.J.' 1 primary 'Gervais, V.' 2 primary 'Civera, C.' 3 primary 'Oschkinat, H.' 4 # _cell.entry_id 1E0M _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1E0M _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description WWPROTOTYPE _entity.formula_weight 4358.737 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment DOMAIN _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SMGLPPGWDEYKTHNGKTYYYNHNTKTSTWTDPRMSS _entity_poly.pdbx_seq_one_letter_code_can SMGLPPGWDEYKTHNGKTYYYNHNTKTSTWTDPRMSS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 GLY n 1 4 LEU n 1 5 PRO n 1 6 PRO n 1 7 GLY n 1 8 TRP n 1 9 ASP n 1 10 GLU n 1 11 TYR n 1 12 LYS n 1 13 THR n 1 14 HIS n 1 15 ASN n 1 16 GLY n 1 17 LYS n 1 18 THR n 1 19 TYR n 1 20 TYR n 1 21 TYR n 1 22 ASN n 1 23 HIS n 1 24 ASN n 1 25 THR n 1 26 LYS n 1 27 THR n 1 28 SER n 1 29 THR n 1 30 TRP n 1 31 THR n 1 32 ASP n 1 33 PRO n 1 34 ARG n 1 35 MET n 1 36 SER n 1 37 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'SYNTHETIC CONSTRUCT' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'SYNTHETIC GENE' # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 1E0M _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession 1E0M _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1E0M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 37 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 1E0M _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 37 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 37 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1E0M _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1E0M _pdbx_nmr_details.text 'HOMONUCLEAR NMR' # _pdbx_nmr_ensemble.entry_id 1E0M _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY' # _pdbx_nmr_representative.entry_id 1E0M _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement ARIA ? ;LINGE, O'DONOGHUE ; 1 'structure solution' XEASY ? ? 2 'structure solution' ARIA/CNS ? ? 3 # _exptl.entry_id 1E0M _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1E0M _struct.title 'PROTOTYPE WW domain' _struct.pdbx_descriptor WWPROTOTYPE _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1E0M _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'SH3 PROTOTYPE, WWPROTOTYPE, PROTEIN DESIGN, DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 8 ? THR A 13 ? TRP A 8 THR A 13 A 2 LYS A 17 ? HIS A 23 ? LYS A 17 HIS A 23 A 3 LYS A 26 ? TRP A 30 ? LYS A 26 TRP A 30 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 11 ? N TYR A 11 O TYR A 19 ? O TYR A 19 A 2 3 N ASN A 22 ? N ASN A 22 O THR A 27 ? O THR A 27 # _database_PDB_matrix.entry_id 1E0M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1E0M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 TRP 8 8 8 TRP TRP A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 SER 37 37 37 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-04-20 2 'Structure model' 1 1 2015-10-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Derived calculations' 2 2 'Structure model' Other 3 2 'Structure model' 'Source and taxonomy' 4 2 'Structure model' 'Version format compliance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 5 ? ? -48.55 164.74 2 1 PRO A 6 ? ? -63.07 2.73 3 1 THR A 13 ? ? -75.33 -157.37 4 1 LYS A 26 ? ? 54.74 70.50 5 1 MET A 35 ? ? -89.12 -87.43 6 2 PRO A 5 ? ? -49.82 167.55 7 2 PRO A 6 ? ? -64.90 8.59 8 2 THR A 13 ? ? -72.82 -161.39 9 2 ARG A 34 ? ? -38.68 -33.31 10 3 THR A 13 ? ? -79.05 -161.97 11 3 THR A 18 ? ? -66.14 79.28 12 3 LYS A 26 ? ? 48.70 71.95 13 3 SER A 36 ? ? -152.43 39.88 14 4 MET A 2 ? ? -148.66 -63.81 15 4 PRO A 5 ? ? -48.37 164.64 16 4 PRO A 6 ? ? -63.12 3.54 17 4 THR A 13 ? ? -77.08 -164.27 18 4 THR A 18 ? ? -67.36 77.56 19 4 LYS A 26 ? ? 52.95 74.21 20 4 SER A 36 ? ? -99.83 33.90 21 5 THR A 13 ? ? -75.40 -169.88 22 5 THR A 18 ? ? -66.45 79.60 23 5 LYS A 26 ? ? 51.34 71.72 24 5 MET A 35 ? ? 45.21 83.77 25 6 MET A 2 ? ? 59.13 -177.74 26 6 PRO A 5 ? ? -48.14 163.66 27 6 PRO A 6 ? ? -59.94 -4.38 28 6 THR A 13 ? ? -74.77 -162.70 29 6 THR A 18 ? ? -65.65 80.30 30 6 LYS A 26 ? ? 53.58 73.53 31 6 MET A 35 ? ? 44.32 87.13 32 7 THR A 13 ? ? -75.47 -163.15 33 7 THR A 18 ? ? -69.39 75.34 34 7 MET A 35 ? ? -86.58 -73.58 35 8 THR A 13 ? ? -65.56 -95.23 36 8 HIS A 14 ? ? -123.64 -65.22 37 8 THR A 18 ? ? -66.46 79.41 38 8 LYS A 26 ? ? 48.06 70.78 39 8 MET A 35 ? ? -126.36 -169.03 40 8 SER A 36 ? ? -162.64 102.83 41 9 THR A 13 ? ? -79.59 -161.31 42 9 THR A 18 ? ? -68.19 78.00 43 9 LYS A 26 ? ? 48.46 71.20 44 9 MET A 35 ? ? -73.28 -164.47 45 10 MET A 2 ? ? 60.66 175.30 46 10 PRO A 5 ? ? -48.92 164.45 47 10 THR A 13 ? ? -68.09 -166.74 48 10 LYS A 26 ? ? 50.91 72.01 49 10 MET A 35 ? ? -82.63 -81.99 50 10 SER A 36 ? ? -124.63 -75.02 #