data_1E0Z # _entry.id 1E0Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1E0Z pdb_00001e0z 10.2210/pdb1e0z/pdb PDBE EBI-4406 ? ? WWPDB D_1290004406 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-04-12 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2023-11-15 5 'Structure model' 2 1 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' Other 8 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp_atom 3 4 'Structure model' chem_comp_bond 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_database_status 6 4 'Structure model' pdbx_nmr_software 7 4 'Structure model' pdbx_struct_conn_angle 8 4 'Structure model' struct_conn 9 4 'Structure model' struct_site 10 5 'Structure model' pdbx_entry_details 11 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.auth_atom_id' 2 4 'Structure model' '_atom_site.label_atom_id' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_mr' 6 4 'Structure model' '_pdbx_nmr_software.name' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.value' 13 4 'Structure model' '_struct_conn.pdbx_dist_value' 14 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 15 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 27 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1E0Z _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2000-04-11 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1E10 _pdbx_database_related.content_type unspecified _pdbx_database_related.details '[2FE-2S]-FERREDOXIN FROM HALOBACTERIUM SALINARUM' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schweimer, K.' 1 'Marg, B.' 2 'Oesterhelt, D.' 3 'Roesch, P.' 4 'Sticht, H.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'A Two-Alpha-Helix Extra Domain Mediates the Halophilic Character of a Plant-Type Ferredoxin from Halophilic Archaea.' Biochemistry 44 29 ? 2005 BICHAW US 0006-2960 0033 ? 15628843 10.1021/BI0485169 1 'Sequence-Specific 1H, 13C and 15N Resonance Assignments and Secondary Structure of [2Fe-2S] Ferredoxin from Halobacterium Salinarum' J.Biomol.NMR 16 347 ? 2000 JBNME9 NE 0925-2738 0800 ? 10826887 10.1023/A:1008381016258 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Marg, B.' 1 ? primary 'Schweimer, K.' 2 ? primary 'Sticht, H.' 3 ? primary 'Oesterhelt, D.' 4 ? 1 'Schweimer, K.' 5 ? 1 'Marg, B.-L.' 6 ? 1 'Oesterhelt, D.' 7 ? 1 'Roesch, P.' 8 ? 1 'Sticht, H.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat FERREDOXIN 14336.571 1 ? ? ? ? 2 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;PTVEYLNYETLDDQGWDMDDDDLFEKAADAGLDGEDYGTMEVAEGEYILEAAEAQGYDWPFSCRAGACANCASIVKEGEI DMDMQQILSDEEVEEKDVRLTCIGSPAADEVKIVYNA(ALY)HLDYLQNRVI ; _entity_poly.pdbx_seq_one_letter_code_can ;PTVEYLNYETLDDQGWDMDDDDLFEKAADAGLDGEDYGTMEVAEGEYILEAAEAQGYDWPFSCRAGACANCASIVKEGEI DMDMQQILSDEEVEEKDVRLTCIGSPAADEVKIVYNAKHLDYLQNRVI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'FE2/S2 (INORGANIC) CLUSTER' _pdbx_entity_nonpoly.comp_id FES # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 THR n 1 3 VAL n 1 4 GLU n 1 5 TYR n 1 6 LEU n 1 7 ASN n 1 8 TYR n 1 9 GLU n 1 10 THR n 1 11 LEU n 1 12 ASP n 1 13 ASP n 1 14 GLN n 1 15 GLY n 1 16 TRP n 1 17 ASP n 1 18 MET n 1 19 ASP n 1 20 ASP n 1 21 ASP n 1 22 ASP n 1 23 LEU n 1 24 PHE n 1 25 GLU n 1 26 LYS n 1 27 ALA n 1 28 ALA n 1 29 ASP n 1 30 ALA n 1 31 GLY n 1 32 LEU n 1 33 ASP n 1 34 GLY n 1 35 GLU n 1 36 ASP n 1 37 TYR n 1 38 GLY n 1 39 THR n 1 40 MET n 1 41 GLU n 1 42 VAL n 1 43 ALA n 1 44 GLU n 1 45 GLY n 1 46 GLU n 1 47 TYR n 1 48 ILE n 1 49 LEU n 1 50 GLU n 1 51 ALA n 1 52 ALA n 1 53 GLU n 1 54 ALA n 1 55 GLN n 1 56 GLY n 1 57 TYR n 1 58 ASP n 1 59 TRP n 1 60 PRO n 1 61 PHE n 1 62 SER n 1 63 CYS n 1 64 ARG n 1 65 ALA n 1 66 GLY n 1 67 ALA n 1 68 CYS n 1 69 ALA n 1 70 ASN n 1 71 CYS n 1 72 ALA n 1 73 SER n 1 74 ILE n 1 75 VAL n 1 76 LYS n 1 77 GLU n 1 78 GLY n 1 79 GLU n 1 80 ILE n 1 81 ASP n 1 82 MET n 1 83 ASP n 1 84 MET n 1 85 GLN n 1 86 GLN n 1 87 ILE n 1 88 LEU n 1 89 SER n 1 90 ASP n 1 91 GLU n 1 92 GLU n 1 93 VAL n 1 94 GLU n 1 95 GLU n 1 96 LYS n 1 97 ASP n 1 98 VAL n 1 99 ARG n 1 100 LEU n 1 101 THR n 1 102 CYS n 1 103 ILE n 1 104 GLY n 1 105 SER n 1 106 PRO n 1 107 ALA n 1 108 ALA n 1 109 ASP n 1 110 GLU n 1 111 VAL n 1 112 LYS n 1 113 ILE n 1 114 VAL n 1 115 TYR n 1 116 ASN n 1 117 ALA n 1 118 ALY n 1 119 HIS n 1 120 LEU n 1 121 ASP n 1 122 TYR n 1 123 LEU n 1 124 GLN n 1 125 ASN n 1 126 ARG n 1 127 VAL n 1 128 ILE n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'HALOBACTERIUM SALINARIUM' _entity_src_nat.pdbx_ncbi_taxonomy_id 2242 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3' 188.224 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FES non-polymer . