data_1EK8 # _entry.id 1EK8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.385 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1EK8 pdb_00001ek8 10.2210/pdb1ek8/pdb RCSB RCSB010666 ? ? WWPDB D_1000010666 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-03-07 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2024-02-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 19 4 'Structure model' '_pdbx_struct_conn_angle.value' 20 4 'Structure model' '_struct_conn.pdbx_dist_value' 21 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 4 'Structure model' '_struct_conn.ptnr1_symmetry' 28 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 34 4 'Structure model' '_struct_conn.ptnr2_symmetry' 35 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 36 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 37 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EK8 _pdbx_database_status.recvd_initial_deposition_date 2000-03-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Min, K.' 1 'Suh, S.W.' 2 'Kim, K.K.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal structure of the ribosome recycling factor from Escherichia coli.' 'EMBO J.' 19 2362 2370 2000 EMJODG UK 0261-4189 0897 ? 10811627 10.1093/emboj/19.10.2362 1 'Crystallization and Preliminary Crystallographic Studies of Ribosome Recycling Factor from Escherichia coli.' 'Acta Crystallogr.,Sect.D' 56 84 85 2000 ABCRE6 DK 0907-4449 0766 ? ? 10.1107/S0907444999013906 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, K.K.' 1 ? primary 'Min, K.' 2 ? primary 'Suh, S.W.' 3 ? 1 'Yun, J.' 4 ? 1 'Kim, W.' 5 ? 1 'Ha, S.C.' 6 ? 1 'Eom, S.H.' 7 ? 1 'Suh, S.W.' 8 ? 1 'Kim, K.K.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RIBOSOME RECYCLING FACTOR' 20671.621 1 ? ? ? ? 2 non-polymer syn 'MERCURY (II) ION' 200.590 3 ? ? ? ? 3 non-polymer syn DECYLOXY-METHANOL 188.307 1 ? ? ? ? 4 water nat water 18.015 230 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RIBOSOME RELEASING FACTOR, RRF' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEK AIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDV QKLTDAAIKKIEAALADKEAELMQF ; _entity_poly.pdbx_seq_one_letter_code_can ;MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEK AIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDV QKLTDAAIKKIEAALADKEAELMQF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MERCURY (II) ION' HG 3 DECYLOXY-METHANOL DEM 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 SER n 1 4 ASP n 1 5 ILE n 1 6 ARG n 1 7 LYS n 1 8 ASP n 1 9 ALA n 1 10 GLU n 1 11 VAL n 1 12 ARG n 1 13 MET n 1 14 ASP n 1 15 LYS n 1 16 CYS n 1 17 VAL n 1 18 GLU n 1 19 ALA n 1 20 PHE n 1 21 LYS n 1 22 THR n 1 23 GLN n 1 24 ILE n 1 25 SER n 1 26 LYS n 1 27 ILE n 1 28 ARG n 1 29 THR n 1 30 GLY n 1 31 ARG n 1 32 ALA n 1 33 SER n 1 34 PRO n 1 35 SER n 1 36 LEU n 1 37 LEU n 1 38 ASP n 1 39 GLY n 1 40 ILE n 1 41 VAL n 1 42 VAL n 1 43 GLU n 1 44 TYR n 1 45 TYR n 1 46 GLY n 1 47 THR n 1 48 PRO n 1 49 THR n 1 50 PRO n 1 51 LEU n 1 52 ARG n 1 53 GLN n 1 54 LEU n 1 55 ALA n 1 56 SER n 1 57 VAL n 1 58 THR n 1 59 VAL n 1 60 GLU n 1 61 ASP n 1 62 SER n 1 63 ARG n 1 64 THR n 1 65 LEU n 1 66 LYS n 1 67 ILE n 1 68 ASN n 1 69 VAL n 1 70 PHE n 1 71 ASP n 1 72 ARG n 1 73 SER n 1 74 MET n 1 75 SER n 1 76 PRO n 1 77 ALA n 1 78 VAL n 1 79 GLU n 1 80 LYS n 1 81 ALA n 1 82 ILE n 1 83 MET n 1 84 ALA n 1 85 SER n 1 86 ASP n 1 87 LEU n 1 88 GLY n 1 89 LEU n 1 90 ASN n 1 91 PRO n 1 92 ASN n 1 93 SER n 1 94 ALA n 1 95 GLY n 1 96 SER n 1 97 ASP n 1 98 ILE n 1 99 ARG n 1 100 VAL n 1 101 PRO n 1 102 LEU n 1 103 PRO n 1 104 PRO n 1 105 LEU n 1 106 THR n 1 107 GLU n 1 108 GLU n 1 109 ARG n 1 110 ARG n 1 111 LYS n 1 112 ASP n 1 113 LEU n 1 114 THR n 1 115 LYS n 1 116 ILE n 1 117 VAL n 1 118 ARG n 1 119 GLY n 1 120 GLU n 1 121 ALA n 1 122 GLU n 1 123 GLN n 1 124 ALA n 1 125 ARG n 1 126 VAL n 1 127 ALA n 1 128 VAL n 1 129 ARG n 1 130 ASN n 1 131 VAL n 1 132 ARG n 1 133 ARG n 1 134 ASP n 1 135 ALA n 1 136 ASN n 1 137 ASP n 1 138 LYS n 1 139 VAL n 1 140 LYS n 1 141 ALA n 1 142 LEU n 1 143 LEU n 1 