data_1EQ3 # _entry.id 1EQ3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1EQ3 pdb_00001eq3 10.2210/pdb1eq3/pdb RCSB RCSB010807 ? ? WWPDB D_1000010807 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1PIN _pdbx_database_related.details '1PIN is a structural related human parvulin' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1EQ3 _pdbx_database_status.recvd_initial_deposition_date 2000-04-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sekerina, E.' 1 'Rahfeld, U.J.' 2 'Muller, J.' 3 'Fischer, G.' 4 'Bayer, P.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;NMR solution structure of hPar14 reveals similarity to the peptidyl prolyl cis/trans isomerase domain of the mitotic regulator hPin1 but indicates a different functionality of the protein. ; J.Mol.Biol. 301 1003 1017 2000 JMOBAK UK 0022-2836 0070 ? 10966801 10.1006/jmbi.2000.4013 1 'Identification and characterization of a 14kDa human protein as a novel parvulin-like peptidyl-prolyl cis/trans isomerase' 'FEBS Lett.' 446 278 282 1999 FEBLAL NE 0014-5793 0165 ? ? '10.1016/S0014-5793(99)00239-2' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sekerina, E.' 1 ? primary 'Rahfeld, J.U.' 2 ? primary 'Muller, J.' 3 ? primary 'Fanghanel, J.' 4 ? primary 'Rascher, C.' 5 ? primary 'Fischer, G.' 6 ? primary 'Bayer, P.' 7 ? 1 'Uchida, T.' 8 ? 1 'Fujimori, F.' 9 ? 1 'Tradler, T.' 10 ? 1 'Fischer, G.' 11 ? 1 'Rahfeld, J.U.' 12 ? # _cell.entry_id 1EQ3 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1EQ3 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PEPTIDYL-PROLYL CIS/TRANS ISOMERASE (PPIASE)' _entity.formula_weight 10731.549 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'PPIASE DOMAIN (RESIDUES 36-131)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPP VKTKFGYHIIMVEGRK ; _entity_poly.pdbx_seq_one_letter_code_can ;NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPP VKTKFGYHIIMVEGRK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 ALA n 1 3 VAL n 1 4 LYS n 1 5 VAL n 1 6 ARG n 1 7 HIS n 1 8 ILE n 1 9 LEU n 1 10 CYS n 1 11 GLU n 1 12 LYS n 1 13 HIS n 1 14 GLY n 1 15 LYS n 1 16 ILE n 1 17 MET n 1 18 GLU n 1 19 ALA n 1 20 MET n 1 21 GLU n 1 22 LYS n 1 23 LEU n 1 24 LYS n 1 25 SER n 1 26 GLY n 1 27 MET n 1 28 ARG n 1 29 PHE n 1 30 ASN n 1 31 GLU n 1 32 VAL n 1 33 ALA n 1 34 ALA n 1 35 GLN n 1 36 TYR n 1 37 SER n 1 38 GLU n 1 39 ASP n 1 40 LYS n 1 41 ALA n 1 42 ARG n 1 43 GLN n 1 44 GLY n 1 45 GLY n 1 46 ASP n 1 47 LEU n 1 48 GLY n 1 49 TRP n 1 50 MET n 1 51 THR n 1 52 ARG n 1 53 GLY n 1 54 SER n 1 55 MET n 1 56 VAL n 1 57 GLY n 1 58 PRO n 1 59 PHE n 1 60 GLN n 1 61 GLU n 1 62 ALA n 1 63 ALA n 1 64 PHE n 1 65 ALA n 1 66 LEU n 1 67 PRO n 1 68 VAL n 1 69 SER n 1 70 GLY n 1 71 MET n 1 72 ASP n 1 73 LYS