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2' 175.820 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 CYS 71 71 71 CYS CYS A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 MET 82 82 82 MET MET A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ALY 118 118 118 ALY ALY A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 GLN 124 124 124 GLN GLN A . n A 1 125 ASN 125 125 125 ASN ASN A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 ILE 128 128 128 ILE ILE A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id FES _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 130 _pdbx_nonpoly_scheme.auth_seq_num 130 _pdbx_nonpoly_scheme.pdb_mon_id FES _pdbx_nonpoly_scheme.auth_mon_id FES _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 1E0Z _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1E0Z _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1E0Z _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1E0Z _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1E0Z _struct.title '[2Fe-2S]-Ferredoxin from Halobacterium salinarum' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1E0Z _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'ELECTRON TRANSPORT, IRON-SULFUR PROTEIN, FERREDOXIN, HALOPHILIC' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FER_HALSA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P00216 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1E0Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00216 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 128 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 128 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 8 ? GLN A 14 ? TYR A 8 GLN A 14 1 7 7 HELX_P HELX_P2 2 ASP A 22 ? GLY A 31 ? ASP A 22 GLY A 31 1 10 10 HELX_P HELX_P3 3 TYR A 47 ? ALA A 54 ? TYR A 47 ALA A 54 1 8 8 HELX_P HELX_P4 4 SER A 89 ? LYS A 96 ? SER A 89 LYS A 96 1 8 8 HELX_P HELX_P5 5 ASN A 116 ? LEU A 120 ? ASN A 116 LEU A 120 5 5 5 HELX_P HELX_P6 6 LEU A 120 ? VAL A 127 ? LEU A 120 VAL A 127 1 8 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 117 C ? ? ? 1_555 A ALY 118 N ? ? A ALA 117 A ALY 118 1_555 ? ? ? ? ? ? ? 1.303 ? ? covale2 covale both ? A ALY 118 C ? ? ? 1_555 A HIS 119 N ? ? A ALY 118 A HIS 119 1_555 ? ? ? ? ? ? ? 1.305 ? ? metalc1 metalc ? ? A CYS 63 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 63 A FES 130 1_555 ? ? ? ? ? ? ? 2.200 ? ? metalc2 metalc ? ? A CYS 68 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 68 A FES 130 1_555 ? ? ? ? ? ? ? 2.196 ? ? metalc3 metalc ? ? A CYS 71 SG ? ? ? 1_555 B FES . FE2 ? ? A CYS 71 A FES 130 1_555 ? ? ? ? ? ? ? 2.202 ? ? metalc4 metalc ? ? A CYS 102 SG ? ? ? 1_555 B FES . FE2 ? ? A CYS 102 A FES 130 1_555 ? ? ? ? ? ? ? 2.200 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 63 ? A CYS 63 ? 1_555 FE1 ? B FES . ? A FES 130 ? 1_555 S1 ? B FES . ? A FES 130 ? 1_555 110.3 ? 2 SG ? A CYS 63 ? A CYS 63 ? 1_555 FE1 ? B FES . ? A FES 130 ? 1_555 S2 ? B FES . ? A FES 130 ? 1_555 109.6 ? 3 S1 ? B FES . ? A FES 130 ? 1_555 FE1 ? B FES . ? A FES 130 ? 1_555 S2 ? B FES . ? A FES 130 ? 1_555 107.1 ? 4 SG ? A CYS 63 ? A CYS 63 ? 1_555 FE1 ? B FES . ? A FES 130 ? 1_555 SG ? A CYS 68 ? A CYS 68 ? 1_555 109.8 ? 5 S1 ? B FES . ? A FES 130 ? 1_555 FE1 ? B FES . ? A FES 130 ? 1_555 SG ? A CYS 68 ? A CYS 68 ? 1_555 110.1 ? 6 S2 ? B FES . ? A FES 130 ? 1_555 FE1 ? B FES . ? A FES 130 ? 1_555 SG ? A CYS 68 ? A CYS 68 ? 1_555 109.8 ? 7 SG ? A CYS 71 ? A CYS 71 ? 1_555 FE2 ? B FES . ? A FES 130 ? 1_555 S1 ? B FES . ? A FES 130 ? 1_555 110.6 ? 8 SG ? A CYS 71 ? A CYS 71 ? 1_555 FE2 ? B FES . ? A FES 130 ? 1_555 S2 ? B FES . ? A FES 130 ? 1_555 109.6 ? 9 S1 ? B FES . ? A FES 130 ? 1_555 FE2 ? B FES . ? A FES 130 ? 1_555 S2 ? B FES . ? A FES 130 ? 1_555 107.2 ? 10 SG ? A CYS 71 ? A CYS 71 ? 1_555 FE2 ? B FES . ? A FES 130 ? 1_555 SG ? A CYS 102 ? A CYS 102 ? 1_555 109.9 ? 11 S1 ? B FES . ? A FES 130 ? 1_555 FE2 ? B FES . ? A FES 130 ? 1_555 SG ? A CYS 102 ? A CYS 102 ? 1_555 110.0 ? 12 S2 ? B FES . ? A FES 130 ? 1_555 FE2 ? B FES . ? A FES 130 ? 1_555 SG ? A CYS 102 ? A CYS 102 ? 1_555 109.5 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id ALY _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 118 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id ALY _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 118 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id LYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id ALY _pdbx_modification_feature.type Acetylation _pdbx_modification_feature.category 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 36 ? GLU A 41 ? ASP A 36 GLU A 41 A 2 THR A 2 ? ASN A 7 ? THR A 2 ASN A 7 A 3 GLU A 110 ? TYR A 115 ? GLU A 110 TYR A 115 A 4 CYS A 71 ? GLU A 77 ? CYS A 71 GLU A 77 A 5 ASP A 97 ? THR A 101 ? ASP A 97 THR A 101 B 1 GLU A 79 ? ASP A 83 ? GLU A 79 ASP A 83 B 2 ILE A 103 ? ALA A 107 ? ILE A 103 ALA A 107 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLY A 38 ? O GLY A 38 N TYR A 5 ? N TYR A 5 A 2 3 O THR A 2 ? O THR A 2 N VAL A 111 ? N VAL A 111 A 3 4 O LYS A 112 ? O LYS A 112 N GLU A 77 ? N GLU A 77 A 4 5 O SER A 73 ? O SER A 73 N ARG A 99 ? N ARG A 99 B 1 2 O ASP A 81 ? O ASP A 81 N SER A 105 ? N SER A 105 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id FES _struct_site.pdbx_auth_seq_id 130 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'BINDING SITE FOR RESIDUE FES A 130' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 SER A 62 ? SER A 62 . ? 