data_1F3O # _entry.id 1F3O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1F3O pdb_00001f3o 10.2210/pdb1f3o/pdb RCSB RCSB011203 ? ? WWPDB D_1000011203 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-07-25 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-31 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Experimental preparation' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' exptl_crystal_grow 2 5 'Structure model' chem_comp_atom 3 5 'Structure model' chem_comp_bond 4 5 'Structure model' database_2 5 5 'Structure model' pdbx_entry_details 6 5 'Structure model' pdbx_modification_feature 7 5 'Structure model' pdbx_struct_conn_angle 8 5 'Structure model' struct_conn 9 5 'Structure model' struct_ref_seq_dif 10 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_exptl_crystal_grow.temp' 2 5 'Structure model' '_database_2.pdbx_DOI' 3 5 'Structure model' '_database_2.pdbx_database_accession' 4 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 5 'Structure model' '_struct_conn.pdbx_dist_value' 17 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 18 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 21 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 22 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 23 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 24 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 25 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 27 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 28 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 29 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 30 5 'Structure model' '_struct_ref_seq_dif.details' 31 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 32 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 33 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1F3O _pdbx_database_status.recvd_initial_deposition_date 2000-06-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yuan, Y.-R.' 1 'Hunt, J.F.' 2 # _citation.id primary _citation.title ;The crystal structure of the MJ0796 ATP-binding cassette. Implications for the structural consequences of ATP hydrolysis in the active site of an ABC transporter. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 276 _citation.page_first 32313 _citation.page_last 32321 _citation.year 2001 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11402022 _citation.pdbx_database_id_DOI 10.1074/jbc.M100758200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yuan, Y.R.' 1 ? primary 'Blecker, S.' 2 ? primary 'Martsinkevich, O.' 3 ? primary 'Millen, L.' 4 ? primary 'Thomas, P.J.' 5 ? primary 'Hunt, J.F.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN MJ0796' 26931.941 1 ? ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201 1 ? ? ? ? 4 water nat water 18.015 64 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)IKLKNVTKTYK(MSE)GEEIIYALKNVNLNIKEGEFVSI(MSE)GPSGSGKST(MSE)LNIIGCLDKPTEGEVYI DNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGA(MSE)SGEERRKRALECLK(MSE)AELEE RFANHKPNQLSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKI(MSE)QLLKKLNEEDGKTVVVVTHDINVARFG ERIIYLKDGEVEREEKLRGFDDR ; _entity_poly.pdbx_seq_one_letter_code_can ;MIKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELTKI RRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARAL ANNPPIILADEPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVARFGERIIYLKDGEVEREEKLRGFDDR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 "ADENOSINE-5'-DIPHOSPHATE" ADP 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ILE n 1 3 LYS n 1 4 LEU n 1 5 LYS n 1 6 ASN n 1 7 VAL n 1 8 THR n 1 9 LYS n 1 10 THR n 1 11 TYR n 1 12 LYS n 1 13 MSE n 1 14 GLY n 1 15 GLU n 1 16 GLU n 1 17 ILE n 1 18 ILE n 1 19 TYR n 1 20 ALA n 1 21 LEU n 1 22 LYS n 1 23 ASN n 1 24 VAL n 1 25 ASN n 1 26 LEU n 1 27 ASN n 1 28 ILE n 1 29 LYS n 1 30 GLU n 1 31 GLY n 1 32 GLU n 1 33 PHE n 1 34 VAL n 1 35 SER n 1 36 ILE n 1 37 MSE n 1 38 GLY n 1 39 PRO n 1 40 SER n 1 41 GLY n 1 42 SER n 1 43 GLY n 1 44 LYS n 1 45 SER n 1 46 THR n 1 47 MSE n 1 48 LEU n 1 49 ASN n 1 50 ILE n 1 51 ILE n 1 52 GLY n 1 53 CYS n 1 54 LEU n 1 55 ASP n 1 56 LYS n 1 57 PRO n 1 58 THR n 1 59 GLU n 1 60 GLY n 1 61 GLU n 1 62 VAL n 1 63 TYR n 1 64 ILE n 1 65 ASP n 1 66 ASN n 1 67 ILE n 1 68 LYS n 1 69 THR n 1 70 ASN n 1 71 ASP n 1 72 LEU n 1 73 ASP n 1 74 ASP n 1 75 ASP n 1 76 GLU n 1 77 LEU n 1 78 THR n 1 79 LYS n 1 80 ILE n 1 81 ARG n 1 82 ARG n 1 83 ASP n 1 84 LYS n 1 85 ILE n 1 86 GLY n 1 87 PHE n 1 88 VAL n 1 89 PHE n 1 90 GLN n 1 91 GLN n 1 92 PHE n 1 93 ASN n 1 94 LEU n 1 95 ILE n 1 96 PRO n 1 97 LEU n 1 98 LEU n 1 99 THR n 1 100 ALA n 1 101 LEU n 1 102 GLU n 1 103 ASN n 1 104 VAL n 1 105 GLU n 1 106 LEU n 1 107 PRO n 1 108 LEU n 1 109 ILE n 1 110 PHE n 1 111 LYS n 1 112 TYR n 1 113 ARG n 1 114 GLY n 1 115 ALA n 1 116 MSE n 1 117 SER n 1 118 GLY n 1 119 GLU n 1 120 GLU n 1 121 ARG n 1 122 ARG n 1 123 LYS n 1 124 ARG n 1 125 ALA n 1 126 LEU n 1 127 GLU n 1 128 CYS n 1 129 LEU n 1 130 LYS n 1 131 MSE n 1 132 ALA n 1 133 GLU n 1 134 LEU n 1 135 GLU n 1 136 GLU n 1 137 ARG n 1 138 PHE n 1 139 ALA n 1 140 ASN n 1 141 HIS n 1 142 LYS n 1 143 PRO n 1 144 ASN n 1 145 GLN n 1 146 LEU n 1 147 SER n 1 148 GLY n 1 149 GLY n 1 150 GLN n 1 151 GLN n 1 152 GLN n 1 153 ARG n 1 154 VAL n 1 155 ALA n 1 156 ILE n 1 157 ALA n 1 158 ARG n 1 159 ALA n 1 160 LEU n 1 161 ALA n 1 162 ASN n 1 163 ASN n 1 164 PRO n 1 165 PRO n 1 166 ILE n 1 167 ILE n 1 168 LEU n 1 169 ALA n 1 170 ASP n 1 171 GLU n 1 172 PRO n 1 173 THR n 1 174 GLY n 1 175 ALA n 1 176 LEU n 1 177 ASP n 1 178 SER n 1 179 LYS n 1 180 THR n 1 181 GLY n 1 182 GLU n 1 183 LYS n 1 184 ILE n 1 185 MSE n 1 186 GLN n 1 187 LEU n 1 188 LEU n 1 189 LYS n 1 190 LYS n 1 191 LEU n 1 192 ASN n 1 193 GLU n 1 194 GLU n 1 195 ASP n 1 196 GLY n 1 197 LYS n 1 198 THR n 1 199 VAL n 1 200 VAL n 1 201 VAL n 1 202 VAL n 1 203 THR n 1 204 HIS n 1 205 ASP n 1 206 ILE n 1 207 ASN n 1 208 VAL n 1 209 ALA n 1 210 ARG n 1 211 PHE n 1 212 GLY n 1 213 GLU n 1 214 ARG n 1 215 ILE n 1 216 ILE n 1 217 TYR n 1 218 LEU n 1 219 LYS n 1 220 ASP n 1 221 GLY n 1 222 GLU n 1 223 VAL n 1 224 GLU n 1 225 ARG n 1 226 GLU n 1 227 GLU n 1 228 LYS n 1 229 LEU n 1 230 ARG n 1 231 GLY n 1 232 PHE n 1 233 ASP n 1 234 ASP n 1 235 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Methanocaldococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanocaldococcus jannaschii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2190 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene 'GENOMIC DNA' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET28A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ADP non-polymer n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 MSE 13 13 13 MSE MSE A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 MSE 37 37 37 MSE MSE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 MSE 47 47 47 MSE MSE