n 1 74 PRO n 1 75 VAL n 1 76 PHE n 1 77 THR n 1 78 ASP n 1 79 PRO n 1 80 PRO n 1 81 VAL n 1 82 LYS n 1 83 THR n 1 84 LYS n 1 85 PHE n 1 86 GLY n 1 87 TYR n 1 88 HIS n 1 89 ILE n 1 90 ILE n 1 91 MET n 1 92 VAL n 1 93 GLU n 1 94 GLY n 1 95 ARG n 1 96 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ LUNG _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell 'ENDOTHELIAL CELLS' _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PQE70 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'HOMO SAPIENS' # _struct_ref.id 1 _struct_ref.db_code PIN4_HUMAN _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q9Y237 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1EQ3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 96 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y237 _struct_ref_seq.db_align_beg 36 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 36 _struct_ref_seq.pdbx_auth_seq_align_end 131 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 DQF-COSY 3 2 2 3D_13C-separated_NOESY 4 2 2 3D_15N-separated_NOESY 5 2 2 2D_15N_HSQC # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 300 ambient 6.5 ? ? K 2 300 ambient 6.5 ? ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM Parvulin; 10mM phosphate buffer;' '90% H2O, 10% D2O or 100% D2O' 2 '1mM Parvulin U15N/13C; 10mM phosphate buffer;' '90% H2O, 10% D2O or 100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1EQ3 _pdbx_nmr_refine.method 'Refinement was done using X-PLOR98 simulated annealing protocol.' _pdbx_nmr_refine.details ;Constraints used for calculation: Total number of NOEs = 1042, Intra-residual = 120, Long-range = 397, Medium-range = 167, Sequential = 358; Coupling constants = 71, Hydrogen bonds = 38. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1EQ3 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1EQ3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.5 collection Bruker 1 XwinNMR 2.5 processing Bruker 2 NDEE ? processing 'Herrmann, F.; SpinUp' 3 NDEE ? 'data analysis' 'Herrmann, F.; SpinUp' 4 AURELIA 2.5 'data analysis' 'Neidig, P; Bruker' 5 X-PLOR 98 'structure solution' 'Brunger; MSI' 6 X-PLOR 98 'data analysis' 'Brunger; MSI' 7 X-PLOR 98 refinement 'Brunger; MSI' 8 'Insight II' 98 'data analysis' MSI 9 # _exptl.entry_id 1EQ3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1EQ3 _struct.title 'NMR STRUCTURE OF HUMAN PARVULIN HPAR14' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1EQ3 _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text 'PEPTIDYL-PROLYL CIS-TRANS ISOMERASE, PARVULIN, ISOMERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 15 ? LYS A 24 ? LYS A 50 LYS A 59 1 ? 10 HELX_P HELX_P2 2 ARG A 28 ? SER A 37 ? ARG A 63 SER A 72 1 ? 