1_555 ? 2 AC1 9 CYS A 63 ? CYS A 63 . ? 1_555 ? 3 AC1 9 ARG A 64 ? ARG A 64 . ? 1_555 ? 4 AC1 9 GLY A 66 ? GLY A 66 . ? 1_555 ? 5 AC1 9 ALA A 67 ? ALA A 67 . ? 1_555 ? 6 AC1 9 CYS A 68 ? CYS A 68 . ? 1_555 ? 7 AC1 9 CYS A 71 ? CYS A 71 . ? 1_555 ? 8 AC1 9 LEU A 100 ? LEU A 100 . ? 1_555 ? 9 AC1 9 CYS A 102 ? CYS A 102 . ? 1_555 ? # _pdbx_entry_details.entry_id 1E0Z _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A ASP 81 ? ? O A SER 105 ? ? 1.49 2 1 O A ASP 22 ? ? H A GLU 25 ? ? 1.51 3 1 O A ALA 117 ? ? H A LEU 120 ? ? 1.53 4 1 O A LEU 123 ? ? H A ARG 126 ? ? 1.54 5 1 O A GLU 91 ? ? H A GLU 95 ? ? 1.59 6 1 HH A TYR 5 ? ? O A GLY 34 ? ? 1.59 7 2 O A TYR 47 ? ? H A ALA 51 ? ? 1.54 8 2 O A ASP 22 ? ? H A GLU 25 ? ? 1.57 9 2 O A GLU 91 ? ? H A GLU 95 ? ? 1.57 10 2 O A VAL 3 ? ? H A MET 40 ? ? 1.59 11 3 O A ASP 22 ? ? H A GLU 25 ? ? 1.59 12 4 O A ASP 81 ? ? H A SER 105 ? ? 1.45 13 4 O A TYR 47 ? ? H A ALA 51 ? ? 1.46 14 5 O A TYR 47 ? ? H A ALA 51 ? ? 1.45 15 5 H2 A PRO 1 ? ? O A VAL 42 ? ? 1.54 16 5 O A ALA 117 ? ? H A LEU 120 ? ? 1.57 17 6 HH A TYR 5 ? ? O A GLY 34 ? ? 1.39 18 6 O A ASP 22 ? ? H A GLU 25 ? ? 1.54 19 6 H A LYS 76 ? ? O A LYS 112 ? ? 1.58 20 6 H A THR 2 ? ? O A ASP 109 ? ? 1.58 21 6 O A VAL 3 ? ? H A MET 40 ? ? 1.58 22 7 O A ASP 22 ? ? H A GLU 25 ? ? 1.51 23 7 H A ASP 81 ? ? O A SER 105 ? ? 1.52 24 7 O A ALA 117 ? ? H A LEU 120 ? ? 1.56 25 7 O A VAL 3 ? ? H A MET 40 ? ? 1.57 26 7 O A GLU 9 ? ? H A ASP 13 ? ? 1.58 27 8 O A ASP 22 ? ? H A GLU 25 ? ? 1.46 28 8 H A ASP 81 ? ? O A SER 105 ? ? 1.55 29 9 O A ASP 22 ? ? H A LYS 26 ? ? 1.52 30 9 O A ALA 117 ? ? H A LEU 120 ? ? 1.59 31 10 HH A TYR 5 ? ? O A GLY 34 ? ? 1.41 32 10 H A ASP 81 ? ? O A SER 105 ? ? 1.54 33 10 O A VAL 3 ? ? H A MET 40 ? ? 1.59 34 10 H A VAL 75 ? ? O A ASP 97 ? ? 1.60 35 11 O A ALA 117 ? ? H A LEU 120 ? ? 1.46 36 11 O A PHE 24 ? ? HH A TYR 37 ? ? 1.52 37 11 O A GLU 77 ? ? H A LYS 112 ? ? 1.53 38 11 O A LEU 120 ? ? H A GLN 124 ? ? 1.53 39 11 O A ASP 22 ? ? H A GLU 25 ? ? 1.56 40 11 H A VAL 3 ? ? O A MET 40 ? ? 1.56 41 12 H A VAL 75 ? ? O A ASP 97 ? ? 1.55 42 12 O A GLU 9 ? ? H A ASP 13 ? ? 1.57 43 12 O A ALA 117 ? ? H A LEU 120 ? ? 1.57 44 12 O A ASP 22 ? ? H A GLU 25 ? ? 1.59 45 13 O A VAL 3 ? ? H A MET 40 ? ? 1.46 46 13 O A ASP 22 ? ? H A LYS 26 ? ? 1.49 47 14 O A ALA 117 ? ? H A LEU 120 ? ? 1.47 48 14 O A ASP 22 ? ? H A LYS 26 ? ? 1.55 49 14 O A VAL 3 ? ? H A MET 40 ? ? 1.60 50 15 O A PHE 24 ? ? HH A TYR 37 ? ? 1.43 51 15 H2 A PRO 1 ? ? O A VAL 42 ? ? 1.48 52 15 O A VAL 3 ? ? H A MET 40 ? ? 1.50 53 15 O A ASP 22 ? ? H A GLU 25 ? ? 1.54 54 15 H A ASP 81 ? ? O A SER 105 ? ? 1.56 55 16 O A LEU 120 ? ? H A LEU 123 ? ? 1.47 56 16 O A ALA 117 ? ? H A LEU 120 ? ? 1.53 57 16 O A ASP 22 ? ? H A GLU 25 ? ? 1.54 58 16 H A ASP 81 ? ? O A SER 105 ? ? 1.55 59 17 O A TYR 47 ? ? H A ALA 51 ? ? 1.46 60 17 O A ASP 22 ? ? H A GLU 25 ? ? 1.51 61 18 H A ASP 81 ? ? O A SER 105 ? ? 1.51 62 18 O A ASP 22 ? ? H A GLU 25 ? ? 1.52 63 18 O A LEU 23 ? ? H A ALA 27 ? ? 1.57 64 19 O A ALA 117 ? ? H A LEU 120 ? ? 1.48 65 19 O A MET 18 ? ? HZ3 A LYS 76 ? ? 1.52 66 19 O A LEU 23 ? ? H A ALA 27 ? ? 1.52 67 19 O A LEU 123 ? ? H A ARG 126 ? ? 1.57 68 19 H A VAL 75 ? ? O A ASP 97 ? ? 1.59 69 20 O A VAL 3 ? ? H A MET 40 ? ? 1.50 70 20 H A ASP 81 ? ? O A SER 105 ? ? 1.56 71 20 O A GLU 77 ? ? H A LYS 112 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 19 ? ? -142.54 12.44 2 1 LEU A 32 ? ? -59.07 -172.55 3 1 ILE A 48 ? ? -54.62 -70.01 4 1 SER A 62 ? ? -144.25 -58.51 5 1 ALA A 72 ? ? -44.47 151.55 6 1 MET A 84 ? ? -69.39 74.97 7 1 GLN A 86 ? ? -162.10 78.43 8 1 ASN A 116 ? ? 72.84 54.68 9 2 ASP A 19 ? ? -150.47 11.17 10 2 ILE A 48 ? ? -40.42 -71.98 11 2 TYR A 57 ? ? -77.06 -169.94 12 2 SER A 62 ? ? -140.33 -58.57 13 2 ALA A 72 ? ? -48.40 151.10 14 2 GLU A 77 ? ? 170.38 146.82 15 2 GLN A 85 ? ? 179.70 -146.88 16 2 GLN A 86 ? ? -146.47 35.05 17 2 ASP A 97 ? ? 46.97 25.30 18 2 ASN A 116 ? ? 74.32 55.97 19 3 SER A 62 ? ? -136.63 -58.72 20 3 ALA A 72 ? ? -43.01 155.14 21 3 GLU A 77 ? ? 176.51 144.83 22 3 ASP A 83 ? ? -48.98 176.77 23 3 GLN A 85 ? ? 175.60 109.05 24 3 ALA A 107 ? ? -111.36 -72.01 25 3 ASP A 109 ? ? -46.44 -74.29 26 3 ASN A 116 ? ? 72.11 49.91 27 4 SER A 62 ? ? -144.31 -58.51 28 4 ALA A 72 ? ? -42.15 153.17 29 4 GLU A 77 ? ? 175.94 166.98 30 4 MET A 84 ? ? -47.74 177.38 31 4 GLN A 86 ? ? -136.00 -36.42 32 4 ASP A 109 ? ? -62.42 -76.25 33 4 ASN A 116 ? ? 