144 LYS n 1 145 ASP n 1 146 LYS n 1 147 GLU n 1 148 ILE n 1 149 SER n 1 150 GLU n 1 151 ASP n 1 152 ASP n 1 153 ASP n 1 154 ARG n 1 155 ARG n 1 156 SER n 1 157 GLN n 1 158 ASP n 1 159 ASP n 1 160 VAL n 1 161 GLN n 1 162 LYS n 1 163 LEU n 1 164 THR n 1 165 ASP n 1 166 ALA n 1 167 ALA n 1 168 ILE n 1 169 LYS n 1 170 LYS n 1 171 ILE n 1 172 GLU n 1 173 ALA n 1 174 ALA n 1 175 LEU n 1 176 ALA n 1 177 ASP n 1 178 LYS n 1 179 GLU n 1 180 ALA n 1 181 GLU n 1 182 LEU n 1 183 MET n 1 184 GLN n 1 185 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET22B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DEM non-polymer . DECYLOXY-METHANOL ? 'C11 H24 O2' 188.307 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HG non-polymer . 'MERCURY (II) ION' ? 'Hg 2' 200.590 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 ARG 110 110 110 ARG ARG A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ASN 136 136 136 ASN ASN A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 THR 164 164 164 THR THR A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 ALA 174 174 174 ALA ALA A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 ALA 176 176 176 ALA ALA A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 PHE 185 185 185 PHE ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HG 1 801 901 HG HG2 A . C 2 HG 1 802 802 HG HG2 A . D 2 HG 1 803 803 HG HG2 A . E 3 DEM 1 901 901 DEM DMA A . F 4 HOH 1 302 302 HOH HOH A . F 4 HOH 2 303 303 HOH HOH A . F 4 HOH 3 304 304 HOH HOH A . F 4 HOH 4 305 305 HOH HOH A . F 4 HOH 5 307 307 HOH HOH A . F 4 HOH 6 309 309 HOH HOH A . F 4 HOH 7 310 310 HOH HOH A . F 4 HOH 8 311 311 HOH HOH A . F 4 HOH 9 312 312 HOH HOH A . F 4 HOH 10 314 314 HOH HOH A . F 4 HOH 11 315 315 HOH HOH A . F 4 HOH 12 316 316 HOH HOH A . F 4 HOH 13 317 317 HOH HOH A . F 4 HOH 14 318 318 HOH HOH A . F 4 HOH 15 320 320 HOH HOH A . F 4 HOH 16 321 321 HOH HOH A . F 4 HOH 17 322 322 HOH HOH A . F 4 HOH 18 323 323 HOH HOH A . F 4 HOH 19 324 324 HOH HOH A . F 4 HOH 20 325 325 HOH HOH A . F 4 HOH 21 327 327 HOH HOH A . F 4 HOH 22 328 328 HOH HOH A . F 4 HOH 23 329 329 HOH HOH A . F 4 HOH 24 330 330 HOH HOH A . F 4 HOH 25 331 331 HOH HOH A . F 4 HOH 26 332 332 HOH HOH A . F 4 HOH 27 333 333 HOH HOH A . F 4 HOH 28 334 334 HOH HOH A . F 4 HOH 29 335 335 HOH HOH A . F 4 HOH 30 336 336 HOH HOH A . F 4 HOH 31 337 337 HOH HOH A . F 4 HOH 32 338 338 HOH HOH A . F 4 HOH 33 339 339 HOH HOH A . F 4 HOH 34 340 340 HOH HOH A . F 4 HOH 35 341 341 HOH HOH A . F 4 HOH 36 342 342 HOH HOH A . F 4 HOH 37 343 343 HOH HOH A . F 4 HOH 38 344 344 HOH HOH A . F 4 HOH 39 346 346 HOH HOH A . F 4 HOH 40 347 347 HOH HOH A . F 4 HOH 41 348 348 HOH HOH A . F 4 HOH 42 349 349 HOH HOH A . F 4 HOH 43 350 350 HOH HOH A . F 4 HOH 44 351 351 HOH HOH A . F 4 HOH 45 352 352 HOH HOH A . F 4 HOH 46 353 353 HOH HOH A . F 4 HOH 47 354 354 HOH HOH A . F 4 HOH 48 355 355 HOH HOH A . F 4 HOH 49 356 356 HOH HOH A . F 4 HOH 50 357 357 HOH HOH A . F 4 HOH 51 358 358 HOH HOH A . F 4 HOH 52 359 359 HOH HOH A . F 4 HOH 53 360 360 HOH HOH A . F 4 HOH 54 361 361 HOH HOH A . F 4 HOH 55 362 362 HOH HOH A . F 4 HOH 56 363 363 HOH HOH A . F 4 HOH 57 364 364 HOH HOH A . F 4 HOH 58 365 365 HOH HOH A . F 4 HOH 59 366 366 HOH HOH A . F 4 HOH 60 367 367 HOH HOH A . F 4 HOH 61 368 368 HOH HOH A . F 4 HOH 62 369 369 HOH HOH A . F 4 HOH 63 370 370 HOH HOH A . F 4 HOH 64 371 371 HOH HOH A . F 4 HOH 65 373 373 HOH HOH A . F 4 HOH 66 374 374 HOH HOH A . F 4 HOH 67 375 375 HOH HOH A . F 4 HOH 68 376 376 HOH HOH A . F 4 HOH 69 377 377 HOH HOH A . F 4 HOH 70 378 378 HOH HOH A . F 4 HOH 71 380 380 HOH HOH A . F 4 HOH 72 381 381 HOH HOH A . F 4 HOH 73 382 382 HOH HOH A . F 4 HOH 74 383 383 HOH HOH A . F 4 HOH 75 400 400 HOH HOH A . F 4 HOH 76 402 402 HOH HOH A . F 4 HOH 77 403 403 HOH HOH A . F 4 HOH 78 405 405 HOH HOH A . F 4 HOH 79 406 406 HOH HOH A . F 4 HOH 80 407 407 HOH HOH A . F 4 HOH 81 408 408 HOH HOH A . F 4 HOH 82 409 409 HOH HOH A . F 4 HOH 83 410 410 HOH HOH A . F 4 HOH 84 411 411 HOH HOH A . F 4 HOH 85 412 412 HOH HOH A . F 4 HOH 86 413 413 HOH