10 HELX_P HELX_P3 3 GLY A 57 ? LEU A 66 ? GLY A 92 LEU A 101 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 1 -0.15 2 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 2 0.30 3 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 3 0.09 4 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 4 -0.42 5 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 5 1.31 6 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 6 -0.21 7 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 7 1.25 8 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 8 0.12 9 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 9 2.07 10 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 10 -0.45 11 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 11 0.63 12 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 12 0.69 13 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 13 -0.09 14 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 14 0.86 15 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 15 0.54 16 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 16 0.40 17 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 17 1.82 18 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 18 0.44 19 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 19 -0.04 20 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 20 0.13 21 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 21 0.28 22 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 22 -0.51 23 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 23 -0.34 24 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 24 -0.29 25 ASP 78 A . ? ASP 113 A PRO 79 A ? PRO 114 A 25 1.53 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 46 ? MET A 50 ? ASP A 81 MET A 85 A 2 VAL A 3 ? CYS A 10 ? VAL A 38 CYS A 45 A 3 GLY A 86 ? GLY A 94 ? GLY A 121 GLY A 129 A 4 VAL A 81 ? THR A 83 ? VAL A 116 THR A 118 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N MET A 50 ? N MET A 85 O VAL A 3 ? O VAL A 38 A 2 3 N CYS A 10 ? N CYS A 45 O TYR A 87 ? O TYR A 122 A 3 4 N HIS A 88 ? N HIS A 123 O VAL A 81 ? O VAL A 116 # _database_PDB_matrix.entry_id 1EQ3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1EQ3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 36 36 ASN ASN A . n A 1 2 ALA 2 37 37 ALA ALA A . n A 1 3 VAL 3 38 38 VAL VAL A . n A 1 4 LYS 4 39 39 LYS LYS A . n A 1 5 VAL 5 40 40 VAL VAL A . n A 1 6 ARG 6 41 41 ARG ARG A . n A 1 7 HIS 7 42 42 HIS HIS A . n A 1 8 ILE 8 43 43 ILE ILE A . n A 1 9 LEU 9 44 44 LEU LEU A . n A 1 10 CYS 10 45 45 CYS CYS A . n A 1 11 GLU 11 46 46 GLU GLU A . n A 1 12 LYS 12 47 47 LYS LYS A . n A 1 13 HIS 13 48 48 HIS HIS A . n A 1 14 GLY 14 49 49 GLY GLY A . n A 1 15 LYS 15 50 50 LYS LYS A . n A 1 16 ILE 16 51 51 ILE ILE A . n A 1 17 