data_1E9E # _entry.id 1E9E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.305 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1E9E PDBE EBI-5448 WWPDB D_1290005448 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1E2D unspecified 'HUMAN THYMIDYLATE KINASE COMPLEXED WITH THYMIDINE MONOPHOSPHATE, ADENOSINE DIPHOSPHATE AND A MAGNESIUM-ION' PDB 1E2E unspecified 'HUMAN THYMIDYLATE KINASE COMPLEXED WITH THYMIDINE MONOPHOSPHATE, ADENOSINE DIPHOSPHATE,A MAGNESIUM-ION AND ALF3' PDB 1E2F unspecified 'HUMAN THYMIDYLATE KINASE COMPLEXED WITH THYMIDINE MONOPHOSPHATE, ADENOSINE DIPHOSPHATE AND A MAGNESIUM-ION' PDB 1E2G unspecified 'HUMAN THYMIDYLATE KINASE COMPLEXED WITH ADP, TDP AND A MAGNESIUM-ION' PDB 1E2Q unspecified 'HUMAN THYMIDYLATE KINASE COMPLEXED WITH TP5A AND A MAGNESIUM-ION' PDB 1E98 unspecified 'WILD TYPE HUMAN THYMIDYLATE KINASE COMPLEXED WITH AZTMP AND ADP' PDB 1E99 unspecified 'HUMAN THYMIDYLATE KINASE COMPLEXED WITH AZTMP AND ADP' PDB 1E9A unspecified 'HUMAN THYMIDYLATE KINASE COMPLEXED WITH THE BISUBSTRATE INHIBITOR AZTP5A' PDB 1E9B unspecified 'HUMAN THYMIDYLATE KINASE COMPLEXED WITH AZTMP AND APPNP' PDB 1E9C unspecified 'MUTANT HUMAN THYMIDYLATE KINASE COMPLEXED WITH TMP AND APPNP' PDB 1E9D unspecified 'MUTANT HUMAN THYMIDYLATE KINASE (F105Y) COMPLEXED WITH AZTMP AND ADP' PDB 1E9F unspecified 'MUTANT HUMAN THYMIDYLATE KINASE COMPLEXED WITH TMP AND ADP' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1E9E _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2000-10-11 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ostermann, N.' 1 'Lavie, A.' 2 'Padiyar, S.' 3 'Brundiers, R.' 4 'Veit, T.' 5 'Reintein, J.' 6 'Goody, R.S.' 7 'Konrad, M.' 8 'Schlichting, I.' 9 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Potentiating Azt Activation: Structures of Wildtype and Mutant Human Thymidylate Kinase Suggest Reasons for the Mutants' Improved Kinetics with the HIV Prodrug Metabolite Aztmp ; J.Mol.Biol. 304 43 ? 2000 JMOBAK UK 0022-2836 0070 ? 11071809 10.1006/JMBI.2000.4175 1 ;Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate. ; Structure 8 629 ? 2000 STRUE6 UK 0969-2126 2005 ? 10873853 '10.1016/S0969-2126(00)00149-0' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ostermann, N.' 1 ? primary 'Lavie, A.' 2 ? primary 'Padiyar, S.' 3 ? primary 'Brundiers, R.' 4 ? primary 'Veit, T.' 5 ? primary 'Reintein, J.' 6 ? primary 'Goody, R.S.' 7 ? primary 'Konrad, M.' 8 ? primary 'Schlichting, I.' 9 ? 1 'Ostermann, N.' 10 ? 1 'Schlichting, I.' 11 ? 1 'Brundiers, R.' 12 ? 1 'Konrad, M.' 13 ? 1 'Reinstein, J.' 14 ? 1 'Veit, T.' 15 ? 1 'Goody, R.S.' 16 ? 1 'Lavie, A.' 17 ? # _cell.entry_id 1E9E _cell.length_a 100.900 _cell.length_b 100.900 _cell.length_c 48.300 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1E9E _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'THYMIDYLATE KINASE' 24140.662 1 2.7.4.9 YES ? ? 2 non-polymer syn "THYMIDINE-5'-PHOSPHATE" 322.208 1 ? ? ? ? 3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201 1 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 5 water nat water 18.015 308 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DTMP KINASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRW EQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQ ERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLKELWK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRW EQVPLIKEKLSQGVTLVVDRYAFSGVAYTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQ ERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLKELWK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ALA n 1 6 ALA n 1 7 ARG n 1 8 ARG n 1 9 GLY n 1 10 ALA n 1 11 LEU n 1 12 ILE n 1 13 VAL n 1 14 LEU n 1 15 GLU n 1 16 GLY n 1 17 VAL n 1 18 ASP n 1 19 ARG n 1 20 ALA n 1 21 GLY n 1 22 LYS n 1 23 SER n 1 24 THR n 1 25 GLN n 1 26 SER n 1 27 ARG n 1 28 LYS n 1 29 LEU n 1 30 VAL n 1 31 GLU n 1 32 ALA n 1 33 LEU n 1 34 CYS n 1 35 ALA n 1 36 ALA n 1 37 GLY n 1 38 HIS n 1 39 ARG n 1 40 ALA n 1 41 GLU n 1 42 LEU n 1 43 LEU n 1 44 ARG n 1 45 PHE n 1 46 PRO n 1 47 GLU n 1 48 ARG n 1 49 SER n 1 50 THR n 1 51 GLU n 1 52 ILE n 1 53 GLY n 1 54 LYS n 1 55 LEU n 1 56 LEU n 1 57 SER n 1 58 SER n 1 59 TYR n 1 60 LEU n 1 61 GLN n 1 62 LYS n 1 63 LYS n 1 64 SER n 1 65 ASP n 1 66 VAL n 1 67 GLU n 1 68 ASP n 1 69 HIS n 1 70 SER n 1 71 VAL n 1 72 HIS n 1 73 LEU n 1 74 LEU n 1 75 PHE n 1 76 SER n 1 77 ALA n 1 78 ASN n 1 79 ARG n 1 80 TRP n 1 81 GLU n 1 82 GLN n 1 83 VAL n 1 84 PRO n 1 85 LEU n 1 86 ILE n 1 87 LYS n 1 88 GLU n 1 89 LYS n 1 90 LEU n 1 91 SER n 1 92 GLN n 1 93 GLY n 1 94 VAL n 1 95 THR n 1 96 LEU n 1 97 VAL n 1 98 VAL n 1 99 ASP n 1 100 ARG n 1 101 TYR n 1 102 ALA n 1 103 PHE n 1 104 SER n 1 105 GLY n 1 106 VAL n 1 107 ALA n 1 108 TYR n 1 109 THR n 1 110 GLY n 1 111 ALA n 1 112 LYS n 1 113 GLU n 1 114 ASN n 1 115 PHE n 1 116 SER n 1 117 LEU n 1 118 ASP n 1 119 TRP n 1 120 CYS n 1 121 LYS n 1 122 GLN n 1 123 PRO n 1 124 ASP n 1 125 VAL n 1 126 GLY n 1 127 LEU n 1 128 PRO n 1 129 LYS n 1 130 PRO n 1 131 ASP n 1 132 LEU n 1 133 VAL n 1 134 LEU n 1 