HOH A . F 4 HOH 87 415 415 HOH HOH A . F 4 HOH 88 416 416 HOH HOH A . F 4 HOH 89 417 417 HOH HOH A . F 4 HOH 90 418 418 HOH HOH A . F 4 HOH 91 419 419 HOH HOH A . F 4 HOH 92 420 420 HOH HOH A . F 4 HOH 93 421 421 HOH HOH A . F 4 HOH 94 422 422 HOH HOH A . F 4 HOH 95 423 423 HOH HOH A . F 4 HOH 96 424 424 HOH HOH A . F 4 HOH 97 425 425 HOH HOH A . F 4 HOH 98 426 426 HOH HOH A . F 4 HOH 99 427 427 HOH HOH A . F 4 HOH 100 428 428 HOH HOH A . F 4 HOH 101 429 429 HOH HOH A . F 4 HOH 102 430 430 HOH HOH A . F 4 HOH 103 431 431 HOH HOH A . F 4 HOH 104 432 432 HOH HOH A . F 4 HOH 105 433 433 HOH HOH A . F 4 HOH 106 434 434 HOH HOH A . F 4 HOH 107 435 435 HOH HOH A . F 4 HOH 108 436 436 HOH HOH A . F 4 HOH 109 437 437 HOH HOH A . F 4 HOH 110 438 438 HOH HOH A . F 4 HOH 111 439 439 HOH HOH A . F 4 HOH 112 440 440 HOH HOH A . F 4 HOH 113 441 441 HOH HOH A . F 4 HOH 114 442 442 HOH HOH A . F 4 HOH 115 443 443 HOH HOH A . F 4 HOH 116 444 444 HOH HOH A . F 4 HOH 117 445 445 HOH HOH A . F 4 HOH 118 446 446 HOH HOH A . F 4 HOH 119 447 447 HOH HOH A . F 4 HOH 120 448 448 HOH HOH A . F 4 HOH 121 449 449 HOH HOH A . F 4 HOH 122 450 450 HOH HOH A . F 4 HOH 123 451 451 HOH HOH A . F 4 HOH 124 452 452 HOH HOH A . F 4 HOH 125 453 453 HOH HOH A . F 4 HOH 126 454 454 HOH HOH A . F 4 HOH 127 455 455 HOH HOH A . F 4 HOH 128 456 456 HOH HOH A . F 4 HOH 129 457 457 HOH HOH A . F 4 HOH 130 458 458 HOH HOH A . F 4 HOH 131 459 459 HOH HOH A . F 4 HOH 132 460 460 HOH HOH A . F 4 HOH 133 461 461 HOH HOH A . F 4 HOH 134 462 462 HOH HOH A . F 4 HOH 135 463 463 HOH HOH A . F 4 HOH 136 464 464 HOH HOH A . F 4 HOH 137 465 465 HOH HOH A . F 4 HOH 138 466 466 HOH HOH A . F 4 HOH 139 467 467 HOH HOH A . F 4 HOH 140 468 468 HOH HOH A . F 4 HOH 141 469 469 HOH HOH A . F 4 HOH 142 470 470 HOH HOH A . F 4 HOH 143 471 471 HOH HOH A . F 4 HOH 144 472 472 HOH HOH A . F 4 HOH 145 473 473 HOH HOH A . F 4 HOH 146 474 474 HOH HOH A . F 4 HOH 147 476 476 HOH HOH A . F 4 HOH 148 477 477 HOH HOH A . F 4 HOH 149 478 478 HOH HOH A . F 4 HOH 150 479 479 HOH HOH A . F 4 HOH 151 480 480 HOH HOH A . F 4 HOH 152 481 481 HOH HOH A . F 4 HOH 153 482 482 HOH HOH A . F 4 HOH 154 483 483 HOH HOH A . F 4 HOH 155 484 484 HOH HOH A . F 4 HOH 156 485 485 HOH HOH A . F 4 HOH 157 486 486 HOH HOH A . F 4 HOH 158 487 487 HOH HOH A . F 4 HOH 159 488 488 HOH HOH A . F 4 HOH 160 489 489 HOH HOH A . F 4 HOH 161 490 490 HOH HOH A . F 4 HOH 162 491 491 HOH HOH A . F 4 HOH 163 492 492 HOH HOH A . F 4 HOH 164 493 493 HOH HOH A . F 4 HOH 165 494 494 HOH HOH A . F 4 HOH 166 495 495 HOH HOH A . F 4 HOH 167 496 496 HOH HOH A . F 4 HOH 168 497 497 HOH HOH A . F 4 HOH 169 498 498 HOH HOH A . F 4 HOH 170 499 499 HOH HOH A . F 4 HOH 171 500 500 HOH HOH A . F 4 HOH 172 501 501 HOH HOH A . F 4 HOH 173 502 502 HOH HOH A . F 4 HOH 174 503 503 HOH HOH A . F 4 HOH 175 504 504 HOH HOH A . F 4 HOH 176 505 505 HOH HOH A . F 4 HOH 177 506 506 HOH HOH A . F 4 HOH 178 507 507 HOH HOH A . F 4 HOH 179 508 508 HOH HOH A . F 4 HOH 180 509 509 HOH HOH A . F 4 HOH 181 510 510 HOH HOH A . F 4 HOH 182 511 511 HOH HOH A . F 4 HOH 183 512 512 HOH HOH A . F 4 HOH 184 513 513 HOH HOH A . F 4 HOH 185 514 514 HOH HOH A . F 4 HOH 186 600 600 HOH HOH A . F 4 HOH 187 602 602 HOH HOH A . F 4 HOH 188 603 603 HOH HOH A . F 4 HOH 189 604 604 HOH HOH A . F 4 HOH 190 605 605 HOH HOH A . F 4 HOH 191 606 606 HOH HOH A . F 4 HOH 192 607 607 HOH HOH A . F 4 HOH 193 608 608 HOH HOH A . F 4 HOH 194 609 609 HOH HOH A . F 4 HOH 195 610 610 HOH HOH A . F 4 HOH 196 611 611 HOH HOH A . F 4 HOH 197 612 612 HOH HOH A . F 4 HOH 198 613 613 HOH HOH A . F 4 HOH 199 614 614 HOH HOH A . F 4 HOH 200 615 615 HOH HOH A . F 4 HOH 201 616 616 HOH HOH A . F 4 HOH 202 617 617 HOH HOH A . F 4 HOH 203 618 618 HOH HOH A . F 4 HOH 204 619 619 HOH HOH A . F 4 HOH 205 620 620 HOH HOH A . F 4 HOH 206 621 621 HOH HOH A . F 4 HOH 207 622 622 HOH HOH A . F 4 HOH 208 623 623 HOH HOH A . F 4 HOH 209 624 624 HOH HOH A . F 4 HOH 210 625 625 HOH HOH A . F 4 HOH 211 626 626 HOH HOH A . F 4 HOH 212 627 627 HOH HOH A . F 4 HOH 213 628 628 HOH