MET 17 52 52 MET MET A . n A 1 18 GLU 18 53 53 GLU GLU A . n A 1 19 ALA 19 54 54 ALA ALA A . n A 1 20 MET 20 55 55 MET MET A . n A 1 21 GLU 21 56 56 GLU GLU A . n A 1 22 LYS 22 57 57 LYS LYS A . n A 1 23 LEU 23 58 58 LEU LEU A . n A 1 24 LYS 24 59 59 LYS LYS A . n A 1 25 SER 25 60 60 SER SER A . n A 1 26 GLY 26 61 61 GLY GLY A . n A 1 27 MET 27 62 62 MET MET A . n A 1 28 ARG 28 63 63 ARG ARG A . n A 1 29 PHE 29 64 64 PHE PHE A . n A 1 30 ASN 30 65 65 ASN ASN A . n A 1 31 GLU 31 66 66 GLU GLU A . n A 1 32 VAL 32 67 67 VAL VAL A . n A 1 33 ALA 33 68 68 ALA ALA A . n A 1 34 ALA 34 69 69 ALA ALA A . n A 1 35 GLN 35 70 70 GLN GLN A . n A 1 36 TYR 36 71 71 TYR TYR A . n A 1 37 SER 37 72 72 SER SER A . n A 1 38 GLU 38 73 73 GLU GLU A . n A 1 39 ASP 39 74 74 ASP ASP A . n A 1 40 LYS 40 75 75 LYS LYS A . n A 1 41 ALA 41 76 76 ALA ALA A . n A 1 42 ARG 42 77 77 ARG ARG A . n A 1 43 GLN 43 78 78 GLN GLN A . n A 1 44 GLY 44 79 79 GLY GLY A . n A 1 45 GLY 45 80 80 GLY GLY A . n A 1 46 ASP 46 81 81 ASP ASP A . n A 1 47 LEU 47 82 82 LEU LEU A . n A 1 48 GLY 48 83 83 GLY GLY A . n A 1 49 TRP 49 84 84 TRP TRP A . n A 1 50 MET 50 85 85 MET MET A . n A 1 51 THR 51 86 86 THR THR A . n A 1 52 ARG 52 87 87 ARG ARG A . n A 1 53 GLY 53 88 88 GLY GLY A . n A 1 54 SER 54 89 89 SER SER A . n A 1 55 MET 55 90 90 MET MET A . n A 1 56 VAL 56 91 91 VAL VAL A . n A 1 57 GLY 57 92 92 GLY GLY A . n A 1 58 PRO 58 93 93 PRO PRO A . n A 1 59 PHE 59 94 94 PHE PHE A . n A 1 60 GLN 60 95 95 GLN GLN A . n A 1 61 GLU 61 96 96 GLU GLU A . n A 1 62 ALA 62 97 97 ALA ALA A . n A 1 63 ALA 63 98 98 ALA ALA A . n A 1 64 PHE 64 99 99 PHE PHE A . n A 1 65 ALA 65 100 100 ALA ALA A . n A 1 66 LEU 66 101 101 LEU LEU A . n A 1 67 PRO 67 102 102 PRO PRO A . n A 1 68 VAL 68 103 103 VAL VAL A . n A 1 69 SER 69 104 104 SER SER A . n A 1 70 GLY 70 105 105 GLY GLY A . n A 1 71 MET 71 106 106 MET MET A . n A 1 72 ASP 72 107 107 ASP ASP A . n A 1 73 LYS 73 108 108 LYS LYS A . n A 1 74 PRO 74 109 109 PRO PRO A . n A 1 75 VAL 75 110 110 VAL VAL A . n A 1 76 PHE 76 111 111 PHE PHE A . n A 1 77 THR 77 112 112 THR THR A . n A 1 78 ASP 78 113 113 ASP ASP A . n A 1 79 PRO 79 114 114 PRO PRO A . n A 1 80 PRO 80 115 115 PRO PRO A . n A 1 81 VAL 81 116 116 VAL VAL A . n A 1 82 LYS 82 117 117 LYS LYS A . n A 1 83 THR 83 118 118 THR THR A . n A 1 84 LYS 84 119 119 LYS LYS A . n A 1 85 PHE 85 120 120 PHE PHE A . n A 1 86 GLY 86 121 121 GLY GLY A . n A 1 87 TYR 87 122 122 TYR TYR A . n A 1 88 HIS 88 123 123 HIS HIS A . n A 1 89 ILE 89 124 124 ILE ILE A . n A 1 90 ILE 90 125 125 ILE ILE A . n A 1 91 MET 91 126 126 MET MET A . n A 1 92 VAL 92 127 127 VAL VAL A . n A 1 93 GLU 93 128 128 GLU GLU A . n A 1 94 GLY 94 129 129 GLY GLY A . n A 1 95 ARG 95 130 130 ARG ARG A . n A 1 96 LYS 96 131 131 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-04-04 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ARG 87 ? ? HE21 A GLN 95 ? ? 