data_1ERD # _entry.id 1ERD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1ERD pdb_00001erd 10.2210/pdb1erd/pdb WWPDB D_1000173131 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1ERD _pdbx_database_status.recvd_initial_deposition_date 1994-02-14 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ottiger, M.' 1 'Szyperski, T.' 2 'Luginbuhl, P.' 3 'Ortenzi, C.' 4 'Luporini, P.' 5 'Bradshaw, R.A.' 6 'Wuthrich, K.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'The NMR solution structure of the pheromone Er-2 from the ciliated protozoan Euplotes raikovi.' 'Protein Sci.' 3 1515 1526 1994 PRCIEI US 0961-8368 0795 ? 7833811 ? 1 ;Primary Structure of Euplotes Raikovi Pheromones: Comparison of Five Sequences of Pheromones from Cells with Variable Mating Interactions ; Proc.Natl.Acad.Sci.USA 89 2071 ? 1992 PNASA6 US 0027-8424 0040 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ottiger, M.' 1 ? primary 'Szyperski, T.' 2 ? primary 'Luginbuhl, P.' 3 ? primary 'Ortenzi, C.' 4 ? primary 'Luporini, P.' 5 ? primary 'Bradshaw, R.A.' 6 ? primary 'Wuthrich, K.' 7 ? 1 'Raffioni, S.' 8 ? 1 'Miceli, C.' 9 ? 1 'Vallesi, A.' 10 ? 1 'Chowdhury, S.K.' 11 ? 1 'Chait, B.T.' 12 ? 1 'Luporini, P.' 13 ? 1 'Bradshaw, R.A.' 14 ? # _cell.entry_id 1ERD _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1ERD _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PHEROMONE ER-2' _entity.formula_weight 4303.974 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DPMTCEQAMASCEHTMCGYCQGPLYMTCIGITTDPECGLP _entity_poly.pdbx_seq_one_letter_code_can DPMTCEQAMASCEHTMCGYCQGPLYMTCIGITTDPECGLP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 PRO n 1 3 MET n 1 4 THR n 1 5 CYS n 1 6 GLU n 1 7 GLN n 1 8 ALA n 1 9 MET n 1 10 ALA n 1 11 SER n 1 12 CYS n 1 13 GLU n 1 14 HIS n 1 15 THR n 1 16 MET n 1 17 CYS n 1 18 GLY n 1 19 TYR n 1 20 CYS n 1 21 GLN n 1 22 GLY n 1 23 PRO n 1 24 LEU n 1 25 TYR n 1 26 MET n 1 27 THR n 1 28 CYS n 1 29 ILE n 1 30 GLY n 1 31 ILE n 1 32 THR n 1 33 THR n 1 34 ASP n 1 35 PRO n 1 36 GLU n 1 37 CYS n 1 38 GLY n 1 39 LEU n 1 40 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Euplotes _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Euplotes raikovi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5938 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MER2_EUPRA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P26886 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code MNKLAILAIIAMVLFSANAFRLQSRLRSNMEASARDPMTCEQAMASCEHTMCGYCQGPLYMTCIGITTDPECGLP _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1ERD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P26886 _struct_ref_seq.db_align_beg 36 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 75 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 40 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # _pdbx_nmr_ensemble.entry_id 1ERD _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _exptl.entry_id 1ERD _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1ERD _struct.title 'THE NMR SOLUTION STRUCTURE OF THE PHEROMONE ER-2 FROM THE CILIATED PROTOZOAN EUPLOTES RAIKOVI' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1ERD _struct_keywords.pdbx_keywords PHEROMONE _struct_keywords.text PHEROMONE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1H CYS A 5 ? SER A 11 ? CYS A 5 SER A 11 1 ? 