data_1F2H # _entry.id 1F2H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1F2H pdb_00001f2h 10.2210/pdb1f2h/pdb RCSB RCSB011162 ? ? WWPDB D_1000011162 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1F2H _pdbx_database_status.recvd_initial_deposition_date 2000-05-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tsao, D.' 1 'McDonaugh, T.' 2 'Malakian, K.' 3 'Xu, G.-Y.' 4 'Telliez, J.-B.' 5 'Hsu, H.' 6 'Lin, L.-L.' 7 # _citation.id primary _citation.title ;Solution structure of N-TRADD and characterization of the interaction of N-TRADD and C-TRAF2, a key step in the TNFR1 signaling pathway. ; _citation.journal_abbrev Mol.Cell _citation.journal_volume 5 _citation.page_first 1051 _citation.page_last 1057 _citation.year 2000 _citation.journal_id_ASTM MOCEFL _citation.country US _citation.journal_id_ISSN 1097-2765 _citation.journal_id_CSD 2168 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10911999 _citation.pdbx_database_id_DOI '10.1016/S1097-2765(00)80270-1' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tsao, D.H.' 1 ? primary 'McDonagh, T.' 2 ? primary 'Telliez, J.B.' 3 ? primary 'Hsu, S.' 4 ? primary 'Malakian, K.' 5 ? primary 'Xu, G.Y.' 6 ? primary 'Lin, L.L.' 7 ? # _cell.entry_id 1F2H _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1F2H _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TUMOR NECROSIS FACTOR RECEPTOR TYPE 1 ASSOCIATED DEATH DOMAIN PROTEIN' _entity.formula_weight 18572.160 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-TERMINAL DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'TRADD, TNFR1-ASSOCIATED DEATH DOMAIN PROTEIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGR QPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALR NLKCGSGAR ; _entity_poly.pdbx_seq_one_letter_code_can ;MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGR QPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALR NLKCGSGAR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 GLY n 1 5 GLN n 1 6 ASN n 1 7 GLY n 1 8 HIS n 1 9 GLU n 1 10 GLU n 1 11 TRP n 1 12 VAL n 1 13 GLY n 1 14 SER n 1 15 ALA n 1 16 TYR n 1 17 LEU n 1 18 PHE n 1 19 VAL n 1 20 GLU n 1 21 SER n 1 22 SER n 1 23 LEU n 1 24 ASP n 1 25 LYS n 1 26 VAL n 1 27 VAL n 1 28 LEU n 1 29 SER n 1 30 ASP n 1 31 ALA n 1 32 TYR n 1 33 ALA n 1 34 HIS n 1 35 PRO n 1 36 GLN n 1 37 GLN n 1 38 LYS n 1 39 VAL n 1 40 ALA n 1 41 VAL n 1 42 TYR n 1 43 ARG n 1 44 ALA n 1 45 LEU n 1 46 GLN n 1 47 ALA n 1 48 ALA n 1 49 LEU n 1 50 ALA n 1 51 GLU n 1 52 SER n 1 53 GLY n 1 54 GLY n 1 55 SER n 1 56 PRO n 1 57 ASP n 1 58 VAL n 1 59 LEU n 1 60 GLN n 1 61 MET n 1 62 LEU n 1 63 LYS n 1 64 ILE n 1 65 HIS n 1 66 ARG n 1 67 SER n 1 68 ASP n 1 69 PRO n 1 70 GLN n 1 71 LEU n 1 72 ILE n 1 73 VAL n 1 74 GLN n 1 75 LEU n 1 76 ARG n 1 77 PHE n 1 78 CYS n 1 79 GLY n 1 80 ARG n 1 81 GLN n 1 82 PRO n 1 83 CYS n 1 84 GLY n 1 85 ARG n 1 86 PHE n 1 87 LEU n 1 88 ARG n 1 89 ALA n 1 90 TYR n 1 91 ARG n 1 92 GLU n 1 93 GLY n 1 94 ALA n 1 95 LEU n 1 96 ARG n 1 97 ALA n 1 98 ALA n 1 99 LEU n 1 100 GLN n 1 101 ARG n 1 102 SER n 1 103 LEU n 1 104 ALA n 1 105 ALA n 1 106 ALA n 1 107 LEU n 1 108 ALA n 1 109 GLN n 1 110 HIS n 1 111 SER n 1 112 VAL n 1 113 PRO n 1 114 LEU n 1 115 GLN n 1 116 LEU n 1 117 GLU n 1 118 LEU n 1 119 ARG n 1 120 ALA n 1 121 GLY n 1 122 ALA n 1 123 GLU n 1 124 ARG n 1 125 LEU n 1 126 ASP n 1 127 ALA n 1 128 LEU n 1 129 LEU n 1 130 ALA n 1 131 ASP n 1 132 GLU n 1 133 GLU n 1 134 ARG n 1 135 CYS n 1 136 LEU n 1 137 SER n 1 138 CYS n 1 139 ILE n 1 140 LEU n 1 141 ALA n 1 142 GLN n 1 143 GLN n 1 144 PRO n 1 145 ASP n 1 146 ARG n 1 147 LEU n 1 148 ARG n 1 149 ASP n 1 150 GLU n 1 151 GLU n 1 152 LEU n 1 153 ALA n 1 154 GLU n 1 155 LEU n 1 156 GLU n 1 157 ASP n 1 158 ALA n 1 159 LEU n 1 160 ARG n 1 161 ASN n 1 162 LEU n 1 163 LYS n 1 164 CYS n 1 165 GLY n 1 166 SER n 1 167 GLY n 1 168 ALA n 1 169 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PRSETB _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code TRADD_HUMAN _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q15628 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGR QPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALR NLKCGSGAR ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1F2H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 169 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q15628 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 169 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 169 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 3 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 HNHA 4 1 2 HNCACB 5 1 2 'HN(CO)CACB' 6 1 2 'C(CO)NH-TOCSY' 7 1 3 hcchtocsy 8 1 2 'HAHB(CO)NH' 9 1 1 '15N-edited Tocsy-hsqc' 10 1 3 'methyl-methyl NOE' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 1 6.6 '200mM NaCl' atm K 2 298 1 6.6 '200mM NaCl' atm K 3 298 1 6.6 '200mM NaCl' atm K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.0 mM 15N N-TRADD' '20mM Imidazole pH 6.6 200 mMNaCL 20 mM DTT 0.05%NaN3 90%H2O 10% D2O' 2 '1.1 mM 15N/13C N-TRADD' '20mM Imidazole pH 6.6 200 mMNaCL 20 mM DTT 0.05%NaN3 90%H2O 10% D2O' 3 '0.8 mM 15N/13C N-TRADD' '20mM Imidazole pH 6.6 200 mMNaCL 220 mM DTT 0.05%NaN3 100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1F2H _pdbx_nmr_refine.method 'Distance geometry/simulated annealing' _pdbx_nmr_refine.details ;Structures determined from 2402 restraints (1883 NOE restraints, 159 dihedral, 100 distance restraints from hydrogen bonds and 240 Alpha and Beta 13C chemical shifts). ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1F2H _pdbx_nmr_details.text 'Other experiments used were HC(CO)NH_TOCSY, 3D 13C-13C long range correlation, methyl-methyl NOE' # _pdbx_nmr_ensemble.entry_id 1F2H _pdbx_nmr_ensemble.conformers_calculated_total_number 1 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'Low energies and violations not larger than 0.3A for NOEs and 5 degrees for torsional restraints' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1F2H _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 3.851 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.authors 'Brunger et al' _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1F2H _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1F2H _struct.title 'SOLUTION STRUCTURE OF THE N-TERMINAL DOMAIN OF THE TNFR1 ASSOCIATED PROTEIN, TRADD.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1F2H _struct_keywords.pdbx_keywords APOPTOSIS _struct_keywords.text 'TNFR-1 associated protein, APOPTOSIS' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 27 ? TYR A 32 ? VAL A 27 TYR A 32 1 ? 6 HELX_P HELX_P2 2 HIS A 34 ? GLY A 53 ? HIS A 34 GLY A 53 1 ? 20 HELX_P HELX_P3 3 GLY A 79 ? ALA A 108 ? GLY A 79 ALA A 108 1 ? 30 HELX_P HELX_P4 4 ARG A 124 ? ASP A 131 ? ARG A 124 ASP A 131 1 ? 8 HELX_P HELX_P5 5 ASP A 131 ? GLN A 142 ? ASP A 131 GLN A 142 1 ? 12 HELX_P HELX_P6 6 ASP A 149 ? LYS A 163 ? ASP A 149 LYS A 163 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 61 ? SER A 67 ? MET A 61 SER A 67 A 2 GLN A 70 ? ARG A 76 ? GLN A 70 ARG A 76 A 3 SER A 14 ? GLU A 20 ? SER A 14 GLU A 20 A 4 GLN A 115 ? ARG A 119 ? GLN A 115 ARG A 119 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O SER A 67 ? O SER A 67 N GLN A 70 ? N GLN A 70 A 2 3 N LEU A 75 ? N LEU A 75 O ALA A 15 ? O ALA A 15 A 3 4 O GLU A 20 ? O GLU A 20 N GLN A 115 ? N GLN A 115 # _database_PDB_matrix.entry_id 1F2H _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1F2H _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 CYS 83 83 83 CYS CYS A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 CYS 135 135 135 CYS CYS A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 CYS 138 138 138 CYS CYS A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 GLN 143 143 143 GLN GLN A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 LEU 159 159 159 LEU LEU A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 CYS 164 164 164 CYS CYS A . n A 1 165 GLY 165 165 165 GLY GLY A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 ARG 169 169 169 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-05-30 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 9 ? ? 39.46 65.00 2 1 ASP A 68 ? ? 46.31 -169.00 3 1 CYS A 78 ? ? -155.22 -44.02 4 1 LEU A 107 ? ? -89.97 -79.34 5 1 ALA A 108 ? ? -167.32 34.50 6 1 SER A 111 ? ? -178.05 124.57 #