1.56 2 2 O A ASP 74 ? ? H A ARG 77 ? ? 1.59 3 2 OG1 A THR 86 ? ? H A ARG 87 ? ? 1.60 4 3 OG1 A THR 112 ? ? H A ILE 125 ? ? 1.47 5 4 O A ARG 87 ? ? HE21 A GLN 95 ? ? 1.51 6 5 OD1 A ASP 107 ? ? H A LYS 108 ? ? 1.59 7 9 O A GLU 56 ? ? HZ2 A LYS 59 ? ? 1.60 8 11 O A VAL 40 ? ? H A LEU 82 ? ? 1.58 9 11 O A GLY 61 ? ? H A PHE 64 ? ? 1.59 10 12 O A PRO 93 ? ? H A ALA 97 ? ? 1.54 11 13 O A ARG 87 ? ? HE21 A GLN 95 ? ? 1.51 12 13 O A VAL 40 ? ? H A LEU 82 ? ? 1.57 13 13 OD1 A ASN 65 ? ? H A GLU 66 ? ? 1.59 14 14 OG A SER 104 ? ? H A VAL 110 ? ? 1.57 15 15 O A ARG 87 ? ? HE22 A GLN 95 ? ? 1.45 16 15 O A PRO 93 ? ? H A ALA 97 ? ? 1.55 17 15 O A ARG 77 ? ? HE21 A GLN 78 ? ? 1.56 18 17 HG1 A THR 118 ? ? O A GLY 121 ? ? 1.58 19 21 OD1 A ASP 81 ? ? H A GLY 83 ? ? 1.58 20 25 OG1 A THR 86 ? ? H A ARG 87 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 59 ? ? 39.46 -92.63 2 1 SER A 60 ? ? -129.48 -158.03 3 1 ARG A 87 ? ? -107.55 -62.58 4 1 VAL A 91 ? ? -154.03 -88.32 5 1 VAL A 110 ? ? -133.28 -77.24 6 1 PRO A 115 ? ? -69.38 -179.44 7 2 GLU A 46 ? ? -55.23 -157.95 8 2 LYS A 59 ? ? 52.20 -133.62 9 2 LYS A 75 ? ? -38.32 -35.62 10 2 GLN A 78 ? ? 62.61 -77.78 11 2 THR A 86 ? ? -72.14 -92.99 12 2 MET A 90 ? ? -141.65 -86.39 13 2 ASP A 107 ? ? -144.23 -86.94 14 2 THR A 112 ? ? -48.87 95.36 15 2 ARG A 130 ? ? -132.41 -85.55 16 3 LYS A 59 ? ? -42.55 161.09 17 3 ASP A 74 ? ? -102.07 72.10 18 3 GLN A 78 ? ? 33.92 99.94 19 3 VAL A 91 ? ? 34.51 -91.25 20 3 LEU A 101 ? ? -106.03 65.77 21 3 THR A 112 ? ? -58.26 90.77 22 3 PHE A 120 ? ? -88.60 43.26 23 4 ARG A 77 ? ? 81.14 -18.39 24 4 GLN A 78 ? ? 70.38 177.33 25 4 MET A 90 ? ? -130.16 -83.04 26 4 ASP A 107 ? ? -103.90 -62.93 27 4 VAL A 110 ? ? -106.87 -99.63 28 4 ARG A 130 ? ? -132.77 -35.69 29 5 LYS A 59 ? ? 23.41 -134.42 30 5 VAL A 67 ? ? -62.74 -71.71 31 5 SER A 89 ? ? -120.96 -62.16 32 5 MET A 90 ? ? -137.44 -86.51 33 5 VAL A 103 ? ? -68.78 90.98 34 5 ASP A 107 ? ? -140.30 -46.85 35 5 VAL A 110 ? ? -121.33 -74.73 36 5 THR A 112 ? ? -62.15 -104.16 37 6 GLU A 46 ? ? -64.76 -171.64 38 6 LYS A 59 ? ? 44.57 -138.75 39 6 ASP A 74 ? ? -104.43 59.21 40 6 GLN A 78 ? ? -143.45 -72.63 41 6 SER A 89 ? ? -141.80 -32.09 42 6 MET A 90 ? ? -104.33 -145.11 43 6 VAL A 110 ? ? -144.86 -85.31 44 7 LYS A 59 ? ? 39.17 -159.62 45 7 ARG A 87 ? ? -98.96 46.11 46 7 MET A 90 ? ? -100.93 -166.15 47 7 ASP A 107 ? ? -137.84 -59.09 48 7 THR A 112 ? ? -50.43 97.38 49 8 LYS A 59 ? ? 45.83 -99.06 50 8 GLN A 78 ? ? -169.52 105.46 51 8 THR A 86 ? ? -101.63 -67.60 52 8 SER A 89 ? ? -142.87 -50.58 53 8 MET A 90 ? ? -117.63 -95.59 54 8 LEU A 101 ? ? -105.67 67.52 55 8 PRO A 102 ? ? -68.14 93.21 56 8 SER A 104 ? ? -138.81 -36.80 57 9 GLU A 46 ? ? -73.44 -159.69 58 9 LYS A 59 ? ? 