73.42 55.15 34 5 ALA A 30 ? ? -91.10 -66.39 35 5 LEU A 32 ? ? -49.50 178.91 36 5 ILE A 48 ? ? -43.65 -70.88 37 5 SER A 62 ? ? -144.10 -58.57 38 5 ALA A 72 ? ? -43.01 157.06 39 5 MET A 84 ? ? -65.97 70.51 40 5 GLN A 85 ? ? -178.97 135.62 41 5 ARG A 99 ? ? -170.04 -152.43 42 5 ASP A 109 ? ? -61.17 -78.77 43 6 LEU A 32 ? ? -60.04 -171.68 44 6 SER A 62 ? ? -144.26 -58.53 45 6 GLU A 77 ? ? 176.65 151.71 46 6 GLN A 85 ? ? -170.49 -178.42 47 6 GLN A 86 ? ? -145.44 19.16 48 6 LEU A 88 ? ? -124.93 -169.97 49 6 ASN A 116 ? ? 73.75 56.80 50 7 ASP A 19 ? ? -154.51 20.52 51 7 SER A 62 ? ? -143.35 -58.58 52 7 ALA A 72 ? ? -46.55 153.55 53 7 GLU A 77 ? ? 174.17 157.26 54 7 MET A 84 ? ? -63.71 75.77 55 7 GLN A 85 ? ? 175.66 157.43 56 7 GLN A 86 ? ? -150.47 85.37 57 7 ARG A 99 ? ? -161.34 -160.43 58 7 ASN A 116 ? ? 73.24 54.25 59 8 SER A 62 ? ? -144.29 -58.68 60 8 ALA A 72 ? ? -43.03 150.84 61 8 GLU A 79 ? ? -168.91 101.42 62 8 MET A 84 ? ? -69.58 63.84 63 8 GLN A 85 ? ? -171.49 60.00 64 8 ASP A 109 ? ? -46.76 -74.53 65 8 ASN A 116 ? ? 74.97 53.94 66 9 SER A 62 ? ? -144.14 -58.61 67 9 ALA A 72 ? ? -46.98 156.85 68 9 GLU A 77 ? ? 178.89 173.64 69 9 GLN A 85 ? ? -163.57 -163.35 70 9 GLN A 86 ? ? -171.12 30.66 71 9 ASP A 97 ? ? 47.17 23.73 72 9 ALA A 107 ? ? -117.02 -75.64 73 9 ALA A 108 ? ? -50.84 171.17 74 9 ASN A 116 ? ? 72.90 53.26 75 10 SER A 62 ? ? -143.41 -58.58 76 10 ALA A 72 ? ? -40.49 155.91 77 10 GLU A 77 ? ? 172.76 143.05 78 10 ASP A 109 ? ? -70.08 -74.79 79 10 ASN A 116 ? ? 75.09 58.96 80 10 GLN A 124 ? ? -51.08 -73.81 81 11 LEU A 32 ? ? -53.25 176.21 82 11 ASP A 36 ? ? -123.51 -52.55 83 11 SER A 62 ? ? -142.66 -58.60 84 11 ALA A 72 ? ? -44.25 153.90 85 11 GLU A 77 ? ? 177.46 132.57 86 11 ASP A 109 ? ? -57.68 -76.91 87 11 ASN A 116 ? ? 72.49 53.43 88 12 TRP A 16 ? ? -113.42 -168.22 89 12 ASP A 20 ? ? -55.24 -70.12 90 12 LEU A 32 ? ? -51.60 -178.06 91 12 SER A 62 ? ? -144.32 -58.46 92 12 ALA A 72 ? ? -42.57 158.11 93 12 GLU A 77 ? ? 172.01 152.66 94 12 GLN A 85 ? ? -177.49 138.73 95 12 ASP A 109 ? ? -73.24 -75.43 96 12 ASN A 116 ? ? 74.47 58.33 97 12 LEU A 120 ? ? -43.31 159.06 98 13 ASP A 19 ? ? -159.90 21.10 99 13 ASP A 21 ? ? -80.03 -105.25 100 13 ASP A 22 ? ? -141.15 47.36 101 13 LEU A 23 ? ? -46.53 -84.75 102 13 SER A 62 ? ? -144.13 -58.59 103 13 ALA A 72 ? ? -45.77 156.55 104 13 SER A 73 ? ? -136.46 -159.44 105 13 GLU A 77 ? ? 179.77 167.29 106 13 GLN A 85 ? ? -171.01 -167.35 107 13 ASN A 116 ? ? 74.33 55.25 108 14 ASP A 17 ? ? -116.10 -167.83 109 14 ASP A 19 ? ? -152.52 20.41 110 14 ASP A 21 ? ? -80.14 -105.51 111 14 ASP A 22 ? ? -170.45 40.80 112 14 SER A 62 ? ? -144.18 -58.57 113 14 ALA A 72 ? ? -44.40 154.68 114 14 GLU A 77 ? ? -173.21 -177.06 115 14 GLN A 85 ? ? -156.47 -75.80 116 14 GLN A 86 ? ? 64.50 98.42 117 14 ASP A 109 ? ? -50.96 -75.46 118 14 ASN A 116 ? ? 75.95 59.13 119 14 LEU A 120 ? ? -42.81 152.20 120 15 ASP A 36 ? ? -127.79 -51.93 121 15 SER A 62 ? ? -144.39 -59.24 122 15 ALA A 72 ? ? -39.02 152.93 123 15 GLU A 77 ? ? 173.39 169.07 124 15 LEU A 120 ? ? -53.90 95.50 125 16 TRP A 16 ? ? -111.96 -168.63 126 16 SER A 62 ? ? -144.13 -58.71 127 16 ALA A 72 ? ? -48.43 157.99 128 16 GLU A 77 ? ? 173.21 162.11 129 16 GLN A 86 ? ? -160.50 89.35 130 16 ASP A 109 ? ? -72.72 -73.27 131 16 ASN A 116 ? ? 74.89 57.44 132 16 LEU A 120 ? ? -40.16 96.34 133 17 ASP A 19 ? ? -136.61 -30.00 134 17 ASP A 33 ? ? -45.63 151.89 135 17 ILE A 48 ? ? -44.27 -71.22 136 17 SER A 62 ? ? -144.30 -58.50 137 17 ALA A 72 ? ? -43.70 150.87 138 17 GLN A 85 ? ? -161.11 -158.66 139 17 ARG A 99 ? ? -175.02 -176.75 140 17 ASP A 109 ? ? -68.57 -79.65 141 17 ASN A 116 ? ? 81.59 66.16 142 18 SER A 62 ? ? -144.22 -58.50 143 18 ALA A 72 ? ? -44.65 150.82 144 18 GLU A 77 ? ? 178.52 166.86 145 18 ASP A 109 ? ? -87.31 -93.45 146 18 ASN A 116 ? ? 103.34 22.07 147 19 ASP A 17 ? ? -63.33 -176.02 148 19 SER A 62 ? ? -144.26 -58.63 149 19 ALA A 72 ? ? -46.06 154.08 150 19 GLU A 77 ? ? 176.12 174.14 151 19 GLN A 86 ? ? -146.46 25.16 152 19 ASP A 97 ? ? 47.15 25.73 153 19 ALA A 108 ? ? -100.88 -168.95 154 19 ASP A 109 ? ? -85.92 -70.87 155 20 LEU A 32 ? ? -68.15 -177.55 156 20 ILE A 48 ? ? -42.97 -72.95 157 20 SER A 62 ? ? -144.08 -58.56 158 20 ALA A 72 ? ? -41.56 150.37 159 20 VAL A 75 ? ? -45.71 109.04 160 20 GLU A 77 ? ? 172.72 153.02 161 20 GLU A 79 ? ? -173.74 140.84 162 20 GLN A 85 ? ? -161.79 -161.37 163 20 GLN A 86 ? ? -142.30 25.88 164 20 ASP A 97 ? ? 56.76 19.85 165 20 ASP A 109 ? ? -68.32 -84.53 166 20 ASN A 116 ? ? 71.08 49.08 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 64 ? ? 0.269 'SIDE CHAIN' 2 1 ARG A 99 ? ? 0.316 'SIDE CHAIN' 3 1 ARG A 126 ? ? 0.310 'SIDE CHAIN' 4 2 ARG A 64 ? ? 0.285 'SIDE CHAIN' 5 2 ARG A 99 ? ? 0.165 'SIDE CHAIN' 6 2 ARG A 126 ? ? 0.252 'SIDE CHAIN' 7 3 ARG A 64 ? ? 0.317 'SIDE CHAIN' 8 3 ARG A 99 ? ? 0.306 'SIDE CHAIN' 9 3 ARG A 126 ? ? 0.317 'SIDE CHAIN' 10 4 ARG A 99 ? ? 0.313 'SIDE CHAIN' 11 4 ARG A 126 ? ? 0.315 'SIDE CHAIN' 12 5 ARG A 64 ? ? 0.291 'SIDE CHAIN' 13 5 ARG A 99 ? ? 0.193 'SIDE CHAIN' 14 5 ARG A 126 ? ? 