HOH A . F 4 HOH 214 629 629 HOH HOH A . F 4 HOH 215 630 630 HOH HOH A . F 4 HOH 216 631 631 HOH HOH A . F 4 HOH 217 632 632 HOH HOH A . F 4 HOH 218 633 633 HOH HOH A . F 4 HOH 219 634 634 HOH HOH A . F 4 HOH 220 635 635 HOH HOH A . F 4 HOH 221 636 636 HOH HOH A . F 4 HOH 222 637 637 HOH HOH A . F 4 HOH 223 638 638 HOH HOH A . F 4 HOH 224 639 639 HOH HOH A . F 4 HOH 225 640 640 HOH HOH A . F 4 HOH 226 641 641 HOH HOH A . F 4 HOH 227 642 642 HOH HOH A . F 4 HOH 228 643 643 HOH HOH A . F 4 HOH 229 644 644 HOH HOH A . F 4 HOH 230 645 645 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PHE 185 ? CG ? A PHE 185 CG 2 1 Y 1 A PHE 185 ? CD1 ? A PHE 185 CD1 3 1 Y 1 A PHE 185 ? CD2 ? A PHE 185 CD2 4 1 Y 1 A PHE 185 ? CE1 ? A PHE 185 CE1 5 1 Y 1 A PHE 185 ? CE2 ? A PHE 185 CE2 6 1 Y 1 A PHE 185 ? CZ ? A PHE 185 CZ # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHARP phasing . ? 1 CNS refinement . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # _cell.entry_id 1EK8 _cell.length_a 48.064 _cell.length_b 48.064 _cell.length_c 142.273 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EK8 _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # _exptl.entry_id 1EK8 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 46.38 _exptl_crystal.density_Matthews 2.29 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.temp 287 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '0.1 M MES-NaOH, 10 % PEG 350 MME, 12 % PEG 400, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 287K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 1999-02-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0074 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 5.0.2' _diffrn_source.pdbx_wavelength 1.0074 _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 5.0.2 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1EK8 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 2.3 _reflns.number_obs 8691 _reflns.number_all 29485 _reflns.percent_possible_obs 96.2 _reflns.pdbx_Rmerge_I_obs 0.0480000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 11.0 _reflns.B_iso_Wilson_estimate 49.8 _reflns.pdbx_redundancy 3.34 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 97.7 _reflns_shell.Rmerge_I_obs 0.2300000 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 3.4 _reflns_shell.number_unique_all 858 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1EK8 _refine.ls_number_reflns_obs 8391 _refine.ls_number_reflns_all 9017 _refine.pdbx_ls_sigma_I 1.0 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 2.3 _refine.ls_percent_reflns_obs 93.1 _refine.ls_R_factor_obs 0.2350000 _refine.ls_R_factor_all 0.2370000 _refine.ls_R_factor_R_work 0.2280000 _refine.ls_R_factor_R_free 0.2970000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 885 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1437 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 16 _refine_hist.number_atoms_solvent 230 _refine_hist.number_atoms_total 1683 _refine_hist.d_res_high 2.3 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_angle_deg 0.010377 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d 1.63437 ? ? ? 'X-RAY DIFFRACTION' ? # _database_PDB_matrix.entry_id 1EK8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1EK8 _struct.title 'CRYSTAL STRUCTURE OF THE RIBOSOME RECYCLING FACTOR (RRF) FROM ESCHERICHIA COLI' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EK8 _struct_keywords.pdbx_keywords TRANSLATION _struct_keywords.text 'ribosome, translation factor, t-RNA mimicry, coiled coil, TRANSLATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_code RRF_ECOLI _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0A805 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EK8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 185 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A805 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 185 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 185 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 1 ? LYS A 26 ? MET A 1 LYS A 26 1 ? 