49.30 -142.80 59 9 ARG A 77 ? ? -94.70 -61.15 60 9 GLN A 78 ? ? -121.36 -61.56 61 9 MET A 90 ? ? -125.69 -60.38 62 9 THR A 112 ? ? -71.58 -105.24 63 10 LYS A 59 ? ? -30.90 149.36 64 10 ASP A 74 ? ? -104.10 41.46 65 10 SER A 89 ? ? -146.37 40.67 66 10 VAL A 91 ? ? 35.00 -110.06 67 10 LEU A 101 ? ? -37.53 97.66 68 10 SER A 104 ? ? -142.54 -42.74 69 10 VAL A 110 ? ? -102.33 -140.67 70 10 PHE A 120 ? ? -98.81 46.22 71 10 ARG A 130 ? ? -134.26 -35.45 72 11 GLU A 46 ? ? -59.00 172.30 73 11 LYS A 59 ? ? 48.43 -112.51 74 11 ARG A 87 ? ? -114.01 -92.58 75 11 ASP A 107 ? ? -141.55 -96.32 76 11 VAL A 110 ? ? -128.65 -156.25 77 11 ARG A 130 ? ? -132.66 -75.19 78 12 GLU A 46 ? ? -70.27 -163.34 79 12 LYS A 59 ? ? 37.87 -157.23 80 13 SER A 60 ? ? -81.37 33.06 81 13 MET A 62 ? ? -53.79 -172.71 82 13 GLN A 78 ? ? 179.96 133.50 83 13 THR A 86 ? ? -131.34 -46.43 84 13 SER A 89 ? ? -125.68 -88.80 85 13 MET A 90 ? ? -147.43 -85.49 86 13 VAL A 91 ? ? -9.00 -58.38 87 13 THR A 112 ? ? -53.65 93.09 88 14 HIS A 48 ? ? -133.29 -60.74 89 14 GLN A 78 ? ? 54.26 91.12 90 14 THR A 86 ? ? -101.20 -147.95 91 14 SER A 89 ? ? -141.58 52.26 92 14 MET A 90 ? ? -100.96 -90.49 93 14 THR A 112 ? ? -56.78 -5.73 94 14 PRO A 115 ? ? -66.22 -174.69 95 15 LYS A 59 ? ? -50.65 -161.75 96 15 MET A 62 ? ? -113.89 -168.39 97 15 GLN A 78 ? ? -141.01 -80.37 98 15 SER A 89 ? ? -143.22 -65.78 99 15 MET A 90 ? ? -144.08 -77.31 100 15 LEU A 101 ? ? -107.31 67.69 101 15 SER A 104 ? ? -120.85 -83.78 102 15 ASP A 107 ? ? -105.15 -144.04 103 15 LYS A 108 ? ? -138.68 -68.75 104 16 LYS A 59 ? ? -22.37 140.79 105 16 TYR A 71 ? ? -109.96 51.16 106 16 GLN A 78 ? ? 170.07 115.14 107 16 ARG A 87 ? ? -100.00 -72.29 108 16 SER A 104 ? ? -143.73 32.71 109 16 VAL A 110 ? ? -143.65 -157.69 110 16 THR A 112 ? ? -50.43 100.12 111 17 ALA A 37 ? ? -105.01 -156.53 112 17 LYS A 59 ? ? 46.38 -92.05 113 17 THR A 86 ? ? -134.92 -47.22 114 17 ARG A 87 ? ? -103.06 -88.80 115 17 SER A 89 ? ? -143.78 -53.81 116 17 MET A 90 ? ? -107.69 -98.84 117 17 VAL A 110 ? ? -143.31 -147.87 118 17 THR A 112 ? ? -65.18 -91.18 119 18 LYS A 59 ? ? 43.45 -135.66 120 18 SER A 89 ? ? -133.19 -75.05 121 18 MET A 90 ? ? -140.37 -80.14 122 18 THR A 112 ? ? -56.86 109.12 123 19 LYS A 59 ? ? 53.66 -137.31 124 19 THR A 86 ? ? -128.02 -125.48 125 19 VAL A 91 ? ? -68.44 -174.62 126 19 ASP A 107 ? ? -128.52 -94.45 127 19 VAL A 110 ? ? -104.32 -102.59 128 19 GLU A 128 ? ? -144.26 -38.08 129 20 LYS A 47 ? ? -101.84 73.17 130 20 LYS A 59 ? ? -49.46 178.58 131 20 VAL A 91 ? ? 