135 PHE n 1 136 LEU n 1 137 GLN n 1 138 LEU n 1 139 GLN n 1 140 LEU n 1 141 ALA n 1 142 ASP n 1 143 ALA n 1 144 ALA n 1 145 LYS n 1 146 ARG n 1 147 GLY n 1 148 ALA n 1 149 PHE n 1 150 GLY n 1 151 HIS n 1 152 GLU n 1 153 ARG n 1 154 TYR n 1 155 GLU n 1 156 ASN n 1 157 GLY n 1 158 ALA n 1 159 PHE n 1 160 GLN n 1 161 GLU n 1 162 ARG n 1 163 ALA n 1 164 LEU n 1 165 ARG n 1 166 CYS n 1 167 PHE n 1 168 HIS n 1 169 GLN n 1 170 LEU n 1 171 MET n 1 172 LYS n 1 173 ASP n 1 174 THR n 1 175 THR n 1 176 LEU n 1 177 ASN n 1 178 TRP n 1 179 LYS n 1 180 MET n 1 181 VAL n 1 182 ASP n 1 183 ALA n 1 184 SER n 1 185 LYS n 1 186 SER n 1 187 ILE n 1 188 GLU n 1 189 ALA n 1 190 VAL n 1 191 HIS n 1 192 GLU n 1 193 ASP n 1 194 ILE n 1 195 ARG n 1 196 VAL n 1 197 LEU n 1 198 SER n 1 199 GLU n 1 200 ASP n 1 201 ALA n 1 202 ILE n 1 203 ALA n 1 204 THR n 1 205 ALA n 1 206 THR n 1 207 GLU n 1 208 LYS n 1 209 PRO n 1 210 LEU n 1 211 LYS n 1 212 GLU n 1 213 LEU n 1 214 TRP n 1 215 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 1E9E 1 ? ? 1E9E ? 2 UNP KTHY_HUMAN 1 ? ? P23919 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1E9E A 1 ? 3 ? 1E9E -3 ? -1 ? -3 -1 2 2 1E9E A 4 ? 215 ? P23919 1 ? 212 ? 1 212 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1E9E ALA A 203 ? UNP P23919 ARG 200 'engineered mutation' 200 1 1 1E9E TYR A 108 ? UNP P23919 PHE 105 'engineered mutation' 105 2 1 1E9E ILE A 187 ? UNP P23919 LEU 184 conflict 184 3 1 1E9E ILE A 194 ? UNP P23919 LEU 191 conflict 191 4 1 1E9E LYS A 211 ? UNP P23919 GLY 208 conflict 208 5 1 1E9E ASP A 193 ? UNP P23919 GLU 190 conflict 190 6 1 1E9E SER A 186 ? UNP P23919 ARG 183 conflict 183 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ADP non-polymer n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TMP non-polymer . "THYMIDINE-5'-PHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1E9E _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.55 _exptl_crystal.density_percent_sol 51.69 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.00 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;VAPOR DIFFUSION AT 293 K MIXING 2 MICROLITERS OF A SOLUTION CONTAINING THE ENZYME, NUCLEOTIDES, AND 50 MM MGCL2 WITH 2 MICROLITERS OF A SOLUTION CONTAINING 21% PEG 3350, 100 MM TRIS HCL PH 8.0 AND 50 MICROLITERS OF DEAD SEA WATER. ; # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator YES _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.54 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 1E9E _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 70.000 _reflns.d_resolution_high 1.600 _reflns.number_obs 32953 _reflns.number_all ? _reflns.percent_possible_obs 98.5 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.04600 _reflns.pdbx_netI_over_sigmaI 26.3000 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.200 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.70 _reflns_shell.percent_possible_all 92.6 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.19900 _reflns_shell.meanI_over_sigI_obs 4.600 _reflns_shell.pdbx_redundancy 2.20 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 1E9E _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 32088 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 70 _refine.ls_d_res_high 1.6 _refine.ls_percent_reflns_obs 98 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.179 _refine.ls_R_factor_R_free 0.219 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.0 _refine.ls_number_reflns_R_free 3221 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1665 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 50 _refine_hist.number_atoms_solvent 308 _refine_hist.number_atoms_total 2023 _refine_hist.d_res_high 1.6 _refine_hist.d_res_low 70 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function p_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? p_angle_d 1.4 ? ? ? 'X-RAY DIFFRACTION' ? p_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_d ? ? ? ? 'X-RAY DIFFRACTION' ? p_hb_or_metal_coord ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? p_plane_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_chiral_restr ? ? ? ? 'X-RAY DIFFRACTION' ? p_singtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_multtor_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xhyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_xyhbond_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? p_planar_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_staggered_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_orthonormal_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_transverse_tor ? ? ? ? 'X-RAY DIFFRACTION' ? p_special_tor ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1E9E _struct.title 'Mutant human thymidylate kinase (F105Y) complexed with dTMP and ADP' _struct.pdbx_descriptor 'THYMIDYLATE KINASE (E.C.2.7.4.9)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1E9E _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'PHOSPHOTRANSFERASE, THYMIDYLATE KINASE, P-LOOP, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 21 ? ALA A 36 ? GLY A 18 ALA A 33 1 ? 