26 HELX_P HELX_P2 2 ASP A 71 ? SER A 73 ? ASP A 71 SER A 73 5 ? 3 HELX_P HELX_P3 3 MET A 74 ? SER A 85 ? MET A 74 SER A 85 1 ? 12 HELX_P HELX_P4 4 THR A 106 ? LYS A 146 ? THR A 106 LYS A 146 1 ? 41 HELX_P HELX_P5 5 SER A 149 ? MET A 183 ? SER A 149 MET A 183 1 ? 35 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ARG 12 O ? ? ? 3_554 B HG . HG ? ? A ARG 12 A HG 801 1_555 ? ? ? ? ? ? ? 3.185 ? ? metalc2 metalc ? ? A CYS 16 SG ? ? ? 3_554 B HG . HG ? ? A CYS 16 A HG 801 1_555 ? ? ? ? ? ? ? 3.395 ? ? metalc3 metalc ? ? A CYS 16 O ? ? ? 1_555 D HG . HG ? ? A CYS 16 A HG 803 1_555 ? ? ? ? ? ? ? 3.286 ? ? metalc4 metalc ? ? A GLN 53 O ? ? ? 1_555 B HG . HG ? ? A GLN 53 A HG 801 1_555 ? ? ? ? ? ? ? 3.034 ? ? metalc5 metalc ? ? A LEU 54 O ? ? ? 1_555 C HG . HG ? ? A LEU 54 A HG 802 1_555 ? ? ? ? ? ? ? 2.974 ? ? metalc6 metalc ? ? A ASP 71 N ? ? ? 1_555 C HG . HG ? ? A ASP 71 A HG 802 1_555 ? ? ? ? ? ? ? 3.245 ? ? metalc7 metalc ? ? A GLN 123 NE2 ? ? ? 1_555 D HG . HG ? ? A GLN 123 A HG 803 1_555 ? ? ? ? ? ? ? 3.138 ? ? metalc8 metalc ? ? A GLN 123 OE1 ? ? ? 1_555 D HG . HG ? ? A GLN 123 A HG 803 1_555 ? ? ? ? ? ? ? 3.381 ? ? metalc9 metalc ? ? F HOH . O ? ? ? 1_555 B HG . HG ? ? A HOH 405 A HG 801 1_555 ? ? ? ? ? ? ? 3.250 ? ? metalc10 metalc ? ? F HOH . O ? ? ? 1_555 C HG . HG ? ? A HOH 405 A HG 802 1_555 ? ? ? ? ? ? ? 3.321 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ARG 12 ? A ARG 12 ? 3_554 HG ? B HG . ? A HG 801 ? 1_555 SG ? A CYS 16 ? A CYS 16 ? 3_554 64.3 ? 2 O ? A ARG 12 ? A ARG 12 ? 3_554 HG ? B HG . ? A HG 801 ? 1_555 O ? A GLN 53 ? A GLN 53 ? 1_555 100.1 ? 3 SG ? A CYS 16 ? A CYS 16 ? 3_554 HG ? B HG . ? A HG 801 ? 1_555 O ? A GLN 53 ? A GLN 53 ? 1_555 157.5 ? 4 O ? A ARG 12 ? A ARG 12 ? 3_554 HG ? B HG . ? A HG 801 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 118.3 ? 5 SG ? A CYS 16 ? A CYS 16 ? 3_554 HG ? B HG . ? A HG 801 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 55.6 ? 6 O ? A GLN 53 ? A GLN 53 ? 1_555 HG ? B HG . ? A HG 801 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 141.5 ? 7 O ? A CYS 16 ? A CYS 16 ? 1_555 HG ? D HG . ? A HG 803 ? 1_555 NE2 ? A GLN 123 ? A GLN 123 ? 1_555 159.5 ? 8 O ? A CYS 16 ? A CYS 16 ? 1_555 HG ? D HG . ? A HG 803 ? 1_555 OE1 ? A GLN 123 ? A GLN 123 ? 1_555 136.7 ? 9 NE2 ? A GLN 123 ? A GLN 123 ? 1_555 HG ? D HG . ? A HG 803 ? 1_555 OE1 ? A GLN 123 ? A GLN 123 ? 1_555 40.1 ? 10 O ? A LEU 54 ? A LEU 54 ? 1_555 HG ? C HG . ? A HG 802 ? 1_555 N ? A ASP 71 ? A ASP 71 ? 1_555 105.0 ? 11 O ? A LEU 54 ? A LEU 54 ? 1_555 HG ? C HG . ? A HG 802 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 128.0 ? 12 N ? A ASP 71 ? A ASP 71 ? 1_555 HG ? C HG . ? A HG 802 ? 1_555 O ? F HOH . ? A HOH 405 ? 1_555 81.4 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 41 ? TYR A 44 ? VAL A 41 TYR A 44 A 2 THR A 47 ? PRO A 50 ? THR A 47 PRO A 50 B 1 ALA A 55 ? ASP A 61 ? ALA A 55 ASP A 61 B 2 THR A 64 ? VAL A 69 ? THR A 64 VAL A 69 B 3 ASP A 97 ? PRO A 101 ? ASP A 97 PRO A 101 B 4 ASN A 92 ? ALA A 94 ? ASN A 92 ALA A 94 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 44 ? N TYR A 44 O THR A 47 ? O THR A 47 B 1 2 O ASP A 61 ? O ASP A 61 N THR A 64 ? N THR A 64 B 2 3 N ILE A 67 ? N ILE A 67 O ILE A 98 ? O ILE A 98 B 3 4 O ARG A 99 ? O ARG A 99 N ASN A 92 ? N ASN A 92 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A HG 801 ? 3 'BINDING SITE FOR RESIDUE HG A 801' AC2 Software A HG 802 ? 2 'BINDING SITE FOR RESIDUE HG A 802' AC3 Software A HG 803 ? 2 'BINDING SITE FOR RESIDUE HG A 803' AC4 Software A DEM 901 ? 5 'BINDING SITE FOR RESIDUE DEM A 901' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ARG A 12 ? ARG A 12 . ? 3_554 ? 2 AC1 3 CYS A 16 ? CYS A 16 . ? 3_554 ? 3 AC1 3 GLN A 53 ? GLN A 53 . ? 1_555 ? 4 AC2 2 LEU A 54 ? LEU A 54 . ? 1_555 ? 5 AC2 2 ASP A 71 ? ASP A 71 . ? 1_555 ? 6 AC3 2 CYS A 16 ? CYS A 16 . ? 1_555 ? 7 AC3 2 GLN A 123 ? GLN A 123 . ? 1_555 ? 8 AC4 5 ARG A 31 ? ARG A 31 . ? 1_555 ? 9 AC4 5 LEU A 36 ? LEU A 36 . ? 1_555 ? 10 AC4 5 ASP A 86 ? ASP A 86 . ? 6_555 ? 11 AC4 5 LEU A 87 ? LEU A 87 . ? 6_555 ? 