64.84 117.49 132 20 ASP A 107 ? ? -140.46 -59.08 133 20 VAL A 110 ? ? -141.75 -138.91 134 21 LYS A 59 ? ? -35.09 -70.13 135 21 GLN A 78 ? ? -138.60 -127.15 136 21 MET A 90 ? ? -100.42 -106.35 137 21 ALA A 100 ? ? -96.86 -89.55 138 21 VAL A 103 ? ? -120.67 -152.38 139 21 VAL A 110 ? ? -130.38 -93.73 140 21 PRO A 115 ? ? -72.46 -168.92 141 22 GLU A 46 ? ? -73.27 -155.81 142 22 LYS A 59 ? ? -48.93 178.89 143 22 THR A 86 ? ? -134.02 -37.59 144 22 VAL A 91 ? ? -167.36 -46.68 145 22 VAL A 103 ? ? -130.88 -78.22 146 22 VAL A 110 ? ? -140.74 -96.19 147 22 PRO A 115 ? ? -69.65 -175.03 148 23 LYS A 47 ? ? -118.66 56.77 149 23 LYS A 59 ? ? 49.82 -126.98 150 23 THR A 86 ? ? -122.78 -57.98 151 23 ASP A 107 ? ? -143.19 -60.74 152 23 VAL A 110 ? ? -143.40 -137.68 153 23 PRO A 115 ? ? -66.34 -174.24 154 24 GLU A 46 ? ? -88.45 -158.63 155 24 LYS A 59 ? ? 50.09 -124.66 156 24 THR A 86 ? ? -129.84 -72.95 157 24 SER A 89 ? ? -142.37 -66.45 158 24 MET A 90 ? ? -142.06 -39.65 159 24 PRO A 93 ? ? -63.62 -175.55 160 24 PHE A 94 ? ? 68.48 -78.03 161 25 LYS A 59 ? ? 45.66 -133.65 162 25 THR A 86 ? ? -100.58 -89.57 163 25 VAL A 91 ? ? 60.11 109.36 164 25 PRO A 115 ? ? -63.65 -179.30 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 41 ? ? 0.302 'SIDE CHAIN' 2 1 ARG A 63 ? ? 0.291 'SIDE CHAIN' 3 1 ARG A 77 ? ? 0.206 'SIDE CHAIN' 4 1 ARG A 87 ? ? 0.224 'SIDE CHAIN' 5 1 ARG A 130 ? ? 0.316 'SIDE CHAIN' 6 2 ARG A 41 ? ? 0.237 'SIDE CHAIN' 7 2 ARG A 63 ? ? 0.312 'SIDE CHAIN' 8 2 ARG A 77 ? ? 0.191 'SIDE CHAIN' 9 2 ARG A 87 ? ? 0.310 'SIDE CHAIN' 10 3 ARG A 41 ? ? 0.078 'SIDE CHAIN' 11 3 ARG A 63 ? ? 0.265 'SIDE CHAIN' 12 3 ARG A 77 ? ? 0.193 'SIDE CHAIN' 13 3 ARG A 87 ? ? 0.140 'SIDE CHAIN' 14 3 ARG A 130 ? ? 0.236 'SIDE CHAIN' 15 4 ARG A 41 ? ? 0.168 'SIDE CHAIN' 16 4 ARG A 63 ? ? 0.247 'SIDE CHAIN' 17 4 ARG A 77 ? ? 0.280 'SIDE CHAIN' 18 4 ARG A 130 ? ? 0.171 'SIDE CHAIN' 19 5 ARG A 41 ? ? 0.277 'SIDE CHAIN' 20 5 ARG A 63 ? ? 0.299 'SIDE CHAIN' 21 5 ARG A 77 ? ? 0.300 'SIDE CHAIN' 22 5 ARG A 87 ? ? 0.195 'SIDE CHAIN' 23 5 ARG A 130 ? ? 0.202 'SIDE CHAIN' 24 6 ARG A 41 ? ? 0.274 'SIDE CHAIN' 25 6 ARG A 63 ? ? 0.317 'SIDE CHAIN' 26 6 ARG A 77 ? ? 0.317 'SIDE CHAIN' 27 6 ARG A 87 ? ? 0.192 'SIDE CHAIN' 28 6 ARG A 130 ? ? 0.112 'SIDE CHAIN' 29 7 ARG A 41 ? ? 0.203 'SIDE CHAIN' 30 7 ARG A 63 ? ? 0.113 'SIDE CHAIN' 31 7 ARG A 77 ? ? 0.222 'SIDE CHAIN' 32 7 ARG A 87 ? ? 0.117 'SIDE CHAIN' 33 7 ARG A 130 ? ? 0.230 'SIDE CHAIN' 34 8 ARG A 41 ? ? 0.201 'SIDE CHAIN' 35 8 ARG A 63 ? ? 0.171 'SIDE CHAIN' 36 8 ARG A 77 ? ? 0.296 'SIDE CHAIN' 37 8 ARG A 87 ? ? 0.251 'SIDE CHAIN' 38 8 ARG A 130 ? ? 0.285 'SIDE CHAIN' 39 9 ARG A 41 ? ? 0.210 'SIDE CHAIN' 40 9 ARG A 63 ? ? 0.285 'SIDE CHAIN' 41 9 ARG A 77 ? ? 0.307 'SIDE CHAIN' 42 9 ARG A 87 ? ? 0.263 'SIDE CHAIN' 43 9 ARG A 130 ? ? 0.164 'SIDE CHAIN' 44 10 ARG A 41 ? ? 