data_1E5U # _entry.id 1E5U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1E5U PDBE EBI-5224 WWPDB D_1290005224 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2000-10-03 _pdbx_database_PDB_obs_spr.pdb_id 1E5U _pdbx_database_PDB_obs_spr.replace_pdb_id 1E1B _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1E5U _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2000-08-02 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Prasannan, S.' 1 'Matthews, S.J.' 2 'Batchelor, M.' 3 'Daniell, S.' 4 'Reece, S.' 5 'Frankel, G.' 6 'Dougan, G.' 7 'Connerton, I.' 8 'Bloomberg, G.' 9 # _citation.id primary _citation.title 'Structural Basis for Recognition of the Translocated Intimin Receptor (Tir) by Intimin from Enteropathogenic E. Coli' _citation.journal_abbrev 'Embo J.' _citation.journal_volume 19 _citation.page_first 2452 _citation.page_last ? _citation.year 2000 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10835344 _citation.pdbx_database_id_DOI 10.1093/EMBOJ/19.11.2452 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Batchelor, M.' 1 primary 'Prasannan, S.' 2 primary 'Daniell, S.' 3 primary 'Reece, S.' 4 primary 'Connerton, I.' 5 primary 'Bloomberg, G.' 6 primary 'Dougan, G.' 7 primary 'Frankel, G.' 8 primary 'Matthews, S.J.' 9 # _cell.entry_id 1E5U _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1E5U _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description INTIMIN _entity.formula_weight 20074.328 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-TERMINAL 190 RESIDUE-FRAGMENT' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name INT190 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TLTIDDGNIEIVGTGVKGKLPTVWLQYGQVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISSDNQTA TYTIATPNSLIVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKSSQTIISWVQQTAQDAKSGVA STYDLVKQNPLNNIKASESNAYATCVK ; _entity_poly.pdbx_seq_one_letter_code_can ;TLTIDDGNIEIVGTGVKGKLPTVWLQYGQVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISSDNQTA TYTIATPNSLIVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKSSQTIISWVQQTAQDAKSGVA STYDLVKQNPLNNIKASESNAYATCVK ; _entity_poly.pdbx_strand_id I _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 LEU n 1 3 THR n 1 4 ILE n 1 5 ASP n 1 6 ASP n 1 7 GLY n 1 8 ASN n 1 9 ILE n 1 10 GLU n 1 11 ILE n 1 12 VAL n 1 13 GLY n 1 14 THR n 1 15 GLY n 1 16 VAL n 1 17 LYS n 1 18 GLY n 1 19 LYS n 1 20 LEU n 1 21 PRO n 1 22 THR n 1 23 VAL n 1 24 TRP n 1 25 LEU n 1 26 GLN n 1 27 TYR n 1 28 GLY n 1 29 GLN n 1 30 VAL n 1 31 ASN n 1 32 LEU n 1 33 LYS n 1 34 ALA n 1 35 SER n 1 36 GLY n 1 37 GLY n 1 38 ASN n 1 39 GLY n 1 40 LYS n 1 41 TYR n 1 42 THR n 1 43 TRP n 1 44 ARG n 1 45 SER n 1 46 ALA n 1 47 ASN n 1 48 PRO n 1 49 ALA n 1 50 ILE n 1 51 ALA n 1 52 SER n 1 53 VAL n 1 54 ASP n 1 55 ALA n 1 56 SER n 1 57 SER n 1 58 GLY n 1 59 GLN n 1 60 VAL n 1 61 THR n 1 62 LEU n 1 63 LYS n 1 64 GLU n 1 65 LYS n 1 66 GLY n 1 67 THR n 1 68 THR n 1 69 THR