12 AC4 5 PRO A 103 ? PRO A 103 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 343 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 495 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.15 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 610 ? ? 1_555 O A HOH 610 ? ? 4_556 1.58 2 1 O A HOH 464 ? ? 1_555 O A HOH 493 ? ? 2_555 2.16 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLU _pdbx_validate_rmsd_angle.auth_seq_id_1 147 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLU _pdbx_validate_rmsd_angle.auth_seq_id_2 147 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLU _pdbx_validate_rmsd_angle.auth_seq_id_3 147 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 130.52 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation 19.52 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 5 ? ? -27.57 -58.47 2 1 SER A 62 ? ? -39.66 -29.09 3 1 ALA A 94 ? ? -174.13 113.91 4 1 SER A 96 ? ? 50.55 -9.42 5 1 GLU A 147 ? ? -33.20 -17.07 6 1 GLN A 184 ? ? -59.47 -75.05 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 DEM CM C N N 88 DEM C1 C N N 89 DEM C2 C N N 90 DEM C3 C N N 91 DEM C4 C N N 92 DEM C5 C N N 93 DEM C6 C N N 94 DEM C7 C N N 95 DEM C8 C N N 96 DEM C9 C N N 97 DEM C10 C N N 98 DEM O1 O N N 99 DEM O5 O N N 100 DEM HCM1 H N N 101 DEM HCM2 H N N 102 DEM HC11 H N N 103 DEM HC12 H N N 104 DEM HC21 H N N 105 DEM HC22 H N N 106 DEM HC31 H N N 107 DEM HC32 H N N 108 DEM HC41 H N N 109 DEM HC42 H N N 110 DEM HC51 H N N 111 DEM HC52 H N N 112 DEM HC61 H N N 113 DEM HC62 H N N 114 DEM HC71 H N N 115 DEM HC72 H N N 116 DEM HC81 H N N 117 DEM HC82 H N N 118 DEM HC91 H N N 119 DEM HC92 H N N 120 DEM H101 H N N 121 DEM H102 H N N 122 DEM H103 H N N 123 DEM HO5 H N N 124 GLN N N N N 125 GLN CA C N S 126 GLN C C N N 127 GLN O O N N 128 GLN CB C N N 129 GLN CG C N N 130 GLN CD C N N 131 GLN OE1 O N N 132 GLN NE2 N N N 133 GLN OXT O N N 134 GLN H H N N 135 GLN H2 H N N 136 GLN HA H N N 137 GLN HB2 H N N 138 GLN HB3 H N N 139 GLN HG2 H N N 140 GLN HG3 H N N 141 GLN HE21 H N N 142 GLN HE22 H N N 143 GLN HXT H N N 144 GLU N N N N 145 GLU CA C N S 146 GLU C C N N 147 GLU O O N N 148 GLU CB C N N 149 GLU CG C N N 150 GLU CD C N N 151 GLU OE1 O N N 152 GLU OE2 O N N 153 GLU OXT O N N 154 GLU H H N N 155 GLU H2 H N N 156 GLU HA H N N 157 GLU HB2 H N N 158 GLU HB3 H N N 159 GLU HG2 H N N 160 GLU HG3 H N N 161 GLU HE2 H N N 162 GLU HXT H N N 163 GLY N N N N 164 GLY CA C N N 165 GLY C C N N 166 GLY O O N N 167 GLY OXT O N N 168 GLY H H N N 169 GLY H2 H N N 170 GLY HA2 H N N 171 GLY HA3 H N N 172 GLY HXT H N N 173 HG HG HG N N 174 HOH O O N N 175 HOH H1 H N N 176 HOH H2 H N N 177 ILE N N N N 178 ILE CA C N S 179 ILE C C N N 180 ILE O O N N 181 ILE CB C N S 182 ILE CG1 C N N 183 ILE CG2 C N N 184 ILE CD1 C N N 185 ILE OXT O N N 186 ILE H H N N 187 ILE H2 H N N 188 ILE HA H N N 189 ILE HB H N N 190 ILE HG12 H N N 191 ILE HG13 H N N 192 ILE HG21 H N N 193 ILE HG22 H N N 194 ILE HG23 H N N 195 ILE HD11 H N N 196 ILE HD12 H N N 197 ILE HD13 H N N 198 ILE HXT H N N 199 LEU N N N N 200 LEU CA C N S 201 LEU C C N N 202 LEU O O N N 203 LEU CB C N N 204 LEU CG C N N 205 LEU CD1 C N N 206 LEU CD2 C N N 207 LEU OXT O N N 208 LEU H H N N 209 LEU H2 H N N 210 LEU HA H N N 211 LEU HB2 H N N 212 LEU HB3 H N N 213 LEU HG H N N 214 LEU HD11 H N N 215 LEU HD12 H N N 216 LEU HD13 H N N 217 LEU HD21 H N N 218 LEU HD22 H N N 219 LEU HD23 H N N 220 LEU HXT H N N 221 LYS N N N N 222 LYS CA C N S 223 LYS C C N N 224 LYS O O N N 225 LYS CB C N N 226 LYS CG C N N 227 LYS CD C N N 228 LYS CE C N N 229 LYS NZ N N N 230 LYS OXT O N N 231 LYS H H N N 232 LYS H2 H N N 233 LYS HA H N N 234 LYS HB2 H N N 235 LYS HB3 H N N 236 LYS HG2 H N N 237 LYS HG3 H N N 238 LYS HD2 H N N 239 LYS HD3 H N N 240 LYS HE2 H N N 241 LYS HE3 H N N 242 LYS HZ1 H N N 243 LYS HZ2 H N N 244 LYS HZ3 H N N 245 LYS HXT H N N 246 MET N N N N 247 MET CA C N S 248 MET C C N N 249 MET O O N N 250 MET CB C N N 251 MET CG C N N 252 MET SD S N N 253 MET CE C N N 254 MET OXT O N N 255 MET H H N N 256 MET H2 H N N 257 MET HA H N