0.317 'SIDE CHAIN' 15 6 ARG A 64 ? ? 0.255 'SIDE CHAIN' 16 6 ARG A 99 ? ? 0.214 'SIDE CHAIN' 17 6 ARG A 126 ? ? 0.229 'SIDE CHAIN' 18 7 ARG A 64 ? ? 0.317 'SIDE CHAIN' 19 7 ARG A 99 ? ? 0.315 'SIDE CHAIN' 20 7 ARG A 126 ? ? 0.240 'SIDE CHAIN' 21 8 ARG A 64 ? ? 0.304 'SIDE CHAIN' 22 8 ARG A 99 ? ? 0.169 'SIDE CHAIN' 23 8 ARG A 126 ? ? 0.317 'SIDE CHAIN' 24 9 ARG A 64 ? ? 0.316 'SIDE CHAIN' 25 9 ARG A 99 ? ? 0.275 'SIDE CHAIN' 26 9 ARG A 126 ? ? 0.190 'SIDE CHAIN' 27 10 ARG A 64 ? ? 0.241 'SIDE CHAIN' 28 10 ARG A 99 ? ? 0.281 'SIDE CHAIN' 29 10 ARG A 126 ? ? 0.317 'SIDE CHAIN' 30 11 ARG A 64 ? ? 0.316 'SIDE CHAIN' 31 11 ARG A 99 ? ? 0.302 'SIDE CHAIN' 32 11 ARG A 126 ? ? 0.090 'SIDE CHAIN' 33 12 ARG A 64 ? ? 0.232 'SIDE CHAIN' 34 12 ARG A 99 ? ? 0.170 'SIDE CHAIN' 35 12 ARG A 126 ? ? 0.173 'SIDE CHAIN' 36 13 ARG A 64 ? ? 0.294 'SIDE CHAIN' 37 13 ARG A 99 ? ? 0.120 'SIDE CHAIN' 38 13 ARG A 126 ? ? 0.271 'SIDE CHAIN' 39 14 ARG A 99 ? ? 0.251 'SIDE CHAIN' 40 14 ARG A 126 ? ? 0.303 'SIDE CHAIN' 41 15 ARG A 64 ? ? 0.300 'SIDE CHAIN' 42 15 ARG A 99 ? ? 0.234 'SIDE CHAIN' 43 15 ARG A 126 ? ? 0.317 'SIDE CHAIN' 44 16 ARG A 64 ? ? 0.195 'SIDE CHAIN' 45 16 ARG A 99 ? ? 0.145 'SIDE CHAIN' 46 16 ARG A 126 ? ? 0.275 'SIDE CHAIN' 47 17 ARG A 64 ? ? 0.258 'SIDE CHAIN' 48 17 ARG A 99 ? ? 0.272 'SIDE CHAIN' 49 17 ARG A 126 ? ? 0.184 'SIDE CHAIN' 50 18 ARG A 64 ? ? 0.317 'SIDE CHAIN' 51 18 ARG A 99 ? ? 0.307 'SIDE CHAIN' 52 18 ARG A 126 ? ? 0.237 'SIDE CHAIN' 53 19 ARG A 64 ? ? 0.261 'SIDE CHAIN' 54 19 ARG A 99 ? ? 0.206 'SIDE CHAIN' 55 19 ARG A 126 ? ? 0.203 'SIDE CHAIN' 56 20 ARG A 64 ? ? 0.306 'SIDE CHAIN' 57 20 ARG A 99 ? ? 0.192 'SIDE CHAIN' 58 20 ARG A 126 ? ? 0.310 'SIDE CHAIN' # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id ALY _pdbx_struct_mod_residue.label_seq_id 118 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id ALY _pdbx_struct_mod_residue.auth_seq_id 118 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details 'N(6)-ACETYLLYSINE' # _pdbx_nmr_ensemble.entry_id 1E0Z _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION, LOWEST ENERGY' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '10% WATER/90% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 500 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '1H-1H NOESY' 1 2 1 '1H-1H TOCSY' 1 3 1 '1H-15N HSQC' 1 4 1 '1H-13C CT-HSQC' 1 5 1 '15N-EDITED NOESY(3D)' 1 6 1 '13C-EDITED N HNCO' 1 7 1 HNCA 1 8 1 HNCACB 1 9 1 'CBCA(CO)NH HBHA(CO)NH' 1 10 1 HNHA 1 11 1 HCCH-COSY 1 12 1 HCCH- 1 # _pdbx_nmr_details.entry_id 1E0Z _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING HETERONUCLEAR MULTIDIMENSIONAL NMR USING 15N- AND 13C,15N LABELED FERREDOXIN SAMPLES' # _pdbx_nmr_refine.entry_id 1E0Z _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE. FOR RESIDUES 60-71, 87, AND 100-104 NO NMR DISTANCE RESTRAINTS WERE OBTAINED BECAUSE OF THE PROXIMITY TO THE PARAMAGNETIC IRON-SULFUR CLUSTER. THE CONFORMATION OF THE CORRESPONDING RESIDUES WAS MODELLED BASED ON THE GEOMETRY OF THE CRYSTAL STRUCTURE OF THE HOMOLOGUOUS FERREDOXIN FROM HALOARCULA MARISMORTUI. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.851 BRUNGER 1 'structure solution' NMRView ? ? 2 'structure solution' NDEE ? ? 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ALY OH O N N 14 ALY CH C N N 15 ALY CH3 C N N 16 ALY NZ N N N 17 ALY CE C N N 18 ALY CD C N N 19 ALY CG C N N 20 ALY CB C N N 21 ALY CA C N S 22 ALY N N N N 23 ALY C C N N 24 ALY O O N N 25 ALY OXT O N N 26 ALY HH31 H N N 27 ALY HH32 H N N 28 ALY HH33 H N N 29 ALY HZ H N N 30 ALY HE3 H N N 31 ALY HE2 H N N 32 ALY HD3 H N N 33 ALY HD2 H N N 34 ALY HG3 H N N 35 ALY HG2 H N N 36 ALY HB3 H N N 37 ALY HB2 H N N 38 ALY HA H N N 39 ALY H H N N 40 ALY H2 H N N 41 ALY HXT H N N 42 ARG N N N N 43 ARG CA C N S 44 ARG C C N N 45 ARG O O N N 46 ARG CB C N N 47 ARG CG C N N 48 ARG CD C N N 49 ARG NE N N N 50 ARG CZ C N N 51 ARG NH1 N N N 52 ARG NH2 N N N 53 ARG OXT O N N 54 ARG H H N N 55 ARG H2 H N N 56 ARG HA H N N 57 ARG HB2 H N N 58 ARG HB3 H N N 59 ARG HG2 H N N 60 ARG HG3 H N N 61 ARG HD2 H N N 62 ARG HD3 H N N 63 ARG HE H N N 64 ARG HH11 H N N 65 ARG HH12 H N N 66 ARG HH21 H N N 67 ARG HH22 H N N 68 ARG HXT H N N 69 ASN N N N N 70 ASN CA C N S 71 ASN C C N N 72 ASN O O N N 73 ASN CB C N N 74 ASN CG C N N 75 ASN OD1 O N N 76 ASN ND2 N N N 77 ASN OXT O N N 78 ASN H H N N 79 ASN H2 H N N 80 ASN HA H N N 81 ASN HB2 H N N 82 ASN HB3 H N N 83 ASN HD21 H N N 84 ASN HD22 H N N 85 ASN HXT H N N 86 ASP N N N N 87 ASP CA C N S 88 ASP C C N N 89 ASP O O N N 90 ASP CB C N N 91 ASP CG C N N 92 ASP OD1 O N N 93 ASP OD2 O N N 94 ASP OXT O N N 95 ASP H H N N 96 ASP H2 H N N 97 ASP HA H N N 98 ASP HB2 H N N 99 ASP HB3 H N N 100 ASP HD2 H N N 101 ASP HXT H N N 102 CYS N N N N 103 CYS CA C N R 104 CYS C C N N 105 CYS O O N N 106 CYS CB C N N 107 CYS SG S N N 108 CYS OXT O N N 109 CYS H H N N 110 CYS H2 H N N 111 CYS HA H N N 112 CYS HB2 