n 1 70 ILE n 1 71 SER n 1 72 VAL n 1 73 ILE n 1 74 SER n 1 75 SER n 1 76 ASP n 1 77 ASN n 1 78 GLN n 1 79 THR n 1 80 ALA n 1 81 THR n 1 82 TYR n 1 83 THR n 1 84 ILE n 1 85 ALA n 1 86 THR n 1 87 PRO n 1 88 ASN n 1 89 SER n 1 90 LEU n 1 91 ILE n 1 92 VAL n 1 93 PRO n 1 94 ASN n 1 95 MET n 1 96 SER n 1 97 LYS n 1 98 ARG n 1 99 VAL n 1 100 THR n 1 101 TYR n 1 102 ASN n 1 103 ASP n 1 104 ALA n 1 105 VAL n 1 106 ASN n 1 107 THR n 1 108 CYS n 1 109 LYS n 1 110 ASN n 1 111 PHE n 1 112 GLY n 1 113 GLY n 1 114 LYS n 1 115 LEU n 1 116 PRO n 1 117 SER n 1 118 SER n 1 119 GLN n 1 120 ASN n 1 121 GLU n 1 122 LEU n 1 123 GLU n 1 124 ASN n 1 125 VAL n 1 126 PHE n 1 127 LYS n 1 128 ALA n 1 129 TRP n 1 130 GLY n 1 131 ALA n 1 132 ALA n 1 133 ASN n 1 134 LYS n 1 135 TYR n 1 136 GLU n 1 137 TYR n 1 138 TYR n 1 139 LYS n 1 140 SER n 1 141 SER n 1 142 GLN n 1 143 THR n 1 144 ILE n 1 145 ILE n 1 146 SER n 1 147 TRP n 1 148 VAL n 1 149 GLN n 1 150 GLN n 1 151 THR n 1 152 ALA n 1 153 GLN n 1 154 ASP n 1 155 ALA n 1 156 LYS n 1 157 SER n 1 158 GLY n 1 159 VAL n 1 160 ALA n 1 161 SER n 1 162 THR n 1 163 TYR n 1 164 ASP n 1 165 LEU n 1 166 VAL n 1 167 LYS n 1 168 GLN n 1 169 ASN n 1 170 PRO n 1 171 LEU n 1 172 ASN n 1 173 ASN n 1 174 ILE n 1 175 LYS n 1 176 ALA n 1 177 SER n 1 178 GLU n 1 179 SER n 1 180 ASN n 1 181 ALA n 1 182 TYR n 1 183 ALA n 1 184 THR n 1 185 CYS n 1 186 VAL n 1 187 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EAE _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ENTEROPATHOGENIC SEROTYPE O127\:H6' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant 'STRAIN E2348/69' _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell BACTERIAL _entity_src_gen.pdbx_gene_src_cellular_location 'OUTER MEMBRANE/SURFACE' _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene 'EAE [TRUNCATION]' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET3A/PLYSS _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description RECOMBINANT # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EAE1_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P19809 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1E5U _struct_ref_seq.pdbx_strand_id I _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 187 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19809 _struct_ref_seq.db_align_beg 753 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 939 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 187 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 HSQC 1 2 1 'TRIPLE RESONANCE' 1 3 1 15N-NOESY 1 4 1 13C-NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20 MM ACETATE' _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1E5U _pdbx_nmr_refine.method 'HYBRID TORSION ANGLE/ CARTESIAN CO-ORDINATE DYNAMICS' _pdbx_nmr_refine.details 'INT190 IS A TRUNCATION OF INT280 (30KDA) WHOSE GLOBAL FOLD WAS PUBLISHED IN NATURE STRUCTURAL BIOLOGY (1999) VOL.6, PP. 313-318.