16 HELX_P HELX_P2 2 THR A 50 ? GLN A 61 ? THR A 47 GLN A 58 1 ? 12 HELX_P HELX_P3 3 GLU A 67 ? GLU A 81 ? GLU A 64 GLU A 78 1 ? 15 HELX_P HELX_P4 4 GLN A 82 ? GLN A 92 ? GLN A 79 GLN A 89 1 ? 11 HELX_P HELX_P5 5 TYR A 101 ? GLY A 110 ? TYR A 98 GLY A 107 1 ? 10 HELX_P HELX_P6 6 SER A 116 ? GLN A 122 ? SER A 113 GLN A 119 1 ? 7 HELX_P HELX_P7 7 PRO A 123 ? VAL A 125 ? PRO A 120 VAL A 122 5 ? 3 HELX_P HELX_P8 8 GLN A 139 ? ALA A 144 ? GLN A 136 ALA A 141 1 ? 6 HELX_P HELX_P9 9 ASN A 156 ? MET A 171 ? ASN A 153 MET A 168 1 ? 16 HELX_P HELX_P10 10 SER A 186 ? THR A 206 ? SER A 183 THR A 203 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? C ADP . O2B ? ? ? 1_555 D MG . MG ? ? A ADP 302 A MG 401 1_555 ? ? ? ? ? ? ? 1.995 ? metalc2 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 401 A HOH 2144 1_555 ? ? ? ? ? ? ? 2.054 ? metalc3 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 401 A HOH 2032 1_555 ? ? ? ? ? ? ? 2.200 ? metalc4 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 401 A HOH 2293 1_555 ? ? ? ? ? ? ? 2.130 ? metalc5 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 401 A HOH 2296 1_555 ? ? ? ? ? ? ? 2.099 ? metalc6 metalc ? ? D MG . MG ? ? ? 1_555 A SER 23 OG ? ? A MG 401 A SER 20 1_555 ? ? ? ? ? ? ? 2.062 ? metalc7 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 2164 1_555 ? ? ? ? ? ? ? 2.104 ? metalc8 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 2164 8_665 ? ? ? ? ? ? ? 2.109 ? metalc9 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 2067 1_555 ? ? ? ? ? ? ? 2.198 ? metalc10 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 2163 8_665 ? ? ? ? ? ? ? 2.084 ? metalc11 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 2163 1_555 ? ? ? ? ? ? ? 2.239 ? metalc12 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 402 A HOH 2067 8_665 ? ? ? ? ? ? ? 2.223 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 45 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 42 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 46 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 43 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.31 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 40 ? ARG A 44 ? ALA A 37 ARG A 41 A 2 THR A 95 ? ASP A 99 ? THR A 92 ASP A 96 A 3 LEU A 11 ? GLU A 15 ? LEU A 8 GLU A 12 A 4 LEU A 132 ? GLN A 137 ? LEU A 129 GLN A 134 A 5 TRP A 178 ? ASP A 182 ? TRP A 175 ASP A 179 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 41 ? N GLU A 38 O THR A 95 ? O THR A 92 A 2 3 N VAL A 98 ? N VAL A 95 O ILE A 12 ? O ILE A 9 A 3 4 N VAL A 13 ? N VAL A 10 O LEU A 132 ? O LEU A 129 A 4 5 N PHE A 135 ? N PHE A 132 O LYS A 179 ? O LYS A 176 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 401' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 402' AC3 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE TMP A 301' AC4 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE ADP A 302' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 SER A 23 ? SER A 20 . ? 1_555 ? 2 AC1 6 ADP C . ? ADP A 302 . ? 1_555 ? 3 AC1 6 HOH F . ? HOH A 2032 . ? 1_555 ? 4 AC1 6 HOH F . ? HOH A 2144 . ? 1_555 ? 5 AC1 6 HOH F . ? HOH A 2293 . ? 1_555 ? 6 AC1 6 HOH F . ? HOH A 2296 . ? 1_555 ? 7 AC2 6 HOH F . ? HOH A 2067 . ? 8_665 ? 8 AC2 6 HOH F . ? HOH A 2067 . ? 1_555 ? 9 AC2 6 HOH F . ? HOH A 2163 . ? 8_665 ? 10 AC2 6 HOH F . ? HOH A 2163 . ? 1_555 ? 11 AC2 6 HOH F . ? HOH A 2164 . ? 8_665 ? 12 AC2 6 HOH F . ? HOH A 2164 . ? 1_555 ? 13 AC3 19 PHE A 45 ? PHE A 42 . ? 1_555 ? 14 AC3 19 PRO A 46 ? PRO A 43 . ? 1_555 ? 15 AC3 19 ARG A 48 ? ARG A 45 . ? 1_555 ? 16 AC3 19 LEU A 60 ? LEU A 57 . ? 1_555 ? 17 AC3 19 PHE A 75 ? PHE A 72 . ? 1_555 ? 18 AC3 19 ARG A 79 ? ARG A 76 . ? 1_555 ? 19 AC3 19 ARG A 100 ? ARG A 97 . ? 1_555 ? 20 AC3 19 GLY A 105 ? GLY A 102 . ? 1_555 ? 21 AC3 19 TYR A 108 ? TYR A 105 . ? 1_555 ? 22 AC3 19 TYR A 154 ? TYR A 151 . ? 1_555 ? 23 AC3 19 HOH F . ? HOH A 2144 . ? 1_555 ? 24 AC3 19 HOH F . ? HOH A 2288 . ? 1_555 ? 25 AC3 19 HOH F . ? HOH A 2289 . ? 1_555 ? 26 AC3 19 HOH F . ? HOH A 2290 . ? 1_555 ? 27 AC3 19 HOH F . ? HOH A 2291 . ? 1_555 ? 28 AC3 19 HOH F . ? HOH A 2292 . ? 1_555 ? 29 AC3 19 HOH F . ? HOH A 2293 . ? 1_555 ? 30 AC3 19 HOH F . ? HOH A 2294 . ? 1_555 ? 31 AC3 19 HOH F . ? HOH A 2295 . ? 1_555 ? 32 AC4 27 ARG A 19 ? ARG A 16 . ? 1_555 ? 33 AC4 27 ALA A 20 ? ALA A 17 . ? 1_555 ? 34 AC4 27 GLY A 21 ? GLY A 18 . ? 1_555 ? 35 AC4 27 LYS A 22 ? LYS A 19 . ? 1_555 ? 36 AC4 27 SER A 23 ? SER A 20 . ? 1_555 ? 37 AC4 27 THR A 24 ? THR A 21 . ? 1_555 ? 38 AC4 27 ARG A 146 ? ARG A 143 . ? 1_555 ? 39 AC4 27 LYS A 185 ? LYS A 182 . ? 1_555 ? 40 AC4 27 SER A 186 ? SER A 183 . ? 1_555 ? 41 AC4 27 ILE A 187 ? ILE A 184 . ? 1_555 ? 42 AC4 27 ARG A 195 ? ARG A 192 . ? 4_455 ? 43 AC4 27 GLU A 199 ? GLU A 196 . ? 4_455 ? 44 AC4 27 MG D . ? MG A 401 . ? 1_555 ? 45 AC4 27 HOH F . ? HOH A 2144 . ? 1_555 ? 46 AC4 27 HOH F . ? HOH A 2293 . ? 1_555 ? 47 AC4 27 HOH F . ? HOH A 2296 . ? 1_555 ? 48 AC4 27 HOH F . ? HOH A 2297 . ? 1_555 ? 49 AC4 27 HOH F . ? HOH A 2298 . ? 