0.144 'SIDE CHAIN' 45 10 ARG A 63 ? ? 0.105 'SIDE CHAIN' 46 10 ARG A 77 ? ? 0.128 'SIDE CHAIN' 47 10 ARG A 87 ? ? 0.274 'SIDE CHAIN' 48 10 ARG A 130 ? ? 0.305 'SIDE CHAIN' 49 11 ARG A 41 ? ? 0.302 'SIDE CHAIN' 50 11 ARG A 63 ? ? 0.284 'SIDE CHAIN' 51 11 ARG A 77 ? ? 0.317 'SIDE CHAIN' 52 11 ARG A 87 ? ? 0.311 'SIDE CHAIN' 53 11 ARG A 130 ? ? 0.146 'SIDE CHAIN' 54 12 ARG A 41 ? ? 0.301 'SIDE CHAIN' 55 12 ARG A 77 ? ? 0.308 'SIDE CHAIN' 56 12 ARG A 87 ? ? 0.316 'SIDE CHAIN' 57 13 ARG A 41 ? ? 0.221 'SIDE CHAIN' 58 13 ARG A 63 ? ? 0.139 'SIDE CHAIN' 59 13 ARG A 77 ? ? 0.221 'SIDE CHAIN' 60 13 ARG A 87 ? ? 0.310 'SIDE CHAIN' 61 13 ARG A 130 ? ? 0.296 'SIDE CHAIN' 62 14 ARG A 41 ? ? 0.222 'SIDE CHAIN' 63 14 ARG A 63 ? ? 0.307 'SIDE CHAIN' 64 14 ARG A 77 ? ? 0.314 'SIDE CHAIN' 65 14 ARG A 87 ? ? 0.293 'SIDE CHAIN' 66 14 ARG A 130 ? ? 0.317 'SIDE CHAIN' 67 15 ARG A 41 ? ? 0.298 'SIDE CHAIN' 68 15 ARG A 63 ? ? 0.307 'SIDE CHAIN' 69 15 ARG A 77 ? ? 0.214 'SIDE CHAIN' 70 15 ARG A 130 ? ? 0.181 'SIDE CHAIN' 71 16 ARG A 63 ? ? 0.230 'SIDE CHAIN' 72 16 ARG A 77 ? ? 0.312 'SIDE CHAIN' 73 16 ARG A 87 ? ? 0.277 'SIDE CHAIN' 74 16 ARG A 130 ? ? 0.089 'SIDE CHAIN' 75 17 ARG A 41 ? ? 0.187 'SIDE CHAIN' 76 17 ARG A 63 ? ? 0.204 'SIDE CHAIN' 77 17 ARG A 77 ? ? 0.245 'SIDE CHAIN' 78 17 ARG A 87 ? ? 0.312 'SIDE CHAIN' 79 17 ARG A 130 ? ? 0.268 'SIDE CHAIN' 80 18 ARG A 41 ? ? 0.215 'SIDE CHAIN' 81 18 ARG A 63 ? ? 0.285 'SIDE CHAIN' 82 18 ARG A 87 ? ? 0.220 'SIDE CHAIN' 83 18 ARG A 130 ? ? 0.317 'SIDE CHAIN' 84 19 ARG A 41 ? ? 0.217 'SIDE CHAIN' 85 19 ARG A 63 ? ? 0.310 'SIDE CHAIN' 86 19 ARG A 77 ? ? 0.191 'SIDE CHAIN' 87 19 ARG A 87 ? ? 0.279 'SIDE CHAIN' 88 19 ARG A 130 ? ? 0.167 'SIDE CHAIN' 89 20 ARG A 41 ? ? 0.308 'SIDE CHAIN' 90 20 ARG A 63 ? ? 0.262 'SIDE CHAIN' 91 20 ARG A 77 ? ? 0.316 'SIDE CHAIN' 92 20 ARG A 87 ? ? 0.312 'SIDE CHAIN' 93 20 ARG A 130 ? ? 0.304 'SIDE CHAIN' 94 21 ARG A 63 ? ? 0.309 'SIDE CHAIN' 95 21 ARG A 77 ? ? 0.137 'SIDE CHAIN' 96 21 ARG A 87 ? ? 0.272 'SIDE CHAIN' 97 21 ARG A 130 ? ? 0.277 'SIDE CHAIN' 98 22 ARG A 41 ? ? 0.161 'SIDE CHAIN' 99 22 ARG A 63 ? ? 0.179 'SIDE CHAIN' 100 22 ARG A 77 ? ? 0.268 'SIDE CHAIN' 101 22 ARG A 87 ? ? 0.194 'SIDE CHAIN' 102 22 ARG A 130 ? ? 0.188 'SIDE CHAIN' 103 23 ARG A 41 ? ? 0.159 'SIDE CHAIN' 104 23 ARG A 63 ? ? 0.244 'SIDE CHAIN' 105 23 ARG A 77 ? ? 0.240 'SIDE CHAIN' 106 23 ARG A 87 ? ? 0.294 'SIDE CHAIN' 107 23 ARG A 130 ? ? 0.277 'SIDE CHAIN' 108 24 ARG A 63 ? ? 0.262 'SIDE CHAIN' 109 24 ARG A 77 ? ? 0.317 'SIDE CHAIN' 110 24 ARG A 87 ? ? 0.184 'SIDE CHAIN' 111 24 ARG A 130 ? ? 0.265 'SIDE CHAIN' 112 25 ARG A 41 ? ? 0.186 'SIDE CHAIN' 113 25 ARG A 63 ? ? 0.237 'SIDE CHAIN' 114 25 ARG A 77 ? ? 0.317 'SIDE CHAIN' 115 25 ARG A 130 ? ? 0.304 'SIDE CHAIN' #