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1E5U _pdbx_nmr_details.text ;REPRESENTATIVE STRUCTURE, LEAST ENERGY. RESONANCE ASSIGNMENTS MADE USING TRIPLE RESONANCE EXPERIMENTS WERE FOLLOWED BY COLLATION OF DISTANCE RESTRAINTS USING NOESY EXPERIMENTS ON 15N,13C-LABELLED INT190 EXPERIMENTS ON 15N, 13C-LABELLED INT190. ONE BOND DIPOLAR COUPLINGS WERE MEASURED USING COUPLED HSQC AND TRIPLE RESONANCE EXPERIMENTS. ; # _pdbx_nmr_ensemble.entry_id 1E5U _pdbx_nmr_ensemble.conformers_calculated_total_number 15 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST ENERGY' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR ? BRUNGER 1 'structure solution' XWIN-NMR ? ? 2 'structure solution' AURELIA ? ? 3 'structure solution' X-PLOR ? ? 4 # _exptl.entry_id 1E5U _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1E5U _struct.title 'NMR Representative Structure of Intimin-190 (Int190) from Enteropathogenic E. coli' _struct.pdbx_descriptor INTIMIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'MINIMIZED AVERAGE' # _struct_keywords.entry_id 1E5U _struct_keywords.pdbx_keywords INTIMIN _struct_keywords.text 'INTIMIN, ESCHERICHIA COLI, CELL ADHESION, OUTER MEMBRANE PROTEIN, NMR SPECTROSCOPY' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 100 ? PHE A 111 ? THR I 100 PHE I 111 1 ? 12 HELX_P HELX_P2 2 SER A 118 ? GLY A 130 ? SER I 118 GLY I 130 1 ? 13 HELX_P HELX_P3 3 LYS A 134 ? SER A 141 ? LYS I 134 SER I 141 5 ? 8 HELX_P HELX_P4 4 THR A 151 ? SER A 157 ? THR I 151 SER I 157 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 108 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 185 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id I _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 108 _struct_conn.ptnr2_auth_asym_id I _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 185 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.022 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 3 ? C ? 2 ? D ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 16 ? GLY A 18 ? VAL I 16 GLY I 18 A 2 THR A 3 ? ILE A 11 ? THR I 3 ILE I 11 A 3 GLN A 29 ? SER A 35 ? GLN I 29 SER I 35 A 4 GLY A 58 ? THR A 61 ? GLY I 58 THR I 61 A 5 SER A 52 ? ASP A 54 ? SER I 52 ASP I 54 B 1 TRP A 43 ? ARG A 44 ? TRP I 43 ARG I 44 B 2 THR A 68 ? VAL A 72 ? THR I 68 VAL I 72 B 3 ALA A 80 ? ILE A 84 ? ALA I 80 ILE I 84 C 1 ILE A 91 ? ASN A 94 ? ILE I 91 ASN I 94 C 2 ALA A 183 ? VAL A 186 ? ALA I 183 VAL I 186 D 1 ILE A 145 ? VAL A 148 ? ILE I 145 VAL I 148 D 2 ALA A 160 ? ASP A 164 ? ALA I 160 ASP I 164 D 3 ASN A 169 ? ILE A 174 ? ASN I 169 ILE I 174 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 18 ? N GLY I 18 O ILE A 9 ? O ILE I 9 A 2 3 N GLU A 10 ? N GLU I 10 O ASN A 31 ? O ASN I 31 A 3 4 N LEU A 32 ? N LEU I 32 O GLY A 58 ? O GLY I 58 A 4 5 N THR A 61 ? N THR I 61 O SER A 52 ? O SER I 52 B 1 2 N ARG A 44 ? N ARG I 44 O SER A 71 ? O SER I 71 B 2 3 N VAL A 72 ? N VAL I 72 O ALA A 80 ? O ALA I 80 C 1 2 N ASN A 94 ? N