data_1EAL # _entry.id 1EAL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1EAL pdb_00001eal 10.2210/pdb1eal/pdb WWPDB D_1000172986 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EAL _pdbx_database_status.recvd_initial_deposition_date 1996-08-28 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Luecke, C.' 1 'Zhang, F.' 2 'Rueterjans, H.' 3 'Hamilton, J.A.' 4 'Sacchettini, J.C.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Flexibility is a likely determinant of binding specificity in the case of ileal lipid binding protein.' Structure 4 785 800 1996 STRUE6 UK 0969-2126 2005 ? 8805562 '10.1016/S0969-2126(96)00086-X' 1 ;Three-Dimensional Structure of Bovine Heart Fatty-Acid-Binding Protein with Bound Palmitic Acid, Determined by Multidimensional NMR Spectroscopy ; Eur.J.Biochem. 230 266 ? 1995 EJBCAI IX 0014-2956 0262 ? ? ? 2 'Developmental and Structural Studies of an Intracellular Lipid Binding Protein Expressed in the Ileal Epithelium' J.Biol.Chem. 265 19199 ? 1990 JBCHA3 US 0021-9258 0071 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lucke, C.' 1 ? primary 'Zhang, F.' 2 ? primary 'Ruterjans, H.' 3 ? primary 'Hamilton, J.A.' 4 ? primary 'Sacchettini, J.C.' 5 ? 1 'Lassen, D.' 6 ? 1 'Lucke, C.' 7 ? 1 'Kveder, M.' 8 ? 1 'Mesgarzadeh, A.' 9 ? 1 'Schmidt, J.M.' 10 ? 1 'Specht, B.' 11 ? 1 'Lezius, A.' 12 ? 1 'Spener, F.' 13 ? 1 'Ruterjans, H.' 14 ? 2 'Sacchettini, J.C.' 15 ? 2 'Hauft, S.M.' 16 ? 2 'Van Camp, S.L.' 17 ? 2 'Cistola, D.P.' 18 ? 2 'Gordon, J.I.' 19 ? # _cell.entry_id 1EAL _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EAL _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ILEAL LIPID BINDING PROTEIN' _entity.formula_weight 14093.877 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'PH 5.0, 310K, APO FORM' # _entity_name_com.entity_id 1 _entity_name_com.name GASTROTROPIN # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AFTGKYEIESEKNYDEFMKRLALPSDAIDKARNLKIISEVKQDGQNFTWSQQYPGGHSITNTFTIGKECDIETIGGKKFK ATVQMEGGKVVVNSPNYHHTAEIVDGKLVEVSTVGGVSYERVSKKLA ; _entity_poly.pdbx_seq_one_letter_code_can ;AFTGKYEIESEKNYDEFMKRLALPSDAIDKARNLKIISEVKQDGQNFTWSQQYPGGHSITNTFTIGKECDIETIGGKKFK ATVQMEGGKVVVNSPNYHHTAEIVDGKLVEVSTVGGVSYERVSKKLA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PHE n 1 3 THR n 1 4 GLY n 1 5 LYS n 1 6 TYR n 1 7 GLU n 1 8 ILE n 1 9 GLU n 1 10 SER n 1 11 GLU n 1 12 LYS n 1 13 ASN n 1 14 TYR n 1 15 ASP n 1 16 GLU n 1 17 PHE n 1 18 MET n 1 19 LYS n 1 20 ARG n 1 21 LEU n 1 22 ALA n 1 23 LEU n 1 24 PRO n 1 25 SER n 1 26 ASP n 1 27 ALA n 1 28 ILE n 1 29 ASP n 1 30 LYS n 1 31 ALA n 1 32 ARG n 1 33 ASN n 1 34 LEU n 1 35 LYS n 1 36 ILE n 1 37 ILE n 1 38 SER n 1 39 GLU n 1 40 VAL n 1 41 LYS n 1 42 GLN n 1 43 ASP n 1 44 GLY n 1 45 GLN n 1 46 ASN n 1 47 PHE n 1 48 THR n 1 49 TRP n 1 50 SER n 1 51 GLN n 1 52 GLN n 1 53 TYR n 1 54 PRO n 1 55 GLY n 1 56 GLY n 1 57 HIS n 1 58 SER n 1 59 ILE n 1 60 THR n 1 61 ASN n 1 62 THR n 1 63 PHE n 1 64 THR n 1 65 ILE n 1 66 GLY n 1 67 LYS n 1 68 GLU n 1 69 CYS n 1 70 ASP n 1 71 ILE n 1 72 GLU n 1 73 THR n 1 74 ILE n 1 75 GLY n 1 76 GLY n 1 77 LYS n 1 78 LYS n 1 79 PHE n 1 80 LYS n 1 81 ALA n 1 82 THR n 1 83 VAL n 1 84 GLN n 1 85 MET n 1 86 GLU n 1 87 GLY n 1 88 GLY n 1 89 LYS n 1 90 VAL n 1 91 VAL n 1 92 VAL n 1 93 ASN n 1 94 SER n 1 95 PRO n 1 96 ASN n 1 97 TYR n 1 98 HIS n 1 99 HIS n 1 100 THR n 1 101 ALA n 1 102 GLU n 1 103 ILE n 1 104 VAL n 1 105 ASP n 1 106 