N 258 MET HB2 H N N 259 MET HB3 H N N 260 MET HG2 H N N 261 MET HG3 H N N 262 MET HE1 H N N 263 MET HE2 H N N 264 MET HE3 H N N 265 MET HXT H N N 266 PHE N N N N 267 PHE CA C N S 268 PHE C C N N 269 PHE O O N N 270 PHE CB C N N 271 PHE CG C Y N 272 PHE CD1 C Y N 273 PHE CD2 C Y N 274 PHE CE1 C Y N 275 PHE CE2 C Y N 276 PHE CZ C Y N 277 PHE OXT O N N 278 PHE H H N N 279 PHE H2 H N N 280 PHE HA H N N 281 PHE HB2 H N N 282 PHE HB3 H N N 283 PHE HD1 H N N 284 PHE HD2 H N N 285 PHE HE1 H N N 286 PHE HE2 H N N 287 PHE HZ H N N 288 PHE HXT H N N 289 PRO N N N N 290 PRO CA C N S 291 PRO C C N N 292 PRO O O N N 293 PRO CB C N N 294 PRO CG C N N 295 PRO CD C N N 296 PRO OXT O N N 297 PRO H H N N 298 PRO HA H N N 299 PRO HB2 H N N 300 PRO HB3 H N N 301 PRO HG2 H N N 302 PRO HG3 H N N 303 PRO HD2 H N N 304 PRO HD3 H N N 305 PRO HXT H N N 306 SER N N N N 307 SER CA C N S 308 SER C C N N 309 SER O O N N 310 SER CB C N N 311 SER OG O N N 312 SER OXT O N N 313 SER H H N N 314 SER H2 H N N 315 SER HA H N N 316 SER HB2 H N N 317 SER HB3 H N N 318 SER HG H N N 319 SER HXT H N N 320 THR N N N N 321 THR CA C N S 322 THR C C N N 323 THR O O N N 324 THR CB C N R 325 THR OG1 O N N 326 THR CG2 C N N 327 THR OXT O N N 328 THR H H N N 329 THR H2 H N N 330 THR HA H N N 331 THR HB H N N 332 THR HG1 H N N 333 THR HG21 H N N 334 THR HG22 H N N 335 THR HG23 H N N 336 THR HXT H N N 337 TYR N N N N 338 TYR CA C N S 339 TYR C C N N 340 TYR O O N N 341 TYR CB C N N 342 TYR CG C Y N 343 TYR CD1 C Y N 344 TYR CD2 C Y N 345 TYR CE1 C Y N 346 TYR CE2 C Y N 347 TYR CZ C Y N 348 TYR OH O N N 349 TYR OXT O N N 350 TYR H H N N 351 TYR H2 H N N 352 TYR HA H N N 353 TYR HB2 H N N 354 TYR HB3 H N N 355 TYR HD1 H N N 356 TYR HD2 H N N 357 TYR HE1 H N N 358 TYR HE2 H N N 359 TYR HH H N N 360 TYR HXT H N N 361 VAL N N N N 362 VAL CA C N S 363 VAL C C N N 364 VAL O O N N 365 VAL CB C N N 366 VAL CG1 C N N 367 VAL CG2 C N N 368 VAL OXT O N N 369 VAL H H N N 370 VAL H2 H N N 371 VAL HA H N N 372 VAL HB H N N 373 VAL HG11 H N N 374 VAL HG12 H N N 375 VAL HG13 H N N 376 VAL HG21 H N N 377 VAL HG22 H N N 378 VAL HG23 H N N 379 VAL HXT H N N 380 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DEM CM O1 sing N N 83 DEM CM O5 sing N N 84 DEM CM HCM1 sing N N 85 DEM CM HCM2 sing N N 86 DEM C1 C2 sing N N 87 DEM C1 O1 sing N N 88 DEM C1 HC11 sing N N 89 DEM C1 HC12 sing N N 90 DEM C2 C3 sing N N 91 DEM C2 HC21 sing N N 92 DEM C2 HC22 sing N N 93 DEM C3 C4 sing N N 94 DEM C3 HC31 sing N N 95 DEM C3 HC32 sing N N 96 DEM C4 C5 sing N N 97 DEM C4 HC41 sing N N 98 DEM C4 HC42 sing N N 99 DEM C5 C6 sing N N 100 DEM C5 HC51 sing N N 101 DEM C5 HC52 sing N N 102 DEM C6 C7 sing N N 103 DEM C6 HC61 sing N N 104 DEM C6 HC62 sing N N 105 DEM C7 C8 sing N N 106 DEM C7 HC71 sing N N 107 DEM C7 HC72 sing N N 108 DEM C8 C9 sing N N 109 DEM C8 HC81 sing N N 110 DEM C8 HC82 sing N N 111 DEM C9 C10 sing N N 112 DEM C9 HC91 sing N N 113 DEM C9 HC92 sing N N 114 DEM C10 H101 sing N N 115 DEM C10 H102 sing N N 116 DEM C10 H103 sing N N 117 DEM O5 HO5 sing N N 118 GLN N CA sing N N 119 GLN N H sing N N 120 GLN N H2 sing N N 121 GLN CA C sing N N 122 GLN CA CB sing N N 123 GLN CA HA sing N N 124 GLN C O doub N N 125 GLN C OXT sing N N 126 GLN CB CG sing N N 127 GLN CB HB2 sing N N 128 GLN CB HB3 sing N N 129 GLN CG CD sing N N 130 GLN CG HG2 sing N N 131 GLN CG HG3 sing N N 132 GLN CD OE1 doub N N 133 GLN CD NE2 sing N N 134 GLN NE2 HE21 sing N N 135 GLN NE2 HE22 sing N N 136 GLN OXT HXT sing N N 137 GLU N CA sing N N 138 GLU N H sing N N 139 GLU N H2 sing N N 140 GLU CA C sing N N 141 GLU CA CB sing N N 142 GLU CA HA sing N N 143 GLU C O doub N N 144 GLU C OXT sing N N 145 GLU CB CG sing N N 146 GLU CB HB2 sing N N 147 GLU CB HB3 sing N N 148 GLU CG CD sing N N 149 GLU CG HG2 sing N N 150 GLU CG HG3 sing N N 151 GLU CD OE1 doub N N 152 GLU CD OE2 sing N N 153 GLU OE2 HE2 sing N N 154 GLU OXT HXT sing N N 155 GLY N CA sing N N 156 GLY N H sing N N 157 GLY N H2 sing N N 158 GLY CA C sing N N 159 GLY CA HA2 sing N N 160 GLY CA HA3 sing N N 161 GLY C O doub N