1_555 ? 50 AC4 27 HOH F . ? HOH A 2299 . ? 1_555 ? 51 AC4 27 HOH F . ? HOH A 2300 . ? 1_555 ? 52 AC4 27 HOH F . ? HOH A 2301 . ? 1_555 ? 53 AC4 27 HOH F . ? HOH A 2302 . ? 1_555 ? 54 AC4 27 HOH F . ? HOH A 2303 . ? 1_555 ? 55 AC4 27 HOH F . ? HOH A 2305 . ? 1_555 ? 56 AC4 27 HOH F . ? HOH A 2306 . ? 1_555 ? 57 AC4 27 HOH F . ? HOH A 2307 . ? 1_555 ? 58 AC4 27 HOH F . ? HOH A 2308 . ? 1_555 ? # _database_PDB_matrix.entry_id 1E9E _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1E9E _atom_sites.fract_transf_matrix[1][1] 0.009911 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009911 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020704 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 ? ? ? A . n A 1 2 SER 2 -2 ? ? ? A . n A 1 3 HIS 3 -1 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 ALA 5 2 ? ? ? A . n A 1 6 ALA 6 3 3 ALA ALA A . n A 1 7 ARG 7 4 4 ARG ARG A . n A 1 8 ARG 8 5 5 ARG ARG A . n A 1 9 GLY 9 6 6 GLY GLY A . n A 1 10 ALA 10 7 7 ALA ALA A . n A 1 11 LEU 11 8 8 LEU LEU A . n A 1 12 ILE 12 9 9 ILE ILE A . n A 1 13 VAL 13 10 10 VAL VAL A . n A 1 14 LEU 14 11 11 LEU LEU A . n A 1 15 GLU 15 12 12 GLU GLU A . n A 1 16 GLY 16 13 13 GLY GLY A . n A 1 17 VAL 17 14 14 VAL VAL A . n A 1 18 ASP 18 15 15 ASP ASP A . n A 1 19 ARG 19 16 16 ARG ARG A . n A 1 20 ALA 20 17 17 ALA ALA A . n A 1 21 GLY 21 18 18 GLY GLY A . n A 1 22 LYS 22 19 19 LYS LYS A . n A 1 23 SER 23 20 20 SER SER A . n A 1 24 THR 24 21 21 THR THR A . n A 1 25 GLN 25 22 22 GLN GLN A . n A 1 26 SER 26 23 23 SER SER A . n A 1 27 ARG 27 24 24 ARG ARG A . n A 1 28 LYS 28 25 25 LYS LYS A . n A 1 29 LEU 29 26 26 LEU LEU A . n A 1 30 VAL 30 27 27 VAL VAL A . n A 1 31 GLU 31 28 28 GLU GLU A . n A 1 32 ALA 32 29 29 ALA ALA A . n A 1 33 LEU 33 30 30 LEU LEU A . n A 1 34 CYS 34 31 31 CYS CYS A . n A 1 35 ALA 35 32 32 ALA ALA A . n A 1 36 ALA 36 33 33 ALA ALA A . n A 1 37 GLY 37 34 34 GLY GLY A . n A 1 38 HIS 38 35 35 HIS HIS A . n A 1 39 ARG 39 36 36 ARG ARG A . n A 1 40 ALA 40 37 37 ALA ALA A . n A 1 41 GLU 41 38 38 GLU GLU A . n A 1 42 LEU 42 39 39 LEU LEU A . n A 1 43 LEU 43 40 40 LEU LEU A . n A 1 44 ARG 44 41 41 ARG ARG A . n A 1 45 PHE 45 42 42 PHE PHE A . n A 1 46 PRO 46 43 43 PRO PRO A . n A 1 47 GLU 47 44 44 GLU GLU A . n A 1 48 ARG 48 45 45 ARG ARG A . n A 1 49 SER 49 46 46 SER SER A . n A 1 50 THR 50 47 47 THR THR A . n A 1 51 GLU 51 48 48 GLU GLU A . n A 1 52 ILE 52 49 49 ILE ILE A . n A 1 53 GLY 53 50 50 GLY GLY A . n A 1 54 LYS 54 51 51 LYS LYS A . n A 1 55 LEU 55 52 52 LEU LEU A . n A 1 56 LEU 56 53 53 LEU LEU A . n A 1 57 SER 57 54 54 SER SER A . n A 1 58 SER 58 55 55 SER SER A . n A 1 59 TYR 59 56 56 TYR TYR A . n A 1 60 LEU 60 57 57 LEU LEU A . n A 1 61 GLN 61 58 58 GLN GLN A . n A 1 62 LYS 62 59 59 LYS LYS A . n A 1 63 LYS 63 60 60 LYS LYS A . n A 1 64 SER 64 61 61 SER SER A . n A 1 65 ASP 65 62 62 ASP ASP A . n A 1 66 VAL 66 63 63 VAL VAL A . n A 1 67 GLU 67 64 64 GLU GLU A . n A 1 68 ASP 68 65 65 ASP ASP A . n A 1 69 HIS 69 66 66 HIS HIS A . n A 1 70 SER 70 67 67 SER SER A . n A 1 71 VAL 71 68 68 VAL VAL A . n A 1 72 HIS 72 69 69 HIS HIS A . n A 1 73 LEU 73 70 70 LEU LEU A . n A 1 74 LEU 74 71 71 LEU LEU A . n A 1 75 PHE 75 72 72 PHE PHE A . n A 1 76 SER 76 73 73 SER SER A . n A 1 77 ALA 77 74 74 ALA ALA A . n A 1 78 ASN 78 75 75 ASN ASN A . n A 1 79 ARG 79 76 76 ARG ARG A . n A 1 80 TRP 80 77 77 TRP TRP A . n A 1 81 GLU 81 78 78 GLU GLU A . n A 1 82 GLN 82 79 79 GLN GLN A . n A 1 83 VAL 83 80 80 VAL VAL A . n A 1 84 PRO 84 81 81 PRO PRO A . n A 1 85 LEU 85 82 82 LEU LEU A . n A 1 86 ILE 86 83 83 ILE ILE A . n A 1 87 LYS 87 84 84 LYS LYS A . n A 1 88 GLU 88 85 85 GLU GLU A . n A 1 89 LYS 89 86 86 LYS LYS A . n A 1 90 LEU 90 87 87 LEU LEU A . n A 1 91 SER 91 88 88 SER SER A . n A 1 92 GLN 92 89 89 GLN GLN A . n A 1 93 GLY 93 90 90 GLY GLY A . n A 1 94 VAL 94 91 91 VAL VAL A . n A 1 95 THR 95 92 92 THR THR A . n A 1 96 LEU 96 93 93 LEU LEU A . n A 1 97 VAL 97 94 94 VAL VAL A . n A 1 98 VAL 98 95 95 VAL VAL A . n A 1 99 ASP 99 96 96 ASP ASP A . n A 1 100 ARG 100 97 97 ARG ARG A . n A 1 101 TYR 101 98 98 TYR TYR A . n A 1 102 ALA 102 99 99 ALA ALA A . n A 1 103 PHE 103 100 100 PHE PHE A . n A 1 104 SER 104 101 101 SER SER A . n A 1 105 GLY 105 102 102 GLY GLY A . n A 1 106 VAL 106 103 103 VAL VAL A . n A 1 107 ALA 107 104 104 ALA ALA A . n A 1 108 TYR 108 105 105 TYR TYR A . n A 1 109 THR 109 106 106 THR THR A . n A 1 110 GLY 110 107 107 GLY GLY A . n A 1 111 ALA 111 108 108 ALA ALA A . n A 1 112 LYS 112 109 109 LYS LYS A . n A 1 113 GLU 113 110 110 GLU GLU A . n A 1 114 ASN 114 111 111 ASN ASN A . n A 1 115 PHE 115 112 112 PHE PHE A . n A 1 116 SER 116 113 113 SER SER A . n A 1 117 LEU 117 114 114 LEU LEU A . n A 1 118 ASP 118 115 115 ASP ASP A . n A 1 119 TRP 119 116 116 TRP TRP A . n A 1 120 CYS 120 117 117 CYS CYS A . n A 1 121 LYS 121 118 118 LYS LYS A . n A 1 122 GLN 122 119 119 GLN GLN A . n A 1 123 PRO 123 120 120 PRO PRO A . n A 1 124 ASP 124 121 121 ASP ASP A . n A 1 125 VAL 125 122 122 VAL VAL A . n A 1 126 GLY 126 123 123 GLY GLY