GLY n 1 107 LYS n 1 108 LEU n 1 109 VAL n 1 110 GLU n 1 111 VAL n 1 112 SER n 1 113 THR n 1 114 VAL n 1 115 GLY n 1 116 GLY n 1 117 VAL n 1 118 SER n 1 119 TYR n 1 120 GLU n 1 121 ARG n 1 122 VAL n 1 123 SER n 1 124 LYS n 1 125 LYS n 1 126 LEU n 1 127 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name pig _entity_src_gen.gene_src_genus Sus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue 'ILEAL EPITHELIUM' _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sus scrofa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9823 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line BL21 _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ INTESTINE _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-3D _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ILBP_PIG _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P10289 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;AFTGKYEIESEKNYDEFMKRLALPSDAIDKARNLKIISEVKQDGQNFTWSQQYPGGHSITNTFTIGKECDIETIGGKKFK ATVQMEGGKVVVNSPNYHHTAEIVDGKLVEVSTVGGVTYERVSKKLA ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EAL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 127 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10289 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 127 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 127 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1EAL _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 118 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P10289 _struct_ref_seq_dif.db_mon_id THR _struct_ref_seq_dif.pdbx_seq_db_seq_num 118 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 118 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 TOCSY 1 2 1 NOESY 1 3 1 COSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1EAL _pdbx_nmr_refine.method 'DISTANCE GEOMETRY, SIMULATED ANNEALING' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1EAL _pdbx_nmr_ensemble.conformers_calculated_total_number 5 _pdbx_nmr_ensemble.conformers_submitted_total_number 5 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST VIOLATION OF EXPERIMENTAL DISTANCE CONSTRAINTS' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement SYBYL 5.2 'TRIPOS ASSOCIATES' 1 'structure solution' DIANA ? ? 2 'structure solution' SYBYL ? ? 3 # _exptl.entry_id 1EAL _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1EAL _struct.title 'NMR STUDY OF ILEAL LIPID BINDING PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EAL _struct_keywords.pdbx_keywords 'FATTY ACID BINDING PROTEIN' _struct_keywords.text 'INTRACELLULAR LIPID BINDING PROTEIN, BILE ACID BINDING, ILEAL EPITHELIUM, FATTY ACID BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 13 ? LEU A 21 ? ASN A 13 LEU A 21 1 ? 9 HELX_P HELX_P2 2 SER A 25 ? ARG A 32 ? SER A 25 ARG A 32 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 58 ? THR A 64 ? SER A 58 THR A 64 A 2 PHE A 47 ? GLN A 52 ? PHE A 47 GLN A 52 A 3 ILE A 37 ? GLN A 42 ? ILE A 37 GLN A 42 A 4 GLY A 4 ? LYS A 12 ? GLY A 4 LYS A 12 A 5 SER A 118 ? LYS A 125 ? SER A 118 LYS A 125 A 6 LEU A 108 ? THR A 113 ? LEU A 108 THR A 113 A 7 HIS A 98 ? ILE A 103 ? HIS A 98 ILE A 103 A 8 VAL A 90 ? ASN A 93 ? VAL A 90 ASN A 93 B 1 CYS A 69 ? GLU A 72 ? CYS A 69 GLU A 72 B 2 LYS A 78 ? MET A 85 ? LYS A 78 MET A 85 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 59 ? O ILE A 59 N GLN A 51 ? N GLN A 51 A 2 3 O THR A 48 ? O THR A 48 N LYS