ASN I 94 O ALA A 183 ? O ALA I 183 D 1 2 N VAL A 148 ? N VAL I 148 O SER A 161 ? O SER I 161 D 2 3 N ASP A 164 ? N ASP I 164 O ASN A 169 ? O ASN I 169 # _database_PDB_matrix.entry_id 1E5U _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1E5U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR I . n A 1 2 LEU 2 2 2 LEU LEU I . n A 1 3 THR 3 3 3 THR THR I . n A 1 4 ILE 4 4 4 ILE ILE I . n A 1 5 ASP 5 5 5 ASP ASP I . n A 1 6 ASP 6 6 6 ASP ASP I . n A 1 7 GLY 7 7 7 GLY GLY I . n A 1 8 ASN 8 8 8 ASN ASN I . n A 1 9 ILE 9 9 9 ILE ILE I . n A 1 10 GLU 10 10 10 GLU GLU I . n A 1 11 ILE 11 11 11 ILE ILE I . n A 1 12 VAL 12 12 12 VAL VAL I . n A 1 13 GLY 13 13 13 GLY GLY I . n A 1 14 THR 14 14 14 THR THR I . n A 1 15 GLY 15 15 15 GLY GLY I . n A 1 16 VAL 16 16 16 VAL VAL I . n A 1 17 LYS 17 17 17 LYS LYS I . n A 1 18 GLY 18 18 18 GLY GLY I . n A 1 19 LYS 19 19 19 LYS LYS I . n A 1 20 LEU 20 20 20 LEU LEU I . n A 1 21 PRO 21 21 21 PRO PRO I . n A 1 22 THR 22 22 22 THR THR I . n A 1 23 VAL 23 23 23 VAL VAL I . n A 1 24 TRP 24 24 24 TRP TRP I . n A 1 25 LEU 25 25 25 LEU LEU I . n A 1 26 GLN 26 26 26 GLN GLN I . n A 1 27 TYR 27 27 27 TYR TYR I . n A 1 28 GLY 28 28 28 GLY GLY I . n A 1 29 GLN 29 29 29 GLN GLN I . n A 1 30 VAL 30 30 30 VAL VAL I . n A 1 31 ASN 31 31 31 ASN ASN I . n A 1 32 LEU 32 32 32 LEU LEU I . n A 1 33 LYS 33 33 33 LYS LYS I . n A 1 34 ALA 34 34 34 ALA ALA I . n A 1 35 SER 35 35 35 SER SER I . n A 1 36 GLY 36 36 36 GLY GLY I . n A 1 37 GLY 37 37 37 GLY GLY I . n A 1 38 ASN 38 38 38 ASN ASN I . n A 1 39 GLY 39 39 39 GLY GLY I . n A 1 40 LYS 40 40 40 LYS LYS I . n A 1 41 TYR 41 41 41 TYR TYR I . n A 1 42 THR 42 42 42 THR THR I . n A 1 43 TRP 43 43 43 TRP TRP I . n A 1 44 ARG 44 44 44 ARG ARG I . n A 1 45 SER 45 45 45 SER SER I . n A 1 46 ALA 46 46 46 ALA ALA I . n A 1 47 ASN 47 47 47 ASN ASN I . n A 1 48 PRO 48 48 48 PRO PRO I . n A 1 49 ALA 49 49 49 ALA ALA I . n A 1 50 ILE 50 50 50 ILE ILE I . n A 1 51 ALA 51 51 51 ALA ALA I . n A 1 52 SER 52 52 52 SER SER I . n A 1 53 VAL 53 53 53 VAL VAL I . n A 1 54 ASP 54 54 54 ASP ASP I . n A 1 55 ALA 55 55 55 ALA ALA I . n A 1 56 SER 56 56 56 SER SER I . n A 1 57 SER 57 57 57 SER SER I . n A 1 58 GLY 58 58 58 GLY GLY I . n A 1 59 GLN 59 59 59 GLN GLN I . n A 1 60 VAL 60 60 60 VAL VAL I . n A 1 61 THR 61 61 61 THR THR I . n A 1 62 LEU 62 62 62 LEU LEU I . n A 1 63 LYS 63 63 63 LYS LYS I . n A 1 64 GLU 64 64 64 GLU GLU I . n A 1 65 LYS 65 65 65 LYS LYS I . n A 1 66 GLY 66 66 66 GLY GLY I . n A 1 67 THR 67 67 67 THR THR I . n A 1 68 THR 68 68 68 THR THR I . n A 1 69 THR 69 69 69 THR THR I . n A 1 70 ILE 70 70 70 ILE ILE I . n A 1 71 SER 71 71 71 SER SER I . n A 1 72 VAL 72 72 72 VAL VAL I . n A 1 73 ILE 73 73 73 ILE ILE I . n A 1 74 SER 74 74 74 SER SER I . n A 1 75 SER 75 75 75 SER SER I . n A 1 76 ASP 76 76 76 ASP ASP I . n A 1 77 ASN 77 77 77 ASN ASN I . n A 1 78 GLN 78 78 78 GLN GLN I . n A 1 79 THR 79 79 79 THR THR I . n A 1 80 ALA 80 