A . n A 1 127 LEU 127 124 124 LEU LEU A . n A 1 128 PRO 128 125 125 PRO PRO A . n A 1 129 LYS 129 126 126 LYS LYS A . n A 1 130 PRO 130 127 127 PRO PRO A . n A 1 131 ASP 131 128 128 ASP ASP A . n A 1 132 LEU 132 129 129 LEU LEU A . n A 1 133 VAL 133 130 130 VAL VAL A . n A 1 134 LEU 134 131 131 LEU LEU A . n A 1 135 PHE 135 132 132 PHE PHE A . n A 1 136 LEU 136 133 133 LEU LEU A . n A 1 137 GLN 137 134 134 GLN GLN A . n A 1 138 LEU 138 135 135 LEU LEU A . n A 1 139 GLN 139 136 136 GLN GLN A . n A 1 140 LEU 140 137 137 LEU LEU A . n A 1 141 ALA 141 138 138 ALA ALA A . n A 1 142 ASP 142 139 139 ASP ASP A . n A 1 143 ALA 143 140 140 ALA ALA A . n A 1 144 ALA 144 141 141 ALA ALA A . n A 1 145 LYS 145 142 142 LYS LYS A . n A 1 146 ARG 146 143 143 ARG ARG A . n A 1 147 GLY 147 144 144 GLY GLY A . n A 1 148 ALA 148 145 145 ALA ALA A . n A 1 149 PHE 149 146 146 PHE PHE A . n A 1 150 GLY 150 147 147 GLY GLY A . n A 1 151 HIS 151 148 148 HIS HIS A . n A 1 152 GLU 152 149 149 GLU GLU A . n A 1 153 ARG 153 150 150 ARG ARG A . n A 1 154 TYR 154 151 151 TYR TYR A . n A 1 155 GLU 155 152 152 GLU GLU A . n A 1 156 ASN 156 153 153 ASN ASN A . n A 1 157 GLY 157 154 154 GLY GLY A . n A 1 158 ALA 158 155 155 ALA ALA A . n A 1 159 PHE 159 156 156 PHE PHE A . n A 1 160 GLN 160 157 157 GLN GLN A . n A 1 161 GLU 161 158 158 GLU GLU A . n A 1 162 ARG 162 159 159 ARG ARG A . n A 1 163 ALA 163 160 160 ALA ALA A . n A 1 164 LEU 164 161 161 LEU LEU A . n A 1 165 ARG 165 162 162 ARG ARG A . n A 1 166 CYS 166 163 163 CYS CYS A . n A 1 167 PHE 167 164 164 PHE PHE A . n A 1 168 HIS 168 165 165 HIS HIS A . n A 1 169 GLN 169 166 166 GLN GLN A . n A 1 170 LEU 170 167 167 LEU LEU A . n A 1 171 MET 171 168 168 MET MET A . n A 1 172 LYS 172 169 169 LYS LYS A . n A 1 173 ASP 173 170 170 ASP ASP A . n A 1 174 THR 174 171 171 THR THR A . n A 1 175 THR 175 172 172 THR THR A . n A 1 176 LEU 176 173 173 LEU LEU A . n A 1 177 ASN 177 174 174 ASN ASN A . n A 1 178 TRP 178 175 175 TRP TRP A . n A 1 179 LYS 179 176 176 LYS LYS A . n A 1 180 MET 180 177 177 MET MET A . n A 1 181 VAL 181 178 178 VAL VAL A . n A 1 182 ASP 182 179 179 ASP ASP A . n A 1 183 ALA 183 180 180 ALA ALA A . n A 1 184 SER 184 181 181 SER SER A . n A 1 185 LYS 185 182 182 LYS LYS A . n A 1 186 SER 186 183 183 SER SER A . n A 1 187 ILE 187 184 184 ILE ILE A . n A 1 188 GLU 188 185 185 GLU GLU A . n A 1 189 ALA 189 186 186 ALA ALA A . n A 1 190 VAL 190 187 187 VAL VAL A . n A 1 191 HIS 191 188 188 HIS HIS A . n A 1 192 GLU 192 189 189 GLU GLU A . n A 1 193 ASP 193 190 190 ASP ASP A . n A 1 194 ILE 194 191 191 ILE ILE A . n A 1 195 ARG 195 192 192 ARG ARG A . n A 1 196 VAL 196 193 193 VAL VAL A . n A 1 197 LEU 197 194 194 LEU LEU A . n A 1 198 SER 198 195 195 SER SER A . n A 1 199 GLU 199 196 196 GLU GLU A . n A 1 200 ASP 200 197 197 ASP ASP A . n A 1 201 ALA 201 198 198 ALA ALA A . n A 1 202 ILE 202 199 199 ILE ILE A . n A 1 203 ALA 203 200 200 ALA ALA A . n A 1 204 THR 204 201 201 THR THR A . n A 1 205 ALA 205 202 202 ALA ALA A . n A 1 206 THR 206 203 203 THR THR A . n A 1 207 GLU 207 204 204 GLU GLU A . n A 1 208 LYS 208 205 205 LYS LYS A . n A 1 209 PRO 209 206 206 PRO PRO A . n A 1 210 LEU 210 207 207 LEU LEU A . n A 1 211 LYS 211 208 208 LYS LYS A . n A 1 212 GLU 212 209 209 GLU GLU A . n A 1 213 LEU 213 210 210 LEU LEU A . n A 1 214 TRP 214 211 211 TRP TRP A . n A 1 215 LYS 215 212 212 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TMP 1 301 301 TMP TMP A . C 3 ADP 1 302 302 ADP ADP A . D 4 MG 1 401 401 MG MG A . E 4 MG 1 402 402 MG MG A . F 5 HOH 1 2001 2001 HOH HOH A . F 5 HOH 2 2002 2002 HOH HOH A . F 5 HOH 3 2003 2003 HOH HOH A . F 5 HOH 4 2004 2004 HOH HOH A . F 5 HOH 5 2005 2005 HOH HOH A . F 5 HOH 6 2006 2006 HOH HOH A . F 5 HOH 7 2007 2007 HOH HOH A . F 5 HOH 8 2008 2008 HOH HOH A . F 5 HOH 9 2009 2009 HOH HOH A . F 5 HOH 10 2010 2010 HOH HOH A . F 5 HOH 11 2011 2011 HOH HOH A . F 5 HOH 12 2012 2012 HOH HOH A . F 5 HOH 13 2013 2013 HOH HOH A . F 5 HOH 14 2014 2014 HOH HOH A . F 5 HOH 15 2015 2015 HOH HOH A . F 5 HOH 16 2016 2016 HOH HOH A . F 5 HOH 17 2017 2017 HOH HOH A . F 5 HOH 18 2018 2018 HOH HOH A . F 5 HOH 19 2019 2019 HOH HOH A . F 5 HOH 20 2020 2020 HOH HOH A . F 5 HOH 21 2021 2021 HOH HOH A . F 5 HOH 22 2022 2022 HOH HOH A . F 5 HOH 23 2023 2023 HOH HOH A . F 5 HOH 24 2024 2024 HOH HOH A . F 5 HOH 25 2025 2025 HOH HOH A . F 5 HOH 26 2026 2026 HOH HOH A . F 5 HOH 27 2027 2027 HOH HOH A . F 5 HOH 28 2028 2028 HOH HOH A . F 5 HOH 29 2029 2029 HOH HOH A . F 5 HOH 30 2030 2030 HOH HOH A . F 5 HOH 31 2031 2031 HOH HOH A . F 5 HOH 32 2032 2032 HOH HOH A . F 5 HOH 33 2033 2033 HOH HOH A . F 5 HOH 34 2034 2034 HOH HOH A . F 5 HOH 35 2035 2035 HOH HOH A . F 5 HOH 36 2036 2036 HOH HOH A . F 5 HOH 37 2037 2037 HOH HOH A . F 5 HOH 38 2038 2038 HOH HOH A . F 5 HOH 39 2039 2039 HOH HOH A . F 5 HOH 40 2040 2040 HOH HOH A . F 5 HOH 41 2041 2041 HOH HOH A . F 5 HOH 42 2042 2042 HOH HOH A . F 5 HOH 43 2043 2043 HOH HOH A . F 5 HOH 44 2044 2044 HOH HOH A . F 5 HOH 45 2045 2045 HOH HOH A . F 5 HOH 46 2046 2046 HOH HOH A . F 