A 41 ? N LYS A 41 A 3 4 O SER A 38 ? O SER A 38 N TYR A 6 ? N TYR A 6 A 4 5 O GLU A 7 ? O GLU A 7 N LYS A 124 ? N LYS A 124 A 5 6 O ARG A 121 ? O ARG A 121 N GLU A 110 ? N GLU A 110 A 6 7 O VAL A 109 ? O VAL A 109 N GLU A 102 ? N GLU A 102 A 7 8 O HIS A 99 ? O HIS A 99 N VAL A 92 ? N VAL A 92 B 1 2 O CYS A 69 ? O CYS A 69 N ALA A 81 ? N ALA A 81 # _database_PDB_matrix.entry_id 1EAL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1EAL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 HIS 57 57 57 HIS HIS A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 CYS 69 69 69 CYS CYS A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ALA 127 127 127 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1997-01-22 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 4 _pdbx_validate_rmsd_bond.auth_atom_id_1 CE1 _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 HIS _pdbx_validate_rmsd_bond.auth_seq_id_1 98 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 NE2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 HIS _pdbx_validate_rmsd_bond.auth_seq_id_2 98 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.250 _pdbx_validate_rmsd_bond.bond_target_value 1.317 _pdbx_validate_rmsd_bond.bond_deviation -0.067 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 N A ALA 127 ? ? CA A ALA 127 ? ? CB A ALA 127 ? ? 118.83 110.10 8.73 1.40 N 2 3 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 123.48 120.30 3.18 0.50 N 3 5 NE A ARG 20 ? ? CZ A ARG 20 ? ? NH1 A ARG 20 ? ? 123.34 120.30 3.04 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 2 ? ? -85.23 -86.58 2 1 ASN A 13 ? ? 110.83 61.41 3 1 ALA A 22 ? ? 100.17 67.47 4 1 ARG A 32 ? ? -22.61 -49.76 5 1 ASN A 33 ? ? -155.94 48.54 6 1 ASP A 43 ? ? -100.29 -112.83 7 1 LYS A 67 ? ? 55.34 -126.15 8 1 THR A 73 ? ? -68.77 -71.20 9 1 ASN A 96 ? ? -145.85 52.70 10 1 TYR A 97 ? ? -171.01 71.11 11 1 LEU A 126 ? ? -155.94 51.29 12 2 ALA A 22 ? ? 92.05 59.91 13 2 PRO A 24 ? ? -61.07 -76.37 14 2 SER A 25 ? ? -161.60 -59.39 15 2 ASP A 43 ? ? -141.39 -138.72 16 2 GLN A 45 ? ? 38.83 34.84 17 2 THR A 73 ? ? -130.75 -62.68 18 2 ILE A 74 ? ? 173.82 -46.57 19 2 LYS A 78 ? ? -167.15 108.15 20 2 ASN A 93 ? ? -153.05 66.63 21 2 ASP A 105 ? ? 52.73 -88.74 22 3 THR A 3 ? ? 39.63 68.42 23 3 SER A 10 ? ? -176.14 71.95 24 3 ALA A 22 ? ? 108.87 -92.86 25 3 LEU A 23 ? ? 59.32 156.73 26 3 ASN A 33 ? ? 82.16 -51.85 27 3 SER A 58 ? ? -170.11 93.78 28 3 THR A 73 ? ? 56.98 -175.26 29 3 ILE A 74 ? ? 65.14 -78.51 30 3 GLU A 86 ? ? -154.72 55.79 31 3 TYR A 97 ? ? -176.06 62.82 32 3 ASP A 105 ? ? 37.04 47.19 33 3 VAL A 114 ? ? -147.00 51.40 34 4 THR A 3 ? ? 46.02 73.02 35 4 ALA A 22 ? ? 76.06 57.31 36 4 PRO A 54 ? ? -36.44 89.35 37 4 HIS A 57 ? ? -104.73 79.72 38 4 GLU A 68 ? ? 121.20 84.50 39 4 ILE A 74 ? ? 44.92 87.69 40 4 THR A 82 ? ? -67.19 81.90 41 4 ASN A 96 ? ? -147.39 54.98 42 4 TYR A 97 ? ? 167.08 67.15 43 4 VAL A 114 ? ? -148.02 56.98 44 5 PHE A 2 ? ? 74.61 -72.03 45 5 THR A 3 ? ? -35.26 132.46 46 5 GLU A 11 ? ? -175.96 138.85 47 5 LYS A 12 ? ? -140.33 51.01 48 5 ASN A 13 ? ? -152.34 35.68 49 5 ILE A 59 ? ? -115.46 64.39 50 5 LYS A 77 ? ? 54.08 155.11 51 5 ARG A 121 ? ? -165.26 96.51 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 14 ? ? 0.071 'SIDE CHAIN' 2 1 TYR A 119 ? ? 0.116 'SIDE CHAIN' 3 2 TYR A 53 ? ? 0.106 'SIDE CHAIN' 4 3 TYR A 14 ? ? 0.124 'SIDE CHAIN' 5 4 TYR A 14 ? ? 0.102 'SIDE CHAIN' #