H N N 113 CYS HB3 H N N 114 CYS HG H N N 115 CYS HXT H N N 116 FES FE1 FE N N 117 FES FE2 FE N N 118 FES S1 S N N 119 FES S2 S N N 120 GLN N N N N 121 GLN CA C N S 122 GLN C C N N 123 GLN O O N N 124 GLN CB C N N 125 GLN CG C N N 126 GLN CD C N N 127 GLN OE1 O N N 128 GLN NE2 N N N 129 GLN OXT O N N 130 GLN H H N N 131 GLN H2 H N N 132 GLN HA H N N 133 GLN HB2 H N N 134 GLN HB3 H N N 135 GLN HG2 H N N 136 GLN HG3 H N N 137 GLN HE21 H N N 138 GLN HE22 H N N 139 GLN HXT H N N 140 GLU N N N N 141 GLU CA C N S 142 GLU C C N N 143 GLU O O N N 144 GLU CB C N N 145 GLU CG C N N 146 GLU CD C N N 147 GLU OE1 O N N 148 GLU OE2 O N N 149 GLU OXT O N N 150 GLU H H N N 151 GLU H2 H N N 152 GLU HA H N N 153 GLU HB2 H N N 154 GLU HB3 H N N 155 GLU HG2 H N N 156 GLU HG3 H N N 157 GLU HE2 H N N 158 GLU HXT H N N 159 GLY N N N N 160 GLY CA C N N 161 GLY C C N N 162 GLY O O N N 163 GLY OXT O N N 164 GLY H H N N 165 GLY H2 H N N 166 GLY HA2 H N N 167 GLY HA3 H N N 168 GLY HXT H N N 169 HIS N N N N 170 HIS CA C N S 171 HIS C C N N 172 HIS O O N N 173 HIS CB C N N 174 HIS CG C Y N 175 HIS ND1 N Y N 176 HIS CD2 C Y N 177 HIS CE1 C Y N 178 HIS NE2 N Y N 179 HIS OXT O N N 180 HIS H H N N 181 HIS H2 H N N 182 HIS HA H N N 183 HIS HB2 H N N 184 HIS HB3 H N N 185 HIS HD1 H N N 186 HIS HD2 H N N 187 HIS HE1 H N N 188 HIS HE2 H N N 189 HIS HXT H N N 190 ILE N N N N 191 ILE CA C N S 192 ILE C C N N 193 ILE O O N N 194 ILE CB C N S 195 ILE CG1 C N N 196 ILE CG2 C N N 197 ILE CD1 C N N 198 ILE OXT O N N 199 ILE H H N N 200 ILE H2 H N N 201 ILE HA H N N 202 ILE HB H N N 203 ILE HG12 H N N 204 ILE HG13 H N N 205 ILE HG21 H N N 206 ILE HG22 H N N 207 ILE HG23 H N N 208 ILE HD11 H N N 209 ILE HD12 H N N 210 ILE HD13 H N N 211 ILE HXT H N N 212 LEU N N N N 213 LEU CA C N S 214 LEU C C N N 215 LEU O O N N 216 LEU CB C N N 217 LEU CG C N N 218 LEU CD1 C N N 219 LEU CD2 C N N 220 LEU OXT O N N 221 LEU H H N N 222 LEU H2 H N N 223 LEU HA H N N 224 LEU HB2 H N N 225 LEU HB3 H N N 226 LEU HG H N N 227 LEU HD11 H N N 228 LEU HD12 H N N 229 LEU HD13 H N N 230 LEU HD21 H N N 231 LEU HD22 H N N 232 LEU HD23 H N N 233 LEU HXT H N N 234 LYS N N N N 235 LYS CA C N S 236 LYS C C N N 237 LYS O O N N 238 LYS CB C N N 239 LYS CG C N N 240 LYS CD C N N 241 LYS CE C N N 242 LYS NZ N N N 243 LYS OXT O N N 244 LYS H H N N 245 LYS H2 H N N 246 LYS HA H N N 247 LYS HB2 H N N 248 LYS HB3 H N N 249 LYS HG2 H N N 250 LYS HG3 H N N 251 LYS HD2 H N N 252 LYS HD3 H N N 253 LYS HE2 H N N 254 LYS HE3 H N N 255 LYS HZ1 H N N 256 LYS HZ2 H N N 257 LYS HZ3 H N N 258 LYS HXT H N N 259 MET N N N N 260 MET CA C N S 261 MET C C N N 262 MET O O N N 263 MET CB C N N 264 MET CG C N N 265 MET SD S N N 266 MET CE C N N 267 MET OXT O N N 268 MET H H N N 269 MET H2 H N N 270 MET HA H N N 271 MET HB2 H N N 272 MET HB3 H N N 273 MET HG2 H N N 274 MET HG3 H N N 275 MET HE1 H N N 276 MET HE2 H N N 277 MET HE3 H N N 278 MET HXT H N N 279 PHE N N N N 280 PHE CA C N S 281 PHE C C N N 282 PHE O O N N 283 PHE CB C N N 284 PHE CG C Y N 285 PHE CD1 C Y N 286 PHE CD2 C Y N 287 PHE CE1 C Y N 288 PHE CE2 C Y N 289 PHE CZ C Y N 290 PHE OXT O N N 291 PHE H H N N 292 PHE H2 H N N 293 PHE HA H N N 294 PHE HB2 H N N 295 PHE HB3 H N N 296 PHE HD1 H N N 297 PHE HD2 H N N 298 PHE HE1 H N N 299 PHE HE2 H N N 300 PHE HZ H N N 301 PHE HXT H N N 302 PRO N N N N 303 PRO CA C N S 304 PRO C C N N 305 PRO O O N N 306 PRO CB C N N 307 PRO CG C N N 308 PRO CD C N N 309 PRO OXT O N N 310 PRO H H N N 311 PRO HA H N N 312 PRO HB2 H N N 313 PRO HB3 H N N 314 PRO HG2 H N N 315 PRO HG3 H N N 316 PRO HD2 H N N 317 PRO HD3 H N N 318 PRO HXT H N N 319 SER N N N N 320 SER CA C N S 321 SER C C N N 322 SER O O N N 323 SER CB C N N 324 SER OG O N N 325 SER OXT O N N 326 SER H H N N 327 SER H2 H N N 328 SER HA H N N 329 SER HB2 H N N 330 SER HB3 H N N 331 SER HG H N N 332 SER HXT H N N 333 THR N N N N 334 THR CA C N S 335 THR C C N N 336 THR O O N N 337 THR CB C N R 338 THR OG1 O N N 339 THR CG2 C N N 340 THR OXT O N N 341 THR H H N N 342 THR H2 H N N 343 THR HA H N N 344 THR HB H N N 345 THR HG1 H N N 346 THR HG21 H N N 347 THR HG22 H N N 348 THR HG23 H N N 349 THR HXT H N N 350 TRP N N N N 351 TRP CA C N S 352 TRP C C N N 353 TRP O O N N 354 TRP CB C N N 355 TRP CG C Y N 356 TRP CD1 C Y N 357 TRP CD2 C Y N 358 TRP NE1 N Y N 359 TRP CE2 C Y N 360 TRP CE3 C Y N 361 TRP CZ2 C Y N 362 TRP CZ3 C Y N 363 TRP CH2 C Y N 364 TRP OXT O N N 365 TRP H H N N 366 TRP H2 H N N 367 TRP HA H N N 368 TRP HB2 H N N 369 TRP HB3 H N N 370 TRP HD1 H N N 371 TRP HE1 H N N 372 TRP HE3 H N N 373 TRP HZ2 H N N 374 TRP HZ3 H N N 375 TRP HH2 H N N 376 TRP HXT H N N 377 TYR N N N N 378 TYR CA C N S 379 TYR C C N N 380 TYR O O N N 381 TYR CB C N N 382 TYR CG C Y N 383 TYR CD1 C Y N 384 TYR CD2 C Y N 385 TYR CE1 C Y N 386 TYR CE2 C Y N 387 TYR CZ C Y N 388 TYR OH O N N 389 TYR OXT O N N 390 TYR H H N N 391 TYR H2 H N N 392 TYR HA H N N 393 TYR