5 HOH 47 2047 2047 HOH HOH A . F 5 HOH 48 2048 2048 HOH HOH A . F 5 HOH 49 2049 2049 HOH HOH A . F 5 HOH 50 2050 2050 HOH HOH A . F 5 HOH 51 2051 2051 HOH HOH A . F 5 HOH 52 2052 2052 HOH HOH A . F 5 HOH 53 2053 2053 HOH HOH A . F 5 HOH 54 2054 2054 HOH HOH A . F 5 HOH 55 2055 2055 HOH HOH A . F 5 HOH 56 2056 2056 HOH HOH A . F 5 HOH 57 2057 2057 HOH HOH A . F 5 HOH 58 2058 2058 HOH HOH A . F 5 HOH 59 2059 2059 HOH HOH A . F 5 HOH 60 2060 2060 HOH HOH A . F 5 HOH 61 2061 2061 HOH HOH A . F 5 HOH 62 2062 2062 HOH HOH A . F 5 HOH 63 2063 2063 HOH HOH A . F 5 HOH 64 2064 2064 HOH HOH A . F 5 HOH 65 2065 2065 HOH HOH A . F 5 HOH 66 2066 2066 HOH HOH A . F 5 HOH 67 2067 2067 HOH HOH A . F 5 HOH 68 2068 2068 HOH HOH A . F 5 HOH 69 2069 2069 HOH HOH A . F 5 HOH 70 2070 2070 HOH HOH A . F 5 HOH 71 2071 2071 HOH HOH A . F 5 HOH 72 2072 2072 HOH HOH A . F 5 HOH 73 2073 2073 HOH HOH A . F 5 HOH 74 2074 2074 HOH HOH A . F 5 HOH 75 2075 2075 HOH HOH A . F 5 HOH 76 2076 2076 HOH HOH A . F 5 HOH 77 2077 2077 HOH HOH A . F 5 HOH 78 2078 2078 HOH HOH A . F 5 HOH 79 2079 2079 HOH HOH A . F 5 HOH 80 2080 2080 HOH HOH A . F 5 HOH 81 2081 2081 HOH HOH A . F 5 HOH 82 2082 2082 HOH HOH A . F 5 HOH 83 2083 2083 HOH HOH A . F 5 HOH 84 2084 2084 HOH HOH A . F 5 HOH 85 2085 2085 HOH HOH A . F 5 HOH 86 2086 2086 HOH HOH A . F 5 HOH 87 2087 2087 HOH HOH A . F 5 HOH 88 2088 2088 HOH HOH A . F 5 HOH 89 2089 2089 HOH HOH A . F 5 HOH 90 2090 2090 HOH HOH A . F 5 HOH 91 2091 2091 HOH HOH A . F 5 HOH 92 2092 2092 HOH HOH A . F 5 HOH 93 2093 2093 HOH HOH A . F 5 HOH 94 2094 2094 HOH HOH A . F 5 HOH 95 2095 2095 HOH HOH A . F 5 HOH 96 2096 2096 HOH HOH A . F 5 HOH 97 2097 2097 HOH HOH A . F 5 HOH 98 2098 2098 HOH HOH A . F 5 HOH 99 2099 2099 HOH HOH A . F 5 HOH 100 2100 2100 HOH HOH A . F 5 HOH 101 2101 2101 HOH HOH A . F 5 HOH 102 2102 2102 HOH HOH A . F 5 HOH 103 2103 2103 HOH HOH A . F 5 HOH 104 2104 2104 HOH HOH A . F 5 HOH 105 2105 2105 HOH HOH A . F 5 HOH 106 2106 2106 HOH HOH A . F 5 HOH 107 2107 2107 HOH HOH A . F 5 HOH 108 2108 2108 HOH HOH A . F 5 HOH 109 2109 2109 HOH HOH A . F 5 HOH 110 2110 2110 HOH HOH A . F 5 HOH 111 2111 2111 HOH HOH A . F 5 HOH 112 2112 2112 HOH HOH A . F 5 HOH 113 2113 2113 HOH HOH A . F 5 HOH 114 2114 2114 HOH HOH A . F 5 HOH 115 2115 2115 HOH HOH A . F 5 HOH 116 2116 2116 HOH HOH A . F 5 HOH 117 2117 2117 HOH HOH A . F 5 HOH 118 2118 2118 HOH HOH A . F 5 HOH 119 2119 2119 HOH HOH A . F 5 HOH 120 2120 2120 HOH HOH A . F 5 HOH 121 2121 2121 HOH HOH A . F 5 HOH 122 2122 2122 HOH HOH A . F 5 HOH 123 2123 2123 HOH HOH A . F 5 HOH 124 2124 2124 HOH HOH A . F 5 HOH 125 2125 2125 HOH HOH A . F 5 HOH 126 2126 2126 HOH HOH A . F 5 HOH 127 2127 2127 HOH HOH A . F 5 HOH 128 2128 2128 HOH HOH A . F 5 HOH 129 2129 2129 HOH HOH A . F 5 HOH 130 2130 2130 HOH HOH A . F 5 HOH 131 2131 2131 HOH HOH A . F 5 HOH 132 2132 2132 HOH HOH A . F 5 HOH 133 2133 2133 HOH HOH A . F 5 HOH 134 2134 2134 HOH HOH A . F 5 HOH 135 2135 2135 HOH HOH A . F 5 HOH 136 2136 2136 HOH HOH A . F 5 HOH 137 2137 2137 HOH HOH A . F 5 HOH 138 2138 2138 HOH HOH A . F 5 HOH 139 2139 2139 HOH HOH A . F 5 HOH 140 2140 2140 HOH HOH A . F 5 HOH 141 2141 2141 HOH HOH A . F 5 HOH 142 2142 2142 HOH HOH A . F 5 HOH 143 2143 2143 HOH HOH A . F 5 HOH 144 2144 2144 HOH HOH A . F 5 HOH 145 2145 2145 HOH HOH A . F 5 HOH 146 2146 2146 HOH HOH A . F 5 HOH 147 2147 2147 HOH HOH A . F 5 HOH 148 2148 2148 HOH HOH A . F 5 HOH 149 2149 2149 HOH HOH A . F 5 HOH 150 2150 2150 HOH HOH A . F 5 HOH 151 2151 2151 HOH HOH A . F 5 HOH 152 2152 2152 HOH HOH A . F 5 HOH 153 2153 2153 HOH HOH A . F 5 HOH 154 2154 2154 HOH HOH A . F 5 HOH 155 2155 2155 HOH HOH A . F 5 HOH 156 2156 2156 HOH HOH A . F 5 HOH 157 2157 2157 HOH HOH A . F 5 HOH 158 2158 2158 HOH HOH A . F 5 HOH 159 2159 2159 HOH HOH A . F 5 HOH 160 2160 2160 HOH HOH A . F 5 HOH 161 2161 2161 HOH HOH A . F 5 HOH 162 2162 2162 HOH HOH A . F 5 HOH 163 2163 2163 HOH HOH A . F 5 HOH 164 2164 2164 HOH HOH A . F 5 HOH 165 2165 2165 HOH HOH A . F 5 HOH 166 2166 2166 HOH HOH A . F 5 HOH 167 2167 2167 HOH HOH A . F 5 HOH 168 2168 2168 HOH HOH A . F 5 HOH 169 2169 2169 HOH HOH A . F 5 HOH 170 2170 2170 HOH HOH A . F 5 HOH 171 2171 2171 HOH HOH A . F 5 HOH 172 2172 2172 HOH HOH A . F 5 HOH 173 2173 2173 HOH HOH A . F 5 HOH 174 2174 2174 HOH HOH A . F 5 HOH 175 2175 2175 HOH HOH A . F 5 HOH 176 2176 2176 HOH HOH A . F 5 HOH 177 2177 2177 HOH HOH A . F 5 HOH 178 2178 2178 HOH HOH A . F 5 HOH 179 2179 2179 HOH HOH A . F 5 HOH 180 2180 2180 HOH HOH A . F 5 HOH 181 2181 2181 HOH HOH A . F 5 HOH 182 2182 2182 HOH HOH A . F 5 HOH 183 2183 2183 HOH HOH A . F 5 HOH 184 2184 2184 HOH HOH A . F 5 HOH 185 2185 2185 HOH HOH A . F 5 HOH 186 2186 2186 HOH HOH A . F 5 HOH 187 2187 2187 HOH HOH A . F 5 HOH 188 2188 2188 HOH HOH A . F 5 HOH 189 2189 2189 HOH HOH A . F 5 HOH 190 2190 2190 HOH HOH A . F 5 HOH 191 2191 2191 HOH HOH A . F 5 HOH 192 2192 2192 HOH HOH A . F 5 HOH 193 2193 2193 HOH HOH A . F 5 HOH 194 2194 2194 HOH HOH A . F 5 HOH 195 2195 2195 HOH HOH A . F 5 HOH 196 2196 2196 HOH HOH A . F 5 HOH 197 2197 2197 HOH HOH A . F 5 HOH 198 2198 2198 HOH HOH A . F 5 HOH 199 2199 2199 HOH HOH A . F 5 HOH 200 2200 2200 HOH HOH A . F 5 HOH 201 2201 2201 HOH HOH A . F 5 HOH 202 2202 2202 HOH HOH A . F 5 HOH 203 2203 2203 HOH HOH A . F 5 HOH 204 2204 2204 HOH HOH A . F 5 HOH 205 2205 2205 HOH HOH A . F 5 HOH 206 2206 2206 HOH HOH A . F 5 HOH 207 2207 2207 HOH HOH A . F 5 HOH 208 2208 2208 HOH HOH A . F 5 HOH 209 2209 2209 HOH HOH A . F 5 HOH 210 2210 2210 HOH HOH A . F 5 HOH 211 2211 2211 HOH HOH A . F 5 HOH 212 2212 2212 HOH HOH A . F 5 HOH 213 2213 2213 HOH HOH A . F 5 HOH 214 2214 2214 HOH HOH A . F 5 HOH 215 2215 2215 HOH HOH A . F 5 HOH 216 2216 2216 HOH HOH A . F 5 HOH 217 2217 2217 HOH HOH A . F 5 HOH 218 2218 2218 HOH HOH A . F 5 HOH 219 2219 2219 HOH HOH A . F 5 HOH 220 2220 2220 HOH HOH A . F 5 HOH 221 2221 2221 HOH HOH A . F 5 HOH 222 2222 2222 HOH HOH A . F 5 HOH 223 2223 2223 HOH HOH A . F 5 HOH 224 2224 2224 HOH HOH A . F 5 HOH 225 2225 2225 HOH HOH A . F 5 HOH 226 2226 2226 HOH HOH A . F 5 HOH 227 2227 2227 HOH HOH A . F 5 HOH 228 2228 2228 HOH HOH A . F 5 HOH 229 2229 2229 HOH HOH A . F 5 HOH 230 2230 2230 HOH HOH A . F 5 HOH 231 2231 2231 HOH HOH A . F 5 HOH 232 2232 2232 HOH HOH A . F 5 HOH 233 2233 2233 HOH HOH A . F 5 HOH 234 2234 2234 HOH HOH A . F 5 HOH 235 2235 2235 HOH HOH A . F 5 HOH 236 2236 2236 HOH HOH A . F 5 HOH 237 2237 2237 HOH HOH A . F 5 HOH 238 2238 2238 HOH HOH A . F 5 HOH 239 2239 2239 HOH HOH A . F 5 HOH 240 2240 2240 HOH HOH A . F 5 HOH 241 2241 2241 HOH HOH A . F 5 HOH 242 2242 2242 HOH HOH A . F 5 HOH 243 2243 2243 HOH HOH A . F 5 HOH 244 2244 2244 HOH HOH A . F 5 HOH 245 2245 2245 HOH HOH A . F 5 HOH 246 2246 2246 HOH HOH A . F 5 HOH 247 2247 2247 HOH HOH A . F 5 HOH 248 2248 2248 HOH HOH A . F 5 HOH 249 2249 2249 HOH HOH A . F 5 HOH 250 2250 2250 HOH HOH A . F 5 HOH 251 2251 2251 HOH HOH A . F 5 HOH 252 2252 2252 HOH HOH A . F 5 HOH 253 2253 2253 HOH HOH A . F 5 HOH 254 2254 2254 HOH HOH A . F 5 HOH 255 2255 2255 HOH HOH A . F 5 HOH 256 2256 2256 HOH HOH A . F 5 HOH 257 2257 2257 HOH HOH A . F 5 HOH 258 2258 2258 HOH HOH A . F 5 HOH 259 2259 2259 HOH HOH A . F 5 HOH 260 2260 2260 HOH HOH A . F 5 HOH 261 2261 2261 HOH HOH A . F 5 HOH 262 2262 2262 HOH HOH A . F 5 HOH 263 2263 2263 HOH HOH A . F 5 HOH 264 2264 2264 HOH HOH A . F 5 HOH 265 2265 2265 HOH HOH A . F 5 HOH 266 2266 2266 HOH HOH A . F 5 HOH 267 2267 2267 HOH HOH A . F 5 HOH 268 2268 2268 HOH HOH A . F 5 HOH 269 2269 2269 HOH HOH A . F 5 HOH 270 2270 2270 HOH HOH A . F 5 HOH 271 2271 2271 HOH HOH A . F 5 HOH 272 2272 2272 HOH HOH A . F 5 HOH 273 2273 2273 HOH HOH A . F 5 HOH 274 2274 2274 HOH HOH A . F 5 HOH 275 2275 2275 HOH HOH A . F 5 HOH 276 2276 2276 HOH HOH A . F 5 HOH 277 2277 2277 HOH HOH A . F 5 HOH 278 2278 2278 HOH HOH A . F 5 HOH 279 2279 2279 HOH HOH A . F 5 HOH 280 2280 2280 HOH HOH A . F 5 HOH 281 2281 2281 HOH HOH A . F 5 HOH 282 2282 2282 HOH HOH A . F 5 HOH 283 2283 2283 HOH HOH A . F 5 HOH 284 2284 2284 HOH HOH A . F 5 HOH 285 2285 2285 HOH HOH A . F 5 HOH 286 2286 2286 HOH HOH A . F 5 HOH 287 2287 2287 HOH HOH A . F 5 HOH 288 2288 2288 HOH HOH A . F 5 HOH 289 2289 2289 HOH HOH A . F 5 HOH 290 2290 2290 HOH HOH A . F 5 HOH 291 2291 2291 HOH HOH A . F 5 HOH 292 2292 2292 HOH HOH A . F 5 HOH 293 2293 2293 HOH HOH A . F 5 HOH 294 2294 2294 HOH HOH A . F 5 HOH 295 2295 2295 HOH HOH A . F 5 HOH 296 2296 2296 HOH HOH A . F 5 HOH 297 2297 2297 HOH HOH A . F 5 HOH 298 2298 2298 HOH HOH A . F 5 HOH 299 2299 2299 HOH HOH A . F 5 HOH 300 2300 2300 HOH HOH A . F 5 HOH 301 2301 2301 HOH HOH A . F 5 HOH 302 2302 2302 HOH HOH A . F 5 HOH 303 2303 2303 HOH HOH A . F 5 HOH 304 2304 2304 HOH HOH A . F 5 HOH 305 2305 2305 HOH HOH A . F 5 HOH 306 2306 2306 HOH HOH A . F 5 HOH 307 2307 2307 HOH HOH A . F 5 HOH 308 2308 2308 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1790 ? 1 MORE -19.0 ? 1 'SSA (A^2)' 21970 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 100.9000000000 -1.0000000000 0.0000000000 0.0000000000 100.9000000000 0.0000000000 0.0000000000 -1.0000000000 24.1500000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A MG 402 ? E MG . 2 1 A HOH 2222 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O2B ? C ADP . ? A ADP 302 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 2144 ? 1_555 93.0 ? 2 O2B ? C ADP . ? A ADP 302 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 2032 ? 1_555 173.1 ? 3 O ? F HOH . ? A HOH 2144 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 2032 ? 1_555 90.2 ? 4 O2B ? C ADP . ? A ADP 302 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 2293 ? 1_555 94.6 ? 5 O ? F HOH . ? A HOH 2144 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 2293 ? 1_555 91.0 ? 6 O ? F HOH . ? A HOH 2032 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 2293 ? 1_555 91.3 ? 7 O2B ? C ADP . ? A ADP 302 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 2296 ? 1_555 89.0 ? 8 O ? F HOH . ? A HOH 2144 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 2296 ? 1_555 177.1 ? 