7 HELX_P HELX_P2 2H HIS A 14 ? CYS A 20 ? HIS A 14 CYS A 20 1 ? 7 HELX_P HELX_P3 3H PRO A 23 ? THR A 33 ? PRO A 23 THR A 33 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 20 SG ? ? A CYS 5 A CYS 20 1_555 ? ? ? ? ? ? ? 2.087 ? ? disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 12 A CYS 37 1_555 ? ? ? ? ? ? ? 2.077 ? ? disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 17 A CYS 28 1_555 ? ? ? ? ? ? ? 2.077 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1ERD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1ERD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 MET 26 26 26 MET MET A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 PRO 40 40 40 PRO PRO A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1994-10-15 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 CB A ASP 1 ? ? CA A ASP 1 ? ? C A ASP 1 ? ? 123.20 110.40 12.80 2.00 N 2 3 CA A CYS 28 ? ? CB A CYS 28 ? ? SG A CYS 28 ? ? 123.79 114.20 9.59 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 3 ? ? 75.42 155.20 2 1 CYS A 37 ? ? -54.08 96.96 3 2 PRO A 2 ? ? -66.48 -173.38 4 2 MET A 3 ? ? 53.09 124.19 5 2 CYS A 17 ? ? -57.66 -8.50 6 2 CYS A 37 ? ? -55.57 96.68 7 3 CYS A 37 ? ? -66.06 71.63 8 4 CYS A 37 ? ? -52.23 103.72 9 5 MET A 3 ? ? 59.97 -176.21 10 5 PRO A 35 ? ? -64.52 0.78 11 6 MET A 3 ? ? 67.59 142.73 12 6 CYS A 37 ? ? -50.40 74.07 13 7 PRO A 2 ? ? -61.62 -155.23 14 7 MET A 3 ? ? -38.93 124.96 15 8 MET A 3 ? ? 98.60 158.88 16 8 CYS A 37 ? ? -59.09 99.31 17 9 PRO A 2 ? ? -68.81 -178.69 18 9 MET A 3 ? ? 52.87 109.62 19 9 CYS A 17 ? ? -58.61 -7.03 20 9 CYS A 37 ? ? -56.92 101.04 21 10 MET A 3 ? ? 67.81 133.01 22 10 CYS A 37 ? ? -65.60 84.45 23 11 PRO A 2 ? ? -63.90 99.62 24 11 CYS A 37 ? ? -54.75 95.31 25 12 MET A 3 ? ? 66.04 119.98 26 13 MET A 3 ? ? 69.43 135.04 27 13 CYS A 20 ? ? -76.24 -165.34 28 14 MET A 3 ? ? 59.18 -169.05 29 14 GLU A 36 ? ? -88.12 34.77 30 14 CYS A 37 ? ? -65.42 84.48 31 15 CYS A 37 ? ? -50.61 85.62 32 16 MET A 3 ? ? 61.22 107.22 33 16 CYS A 37 ? ? -47.40 97.72 34 17 MET A 3 ? ? 66.48 139.47 35 17 CYS A 17 ? ? -57.51 -4.91 36 17 CYS A 37 ? ? -48.57 100.18 37 18 CYS A 37 ? ? -49.38 89.69 38 19 MET A 3 ? ? 60.79 -167.07 39 19 CYS A 12 ? ? 70.10 32.30 40 19 CYS A 37 ? ? -52.76 95.81 41 20 MET A 3 ? ? 69.62 118.65 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 19 ? ? 0.112 'SIDE CHAIN' 2 3 TYR A 19 ? ? 0.230 'SIDE CHAIN' 3 4 TYR A 25 ? ? 0.123 'SIDE CHAIN' 4 5 TYR A 25 ? ? 0.067 'SIDE CHAIN' 5 7 TYR A 19 ? ? 0.071 'SIDE CHAIN' 6 8 TYR A 19 ? ? 0.081 'SIDE CHAIN' 7 9 TYR A 19 ? ? 0.125 'SIDE CHAIN' 8 9 TYR A 25 ? ? 0.114 'SIDE CHAIN' 9 11 TYR A 19 ? ? 0.072 'SIDE CHAIN' 10 14 TYR A 25 ? ? 0.079 'SIDE CHAIN' 11 15 TYR A 25 ? ? 0.091 'SIDE CHAIN' 12 17 TYR A 19 ? ? 0.087 'SIDE CHAIN' 13 18 TYR A 25 ? ? 0.087 'SIDE CHAIN' 14 19 TYR A 19 ? ? 0.090 'SIDE CHAIN' 15 20 TYR A 19 ? ? 0.110 'SIDE CHAIN' #