80 80 ALA ALA I . n A 1 81 THR 81 81 81 THR THR I . n A 1 82 TYR 82 82 82 TYR TYR I . n A 1 83 THR 83 83 83 THR THR I . n A 1 84 ILE 84 84 84 ILE ILE I . n A 1 85 ALA 85 85 85 ALA ALA I . n A 1 86 THR 86 86 86 THR THR I . n A 1 87 PRO 87 87 87 PRO PRO I . n A 1 88 ASN 88 88 88 ASN ASN I . n A 1 89 SER 89 89 89 SER SER I . n A 1 90 LEU 90 90 90 LEU LEU I . n A 1 91 ILE 91 91 91 ILE ILE I . n A 1 92 VAL 92 92 92 VAL VAL I . n A 1 93 PRO 93 93 93 PRO PRO I . n A 1 94 ASN 94 94 94 ASN ASN I . n A 1 95 MET 95 95 95 MET MET I . n A 1 96 SER 96 96 96 SER SER I . n A 1 97 LYS 97 97 97 LYS LYS I . n A 1 98 ARG 98 98 98 ARG ARG I . n A 1 99 VAL 99 99 99 VAL VAL I . n A 1 100 THR 100 100 100 THR THR I . n A 1 101 TYR 101 101 101 TYR TYR I . n A 1 102 ASN 102 102 102 ASN ASN I . n A 1 103 ASP 103 103 103 ASP ASP I . n A 1 104 ALA 104 104 104 ALA ALA I . n A 1 105 VAL 105 105 105 VAL VAL I . n A 1 106 ASN 106 106 106 ASN ASN I . n A 1 107 THR 107 107 107 THR THR I . n A 1 108 CYS 108 108 108 CYS CYS I . n A 1 109 LYS 109 109 109 LYS LYS I . n A 1 110 ASN 110 110 110 ASN ASN I . n A 1 111 PHE 111 111 111 PHE PHE I . n A 1 112 GLY 112 112 112 GLY GLY I . n A 1 113 GLY 113 113 113 GLY GLY I . n A 1 114 LYS 114 114 114 LYS LYS I . n A 1 115 LEU 115 115 115 LEU LEU I . n A 1 116 PRO 116 116 116 PRO PRO I . n A 1 117 SER 117 117 117 SER SER I . n A 1 118 SER 118 118 118 SER SER I . n A 1 119 GLN 119 119 119 GLN GLN I . n A 1 120 ASN 120 120 120 ASN ASN I . n A 1 121 GLU 121 121 121 GLU GLU I . n A 1 122 LEU 122 122 122 LEU LEU I . n A 1 123 GLU 123 123 123 GLU GLU I . n A 1 124 ASN 124 124 124 ASN ASN I . n A 1 125 VAL 125 125 125 VAL VAL I . n A 1 126 PHE 126 126 126 PHE PHE I . n A 1 127 LYS 127 127 127 LYS LYS I . n A 1 128 ALA 128 128 128 ALA ALA I . n A 1 129 TRP 129 129 129 TRP TRP I . n A 1 130 GLY 130 130 130 GLY GLY I . n A 1 131 ALA 131 131 131 ALA ALA I . n A 1 132 ALA 132 132 132 ALA ALA I . n A 1 133 ASN 133 133 133 ASN ASN I . n A 1 134 LYS 134 134 134 LYS LYS I . n A 1 135 TYR 135 135 135 TYR TYR I . n A 1 136 GLU 136 136 136 GLU GLU I . n A 1 137 TYR 137 137 137 TYR TYR I . n A 1 138 TYR 138 138 138 TYR TYR I . n A 1 139 LYS 139 139 139 LYS LYS I . n A 1 140 SER 140 140 140 SER SER I . n A 1 141 SER 141 141 141 SER SER I . n A 1 142 GLN 142 142 142 GLN GLN I . n A 1 143 THR 143 143 143 THR THR I . n A 1 144 ILE 144 144 144 ILE ILE I . n A 1 145 ILE 145 145 145 ILE ILE I . n A 1 146 SER 146 146 146 SER SER I . n A 1 147 TRP 147 147 147 TRP TRP I . n A 1 148 VAL 148 148 148 VAL VAL I . n A 1 149 GLN 149 149 149 GLN GLN I . n A 1 150 GLN 150 150 150 GLN GLN I . n A 1 151 THR 151 151 151 THR THR I . n A 1 152 ALA 152 152 152 ALA ALA I . n A 1 153 GLN 153 153 153 GLN GLN I . n A 1 154 ASP 154 154 154 ASP ASP I . n A 1 155 ALA 155 155 155 ALA ALA I . n A 1 156 LYS 156 156 156 LYS LYS I . n A 1 157 SER 157 157 157 SER SER I . n A 1 158 GLY 158 158 158 GLY GLY I . n A 1 159 VAL 159 159 159 VAL VAL