9 O ? F HOH . ? A HOH 2032 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 2296 ? 1_555 87.6 ? 10 O ? F HOH . ? A HOH 2293 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 O ? F HOH . ? A HOH 2296 ? 1_555 90.9 ? 11 O2B ? C ADP . ? A ADP 302 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 OG ? A SER 23 ? A SER 20 ? 1_555 90.7 ? 12 O ? F HOH . ? A HOH 2144 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 OG ? A SER 23 ? A SER 20 ? 1_555 84.8 ? 13 O ? F HOH . ? A HOH 2032 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 OG ? A SER 23 ? A SER 20 ? 1_555 83.6 ? 14 O ? F HOH . ? A HOH 2293 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 OG ? A SER 23 ? A SER 20 ? 1_555 173.4 ? 15 O ? F HOH . ? A HOH 2296 ? 1_555 MG ? D MG . ? A MG 401 ? 1_555 OG ? A SER 23 ? A SER 20 ? 1_555 93.1 ? 16 O ? F HOH . ? A HOH 2164 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2164 ? 8_665 92.8 ? 17 O ? F HOH . ? A HOH 2164 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2067 ? 1_555 88.5 ? 18 O ? F HOH . ? A HOH 2164 ? 8_665 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2067 ? 1_555 176.7 ? 19 O ? F HOH . ? A HOH 2164 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2163 ? 8_665 96.5 ? 20 O ? F HOH . ? A HOH 2164 ? 8_665 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2163 ? 8_665 86.8 ? 21 O ? F HOH . ? A HOH 2067 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2163 ? 8_665 90.0 ? 22 O ? F HOH . ? A HOH 2164 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2163 ? 1_555 83.0 ? 23 O ? F HOH . ? A HOH 2164 ? 8_665 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2163 ? 1_555 91.8 ? 24 O ? F HOH . ? A HOH 2067 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2163 ? 1_555 91.4 ? 25 O ? F HOH . ? A HOH 2163 ? 8_665 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2163 ? 1_555 178.5 ? 26 O ? F HOH . ? A HOH 2164 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2067 ? 8_665 168.5 ? 27 O ? F HOH . ? A HOH 2164 ? 8_665 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2067 ? 8_665 87.7 ? 28 O ? F HOH . ? A HOH 2067 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2067 ? 8_665 91.7 ? 29 O ? F HOH . ? A HOH 2163 ? 8_665 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2067 ? 8_665 94.9 ? 30 O ? F HOH . ? A HOH 2163 ? 1_555 MG ? E MG . ? A MG 402 ? 1_555 O ? F HOH . ? A HOH 2067 ? 8_665 85.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-10-11 2 'Structure model' 1 1 2014-02-19 3 'Structure model' 1 2 2019-03-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Non-polymer description' 4 2 'Structure model' Other 5 2 'Structure model' 'Structure summary' 6 2 'Structure model' 'Version format compliance' 7 3 'Structure model' 'Data collection' 8 3 'Structure model' 'Experimental preparation' 9 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_PDB_rev 2 3 'Structure model' database_PDB_rev_record 3 3 'Structure model' exptl_crystal_grow 4 3 'Structure model' pdbx_database_proc 5 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_exptl_crystal_grow.method' 2 3 'Structure model' '_exptl_crystal_grow.temp' 3 3 'Structure model' '_pdbx_database_status.recvd_author_approval' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement . ? 1 XDS 'data reduction' . ? 2 XSCALE 'data scaling' . ? 3 # _pdbx_entry_details.entry_id 1E9E _pdbx_entry_details.compound_details ;CHAIN A - ENGINEERED MUTATION ARG200ALA, PHE105TYR CHAIN A - (GLY SER HIS) INSERTED AT THE N-TERMINUS CONVERSION OF DTMP TO DTDP ATP + THYMIDINE 5'-MONOPHOSPHATE = ADP + THYMIDINE 5'-DIPHOSPHATE. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;SAMPLE COMTAINS SER183, ILE184, ASP190, AND A ILE191 (CONFIRMED BY THE DNA SEQUENCE AND ELECTRON DENSITY OF SIDE-CHAINS). POSSIBLE ERROR IN SWISSPROT ENTRY. ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 2060 ? ? O A HOH 2062 ? ? 1.96 2 1 NH1 A ARG 41 ? ? O A HOH 2060 ? ? 2.02 3 1 NZ A LYS 126 ? ? NZ A LYS 208 ? ? 2.03 4 1 O A HOH 2210 ? ? O A HOH 2211 ? ? 2.10 5 1 O3P A TMP 301 ? ? O A HOH 2295 ? ? 2.14 6 1 O A HOH 2025 ? ? O A HOH 2059 ? ? 2.14 7 1 OE1 A GLU 44 ? ? O A HOH 2060 ? ? 2.15 8 1 NH2 A ARG 4 ? ? O A HOH 2007 ? ? 2.16 9 1 O A HOH 2210 ? ? O A HOH 2212 ? ? 2.19 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 97 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 97 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 97 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 125.12 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 4.82 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 97 ? ? 81.11 148.10 2 1 TYR A 98 ? ? -151.29 -147.11 3 1 TYR A 151 ? ? 76.28 -12.13 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 2012 ? 5.84 . 2 1 O ? A HOH 2018 ? 6.22 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -3 ? A GLY 1 2 1 Y 1 A SER -2 ? A SER 2 3 1 Y 1 A HIS -1 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A ALA 2 ? A ALA 5 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "THYMIDINE-5'-PHOSPHATE" TMP 3 "ADENOSINE-5'-DIPHOSPHATE" ADP 4 'MAGNESIUM ION' MG 5 water HOH #