HB2 H N N 394 TYR HB3 H N N 395 TYR HD1 H N N 396 TYR HD2 H N N 397 TYR HE1 H N N 398 TYR HE2 H N N 399 TYR HH H N N 400 TYR HXT H N N 401 VAL N N N N 402 VAL CA C N S 403 VAL C C N N 404 VAL O O N N 405 VAL CB C N N 406 VAL CG1 C N N 407 VAL CG2 C N N 408 VAL OXT O N N 409 VAL H H N N 410 VAL H2 H N N 411 VAL HA H N N 412 VAL HB H N N 413 VAL HG11 H N N 414 VAL HG12 H N N 415 VAL HG13 H N N 416 VAL HG21 H N N 417 VAL HG22 H N N 418 VAL HG23 H N N 419 VAL HXT H N N 420 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ALY OH CH doub N N 13 ALY CH CH3 sing N N 14 ALY CH NZ sing N N 15 ALY CH3 HH31 sing N N 16 ALY CH3 HH32 sing N N 17 ALY CH3 HH33 sing N N 18 ALY NZ CE sing N N 19 ALY NZ HZ sing N N 20 ALY CE CD sing N N 21 ALY CE HE3 sing N N 22 ALY CE HE2 sing N N 23 ALY CD CG sing N N 24 ALY CD HD3 sing N N 25 ALY CD HD2 sing N N 26 ALY CG CB sing N N 27 ALY CG HG3 sing N N 28 ALY CG HG2 sing N N 29 ALY CB CA sing N N 30 ALY CB HB3 sing N N 31 ALY CB HB2 sing N N 32 ALY CA N sing N N 33 ALY CA C sing N N 34 ALY CA HA sing N N 35 ALY N H sing N N 36 ALY N H2 sing N N 37 ALY C O doub N N 38 ALY C OXT sing N N 39 ALY OXT HXT sing N N 40 ARG N CA sing N N 41 ARG N H sing N N 42 ARG N H2 sing N N 43 ARG CA C sing N N 44 ARG CA CB sing N N 45 ARG CA HA sing N N 46 ARG C O doub N N 47 ARG C OXT sing N N 48 ARG CB CG sing N N 49 ARG CB HB2 sing N N 50 ARG CB HB3 sing N N 51 ARG CG CD sing N N 52 ARG CG HG2 sing N N 53 ARG CG HG3 sing N N 54 ARG CD NE sing N N 55 ARG CD HD2 sing N N 56 ARG CD HD3 sing N N 57 ARG NE CZ sing N N 58 ARG NE HE sing N N 59 ARG CZ NH1 sing N N 60 ARG CZ NH2 doub N N 61 ARG NH1 HH11 sing N N 62 ARG NH1 HH12 sing N N 63 ARG NH2 HH21 sing N N 64 ARG NH2 HH22 sing N N 65 ARG OXT HXT sing N N 66 ASN N CA sing N N 67 ASN N H sing N N 68 ASN N H2 sing N N 69 ASN CA C sing N N 70 ASN CA CB sing N N 71 ASN CA HA sing N N 72 ASN C O doub N N 73 ASN C OXT sing N N 74 ASN CB CG sing N N 75 ASN CB HB2 sing N N 76 ASN CB HB3 sing N N 77 ASN CG OD1 doub N N 78 ASN CG ND2 sing N N 79 ASN ND2 HD21 sing N N 80 ASN ND2 HD22 sing N N 81 ASN OXT HXT sing N N 82 ASP N CA sing N N 83 ASP N H sing N N 84 ASP N H2 sing N N 85 ASP CA C sing N N 86 ASP CA CB sing N N 87 ASP CA HA sing N N 88 ASP C O doub N N 89 ASP C OXT sing N N 90 ASP CB CG sing N N 91 ASP CB HB2 sing N N 92 ASP CB HB3 sing N N 93 ASP CG OD1 doub N N 94 ASP CG OD2 sing N N 95 ASP OD2 HD2 sing N N 96 ASP OXT HXT sing N N 97 CYS N CA sing N N 98 CYS N H sing N N 99 CYS N H2 sing N N 100 CYS CA C sing N N 101 CYS CA CB sing N N 102 CYS CA HA sing N N 103 CYS C O doub N N 104 CYS C OXT sing N N 105 CYS CB SG sing N N 106 CYS CB HB2 sing N N 107 CYS CB HB3 sing N N 108 CYS SG HG sing N N 109 CYS OXT HXT sing N N 110 FES FE1 S1 sing N N 111 FES FE1 S2 sing N N 112 FES FE2 S1 sing N N 113 FES FE2 S2 sing N N 114 GLN N CA sing N N 115 GLN N H sing N N 116 GLN N H2 sing N N 117 GLN CA C sing N N 118 GLN CA CB sing N N 119 GLN CA HA sing N N 120 GLN C O doub N N 121 GLN C OXT sing N N 122 GLN CB CG sing N N 123 GLN CB HB2 sing N N 124 GLN CB HB3 sing N N 125 GLN CG CD sing N N 126 GLN CG HG2 sing N N 127 GLN CG HG3 sing N N 128 GLN CD OE1 doub N N 129 GLN CD NE2 sing N N 130 GLN NE2 HE21 sing N N 131 GLN NE2 HE22 sing N N 132 GLN OXT HXT sing N N 133 GLU N CA sing N N 134 GLU N H sing N N 135 GLU N H2 sing N N 136 GLU CA C sing N N 137 GLU CA CB sing N N 138 GLU CA HA sing N N 139 GLU C O doub N N 140 GLU C OXT sing N N 141 GLU CB CG sing N N 142 GLU CB HB2 sing N N 143 GLU CB HB3 sing N N 144 GLU CG CD sing N N 145 GLU CG HG2 sing N N 146 GLU CG HG3 sing N N 147 GLU CD OE1 doub N N 148 GLU CD OE2 sing N N 149 GLU OE2 HE2 sing N N 150 GLU OXT HXT sing N N 151 GLY N CA sing N N 152 GLY N H sing N N 153 GLY N H2 sing N N 154 GLY CA C sing N N 155 GLY CA HA2 sing N N 156 GLY CA HA3 sing N N 157 GLY C O doub N N 158 GLY C OXT sing N N 159 GLY OXT HXT sing N N 160 HIS N CA sing N N 161 HIS N H sing N N 162 HIS N H2 sing N N 163 HIS CA C sing N N 164 HIS CA CB sing N N 165 HIS CA HA sing N N 166 HIS C O doub N N 167 HIS C OXT sing N N 168 HIS CB CG sing N N 169 HIS CB HB2 sing N N 170 HIS CB HB3 sing N N 171 HIS CG ND1 sing Y N 172 HIS CG CD2 doub Y N 173 HIS ND1 CE1 doub Y N 174 HIS ND1 HD1 sing N N 175 HIS CD2 NE2 sing Y N 176 HIS CD2 HD2 sing N N 177 HIS CE1 NE2 sing Y N 178 HIS CE1 HE1 sing N N 179 HIS NE2 HE2 sing N N 180 HIS OXT HXT sing N N 181 ILE N CA sing N N 182 ILE N H sing N N 183 ILE N H2 sing N N 184 ILE CA C sing N N 185 ILE CA CB sing N N 186 ILE CA HA sing N N 187 ILE C O doub N N 188 ILE C OXT sing N N 189 ILE CB CG1 sing N N 190 ILE CB CG2 sing N N 191 ILE CB HB sing N N 192 ILE CG1 CD1 sing N N 193 ILE CG1 HG12 sing N N 194 ILE CG1 HG13 sing N N 195 ILE CG2 HG21 sing N N 196 ILE CG2 HG22 sing N N 197 ILE CG2 HG23 sing N N 198 ILE CD1 HD11 sing N N 199 ILE CD1 HD12 sing N N 200 ILE CD1 HD13 sing N N 201 ILE OXT HXT sing N N 