N 162 GLY C OXT sing N N 163 GLY OXT HXT sing N N 164 HOH O H1 sing N N 165 HOH O H2 sing N N 166 ILE N CA sing N N 167 ILE N H sing N N 168 ILE N H2 sing N N 169 ILE CA C sing N N 170 ILE CA CB sing N N 171 ILE CA HA sing N N 172 ILE C O doub N N 173 ILE C OXT sing N N 174 ILE CB CG1 sing N N 175 ILE CB CG2 sing N N 176 ILE CB HB sing N N 177 ILE CG1 CD1 sing N N 178 ILE CG1 HG12 sing N N 179 ILE CG1 HG13 sing N N 180 ILE CG2 HG21 sing N N 181 ILE CG2 HG22 sing N N 182 ILE CG2 HG23 sing N N 183 ILE CD1 HD11 sing N N 184 ILE CD1 HD12 sing N N 185 ILE CD1 HD13 sing N N 186 ILE OXT HXT sing N N 187 LEU N CA sing N N 188 LEU N H sing N N 189 LEU N H2 sing N N 190 LEU CA C sing N N 191 LEU CA CB sing N N 192 LEU CA HA sing N N 193 LEU C O doub N N 194 LEU C OXT sing N N 195 LEU CB CG sing N N 196 LEU CB HB2 sing N N 197 LEU CB HB3 sing N N 198 LEU CG CD1 sing N N 199 LEU CG CD2 sing N N 200 LEU CG HG sing N N 201 LEU CD1 HD11 sing N N 202 LEU CD1 HD12 sing N N 203 LEU CD1 HD13 sing N N 204 LEU CD2 HD21 sing N N 205 LEU CD2 HD22 sing N N 206 LEU CD2 HD23 sing N N 207 LEU OXT HXT sing N N 208 LYS N CA sing N N 209 LYS N H sing N N 210 LYS N H2 sing N N 211 LYS CA C sing N N 212 LYS CA CB sing N N 213 LYS CA HA sing N N 214 LYS C O doub N N 215 LYS C OXT sing N N 216 LYS CB CG sing N N 217 LYS CB HB2 sing N N 218 LYS CB HB3 sing N N 219 LYS CG CD sing N N 220 LYS CG HG2 sing N N 221 LYS CG HG3 sing N N 222 LYS CD CE sing N N 223 LYS CD HD2 sing N N 224 LYS CD HD3 sing N N 225 LYS CE NZ sing N N 226 LYS CE HE2 sing N N 227 LYS CE HE3 sing N N 228 LYS NZ HZ1 sing N N 229 LYS NZ HZ2 sing N N 230 LYS NZ HZ3 sing N N 231 LYS OXT HXT sing N N 232 MET N CA sing N N 233 MET N H sing N N 234 MET N H2 sing N N 235 MET CA C sing N N 236 MET CA CB sing N N 237 MET CA HA sing N N 238 MET C O doub N N 239 MET C OXT sing N N 240 MET CB CG sing N N 241 MET CB HB2 sing N N 242 MET CB HB3 sing N N 243 MET CG SD sing N N 244 MET CG HG2 sing N N 245 MET CG HG3 sing N N 246 MET SD CE sing N N 247 MET CE HE1 sing N N 248 MET CE HE2 sing N N 249 MET CE HE3 sing N N 250 MET OXT HXT sing N N 251 PHE N CA sing N N 252 PHE N H sing N N 253 PHE N H2 sing N N 254 PHE CA C sing N N 255 PHE CA CB sing N N 256 PHE CA HA sing N N 257 PHE C O doub N N 258 PHE C OXT sing N N 259 PHE CB CG sing N N 260 PHE CB HB2 sing N N 261 PHE CB HB3 sing N N 262 PHE CG CD1 doub Y N 263 PHE CG CD2 sing Y N 264 PHE CD1 CE1 sing Y N 265 PHE CD1 HD1 sing N N 266 PHE CD2 CE2 doub Y N 267 PHE CD2 HD2 sing N N 268 PHE CE1 CZ doub Y N 269 PHE CE1 HE1 sing N N 270 PHE CE2 CZ sing Y N 271 PHE CE2 HE2 sing N N 272 PHE CZ HZ sing N N 273 PHE OXT HXT sing N N 274 PRO N CA sing N N 275 PRO N CD sing N N 276 PRO N H sing N N 277 PRO CA C sing N N 278 PRO CA CB sing N N 279 PRO CA HA sing N N 280 PRO C O doub N N 281 PRO C OXT sing N N 282 PRO CB CG sing N N 283 PRO CB HB2 sing N N 284 PRO CB HB3 sing N N 285 PRO CG CD sing N N 286 PRO CG HG2 sing N N 287 PRO CG HG3 sing N N 288 PRO CD HD2 sing N N 289 PRO CD HD3 sing N N 290 PRO OXT HXT sing N N 291 SER N CA sing N N 292 SER N H sing N N 293 SER N H2 sing N N 294 SER CA C sing N N 295 SER CA CB sing N N 296 SER CA HA sing N N 297 SER C O doub N N 298 SER C OXT sing N N 299 SER CB OG sing N N 300 SER CB HB2 sing N N 301 SER CB HB3 sing N N 302 SER OG HG sing N N 303 SER OXT HXT sing N N 304 THR N CA sing N N 305 THR N H sing N N 306 THR N H2 sing N N 307 THR CA C sing N N 308 THR CA CB sing N N 309 THR CA HA sing N N 310 THR C O doub N N 311 THR C OXT sing N N 312 THR CB OG1 sing N N 313 THR CB CG2 sing N N 314 THR CB HB sing N N 315 THR OG1 HG1 sing N N 316 THR CG2 HG21 sing N N 317 THR CG2 HG22 sing N N 318 THR CG2 HG23 sing N N 319 THR OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _atom_sites.entry_id 1EK8 _atom_sites.fract_transf_matrix[1][1] 0.020806 _atom_sites.fract_transf_matrix[1][2] 0.012012 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024024 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007029 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C HG N O S # loop_