I . n A 1 160 ALA 160 160 160 ALA ALA I . n A 1 161 SER 161 161 161 SER SER I . n A 1 162 THR 162 162 162 THR THR I . n A 1 163 TYR 163 163 163 TYR TYR I . n A 1 164 ASP 164 164 164 ASP ASP I . n A 1 165 LEU 165 165 165 LEU LEU I . n A 1 166 VAL 166 166 166 VAL VAL I . n A 1 167 LYS 167 167 167 LYS LYS I . n A 1 168 GLN 168 168 168 GLN GLN I . n A 1 169 ASN 169 169 169 ASN ASN I . n A 1 170 PRO 170 170 170 PRO PRO I . n A 1 171 LEU 171 171 171 LEU LEU I . n A 1 172 ASN 172 172 172 ASN ASN I . n A 1 173 ASN 173 173 173 ASN ASN I . n A 1 174 ILE 174 174 174 ILE ILE I . n A 1 175 LYS 175 175 175 LYS LYS I . n A 1 176 ALA 176 176 176 ALA ALA I . n A 1 177 SER 177 177 177 SER SER I . n A 1 178 GLU 178 178 178 GLU GLU I . n A 1 179 SER 179 179 179 SER SER I . n A 1 180 ASN 180 180 180 ASN ASN I . n A 1 181 ALA 181 181 181 ALA ALA I . n A 1 182 TYR 182 182 182 TYR TYR I . n A 1 183 ALA 183 183 183 ALA ALA I . n A 1 184 THR 184 184 184 THR THR I . n A 1 185 CYS 185 185 185 CYS CYS I . n A 1 186 VAL 186 186 186 VAL VAL I . n A 1 187 LYS 187 187 187 LYS LYS I . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-08-16 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ; HELIX DETERMINATION METHOD: AUTHOR PROVIDED. ; 700 ; SHEET DETERMINATION METHOD: AUTHOR PROVIDED. ; # _pdbx_entry_details.entry_id 1E5U _pdbx_entry_details.compound_details 'FUNCTION: MEDIATES ADHERENCE' _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O I THR 162 ? ? H I LEU 171 ? ? 1.24 2 1 HA I VAL 12 ? ? O I GLN 29 ? ? 1.41 3 1 H I GLY 37 ? ? OG I SER 75 ? ? 1.46 4 1 O I TYR 138 ? ? H I SER 141 ? ? 1.51 5 1 O I ILE 9 ? ? HA I LYS 17 ? ? 1.57 6 1 O I LEU 122 ? ? H I PHE 126 ? ? 1.58 7 1 H I THR 162 ? ? O I LEU 171 ? ? 1.59 8 1 H I SER 146 ? ? O I TYR 163 ? ? 1.60 9 1 O I ILE 11 ? ? N I GLY 13 ? ? 2.08 10 1 N I ALA 46 ? ? O I THR 69 ? ? 2.15 11 1 CA I VAL 12 ? ? O I GLN 29 ? ? 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL I 12 ? ? -31.11 -16.36 2 1 PRO I 21 ? ? -87.99 -116.47 3 1 GLN I 26 ? ? 123.04 -156.70 4 1 ALA I 46 ? ? 57.41 -8.06 5 1 ASN I 47 ? ? 80.56 138.18 6 1 SER I 57 ? ? -175.62 113.87 7 1 LYS I 63 ? ? -155.87 4.65 8 1 GLU I 64 ? ? 167.08 109.56 9 1 LYS I 65 ? ? 173.88 -53.14 10 1 ASN I 77 ? ? 91.09 31.28 11 1 ALA I 85 ? ? -138.03 -59.76 12 1 PRO I 87 ? ? -67.95 -157.12 13 1 ASN I 88 ? ? 74.52 70.17 14 1 MET I 95 ? ? 174.84 74.19 15 1 ASN I 133 ? ? -150.05 59.36 16 1 TYR I 135 ? ? 65.90 -84.21 17 1 SER I 141 ? ? -175.43 74.15 18 1 GLN I 142 ? ? -26.62 -42.96 19 1 GLN I 168 ? ? 169.13 4.75 20 1 ASN I 169 ? ? 96.54 -166.83 21 1 ASN I 173 ? ? 88.51 85.83 22 1 LYS I 175 ? ? 169.57 -30.43 23 1 GLU I 178 ? ? 106.24 36.02 24 1 SER I 179 ? ? 150.27 62.67 25 1 ALA I 181 ? ? -152.63 -86.55 26 1 TYR I 182 ? ? 160.04 176.91 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id I _pdbx_validate_planes.auth_seq_id 44 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.307 _pdbx_validate_planes.type 'SIDE CHAIN' #