202 LEU N CA sing N N 203 LEU N H sing N N 204 LEU N H2 sing N N 205 LEU CA C sing N N 206 LEU CA CB sing N N 207 LEU CA HA sing N N 208 LEU C O doub N N 209 LEU C OXT sing N N 210 LEU CB CG sing N N 211 LEU CB HB2 sing N N 212 LEU CB HB3 sing N N 213 LEU CG CD1 sing N N 214 LEU CG CD2 sing N N 215 LEU CG HG sing N N 216 LEU CD1 HD11 sing N N 217 LEU CD1 HD12 sing N N 218 LEU CD1 HD13 sing N N 219 LEU CD2 HD21 sing N N 220 LEU CD2 HD22 sing N N 221 LEU CD2 HD23 sing N N 222 LEU OXT HXT sing N N 223 LYS N CA sing N N 224 LYS N H sing N N 225 LYS N H2 sing N N 226 LYS CA C sing N N 227 LYS CA CB sing N N 228 LYS CA HA sing N N 229 LYS C O doub N N 230 LYS C OXT sing N N 231 LYS CB CG sing N N 232 LYS CB HB2 sing N N 233 LYS CB HB3 sing N N 234 LYS CG CD sing N N 235 LYS CG HG2 sing N N 236 LYS CG HG3 sing N N 237 LYS CD CE sing N N 238 LYS CD HD2 sing N N 239 LYS CD HD3 sing N N 240 LYS CE NZ sing N N 241 LYS CE HE2 sing N N 242 LYS CE HE3 sing N N 243 LYS NZ HZ1 sing N N 244 LYS NZ HZ2 sing N N 245 LYS NZ HZ3 sing N N 246 LYS OXT HXT sing N N 247 MET N CA sing N N 248 MET N H sing N N 249 MET N H2 sing N N 250 MET CA C sing N N 251 MET CA CB sing N N 252 MET CA HA sing N N 253 MET C O doub N N 254 MET C OXT sing N N 255 MET CB CG sing N N 256 MET CB HB2 sing N N 257 MET CB HB3 sing N N 258 MET CG SD sing N N 259 MET CG HG2 sing N N 260 MET CG HG3 sing N N 261 MET SD CE sing N N 262 MET CE HE1 sing N N 263 MET CE HE2 sing N N 264 MET CE HE3 sing N N 265 MET OXT HXT sing N N 266 PHE N CA sing N N 267 PHE N H sing N N 268 PHE N H2 sing N N 269 PHE CA C sing N N 270 PHE CA CB sing N N 271 PHE CA HA sing N N 272 PHE C O doub N N 273 PHE C OXT sing N N 274 PHE CB CG sing N N 275 PHE CB HB2 sing N N 276 PHE CB HB3 sing N N 277 PHE CG CD1 doub Y N 278 PHE CG CD2 sing Y N 279 PHE CD1 CE1 sing Y N 280 PHE CD1 HD1 sing N N 281 PHE CD2 CE2 doub Y N 282 PHE CD2 HD2 sing N N 283 PHE CE1 CZ doub Y N 284 PHE CE1 HE1 sing N N 285 PHE CE2 CZ sing Y N 286 PHE CE2 HE2 sing N N 287 PHE CZ HZ sing N N 288 PHE OXT HXT sing N N 289 PRO N CA sing N N 290 PRO N CD sing N N 291 PRO N H sing N N 292 PRO CA C sing N N 293 PRO CA CB sing N N 294 PRO CA HA sing N N 295 PRO C O doub N N 296 PRO C OXT sing N N 297 PRO CB CG sing N N 298 PRO CB HB2 sing N N 299 PRO CB HB3 sing N N 300 PRO CG CD sing N N 301 PRO CG HG2 sing N N 302 PRO CG HG3 sing N N 303 PRO CD HD2 sing N N 304 PRO CD HD3 sing N N 305 PRO OXT HXT sing N N 306 SER N CA sing N N 307 SER N H sing N N 308 SER N H2 sing N N 309 SER CA C sing N N 310 SER CA CB sing N N 311 SER CA HA sing N N 312 SER C O doub N N 313 SER C OXT sing N N 314 SER CB OG sing N N 315 SER CB HB2 sing N N 316 SER CB HB3 sing N N 317 SER OG HG sing N N 318 SER OXT HXT sing N N 319 THR N CA sing N N 320 THR N H sing N N 321 THR N H2 sing N N 322 THR CA C sing N N 323 THR CA CB sing N N 324 THR CA HA sing N N 325 THR C O doub N N 326 THR C OXT sing N N 327 THR CB OG1 sing N N 328 THR CB CG2 sing N N 329 THR CB HB sing N N 330 THR OG1 HG1 sing N N 331 THR CG2 HG21 sing N N 332 THR CG2 HG22 sing N N 333 THR CG2 HG23 sing N N 334 THR OXT HXT sing N N 335 TRP N CA sing N N 336 TRP N H sing N N 337 TRP N H2 sing N N 338 TRP CA C sing N N 339 TRP CA CB sing N N 340 TRP CA HA sing N N 341 TRP C O doub N N 342 TRP C OXT sing N N 343 TRP CB CG sing N N 344 TRP CB HB2 sing N N 345 TRP CB HB3 sing N N 346 TRP CG CD1 doub Y N 347 TRP CG CD2 sing Y N 348 TRP CD1 NE1 sing Y N 349 TRP CD1 HD1 sing N N 350 TRP CD2 CE2 doub Y N 351 TRP CD2 CE3 sing Y N 352 TRP NE1 CE2 sing Y N 353 TRP NE1 HE1 sing N N 354 TRP CE2 CZ2 sing Y N 355 TRP CE3 CZ3 doub Y N 356 TRP CE3 HE3 sing N N 357 TRP CZ2 CH2 doub Y N 358 TRP CZ2 HZ2 sing N N 359 TRP CZ3 CH2 sing Y N 360 TRP CZ3 HZ3 sing N N 361 TRP CH2 HH2 sing N N 362 TRP OXT HXT sing N N 363 TYR N CA sing N N 364 TYR N H sing N N 365 TYR N H2 sing N N 366 TYR CA C sing N N 367 TYR CA CB sing N N 368 TYR CA HA sing N N 369 TYR C O doub N N 370 TYR C OXT sing N N 371 TYR CB CG sing N N 372 TYR CB HB2 sing N N 373 TYR CB HB3 sing N N 374 TYR CG CD1 doub Y N 375 TYR CG CD2 sing Y N 376 TYR CD1 CE1 sing Y N 377 TYR CD1 HD1 sing N N 378 TYR CD2 CE2 doub Y N 379 TYR CD2 HD2 sing N N 380 TYR CE1 CZ doub Y N 381 TYR CE1 HE1 sing N N 382 TYR CE2 CZ sing Y N 383 TYR CE2 HE2 sing N N 384 TYR CZ OH sing N N 385 TYR OH HH sing N N 386 TYR OXT HXT sing N N 387 VAL N CA sing N N 388 VAL N H sing N N 389 VAL N H2 sing N N 390 VAL CA C sing N N 391 VAL CA CB sing N N 392 VAL CA HA sing N N 393 VAL C O doub N N 394 VAL C OXT sing N N 395 VAL CB CG1 sing N N 396 VAL CB CG2 sing N N 397 VAL CB HB sing N N 398 VAL CG1 HG11 sing N N 399 VAL CG1 HG12 sing N N 400 VAL CG1 HG13 sing N N 401 VAL CG2 HG21 sing N N 402 VAL CG2 HG22 sing N N 403 VAL CG2 HG23 sing N N 404 VAL OXT HXT sing N N 405 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1E0Z _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_