A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 MSE 116 116 116 MSE MSE A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 CYS 128 128 128 CYS CYS A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 MSE 131 131 131 MSE MSE A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 PRO 143 143 143 PRO PRO A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 GLN 145 145 145 GLN GLN A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 GLN 152 152 152 GLN GLN A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 ASN 163 163 163 ASN ASN A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 THR 173 173 173 THR THR A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 ALA 175 175 175 ALA ALA A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 ASP 177 177 177 ASP ASP A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 LYS 183 183 183 LYS LYS A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 MSE 185 185 185 MSE MSE A . n A 1 186 GLN 186 186 186 GLN GLN A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 LYS 189 189 189 LYS LYS A . n A 1 190 LYS 190 190 190 LYS LYS A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 ASP 195 195 195 ASP ASP A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 LYS 197 197 197 LYS LYS A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 THR 203 203 203 THR THR A . n A 1 204 HIS 204 204 204 HIS HIS A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 ASN 207 207 207 ASN ASN A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 ALA 209 209 209 ALA ALA A . n A 1 210 ARG 210 210 210 ARG ARG A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 GLU 213 213 213 GLU GLU A . n A 1 214 ARG 214 214 214 ARG ARG A . n A 1 215 ILE 215 215 215 ILE ILE A . n A 1 216 ILE 216 216 216 ILE ILE A . n A 1 217 TYR 217 217 217 TYR TYR A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 LYS 219 219 219 LYS LYS A . n A 1 220 ASP 220 220 220 ASP ASP A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 GLU 222 222 222 GLU GLU A . n A 1 223 VAL 223 223 223 VAL VAL A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 ARG 225 225 225 ARG ARG A . n A 1 226 GLU 226 226 226 GLU GLU A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 LYS 228 228 228 LYS LYS A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 ARG 230 230 230 ARG ARG A . n A 1 231 GLY 231 231 231 GLY GLY A . n A 1 232 PHE 232 232 232 PHE PHE A . n A 1 233 ASP 233 233 ? ? ? A . n A 1 234 ASP 234 234 ? ? ? A . n A 1 235 ARG 235 235 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 301 301 MG MG A . C 3 ADP 1 300 300 ADP ADP A . D 4 HOH 1 401 401 HOH HOH A . D 4 HOH 2 402 402 HOH HOH A . D 4 HOH 3 403 403 HOH HOH A . D 4 HOH 4 404 404 HOH HOH A . D 4 HOH 5 405 405 HOH HOH A . D 4 HOH 6 406 406 HOH HOH A . D 4 HOH 7 407 407 HOH HOH A . D 4 HOH 8 408 408 HOH HOH A . D 4 HOH 9 409 409 HOH HOH A . D 4 HOH 10 410 410 HOH HOH A . D 4 HOH 11 411 411 HOH HOH A . D 4 HOH 12 412 412 HOH HOH A . D 4 HOH 13 413 413 HOH HOH A . D 4 HOH 14 414 414 HOH HOH A . D 4 HOH 15 415 415 HOH HOH A . D 4 HOH 16 416 416 HOH HOH A . D 4 HOH 17 417 417 HOH HOH A . D 4 HOH 18 418 418 HOH HOH A . D 4 HOH 19 419 419 HOH HOH A . D 4 HOH 20 420 420 HOH HOH A . D 4 HOH 21 421 421 HOH HOH A . D 4 HOH 22 422 422 HOH HOH A . D 4 HOH 23 423 423 HOH HOH A . D 4 HOH 24 424 424 HOH HOH A . D 4 HOH 25 425 425 HOH HOH A . D 4 HOH 26 426 426 HOH HOH A . D 4 HOH 27 427 427 HOH HOH A . D 4 HOH 28 428 428 HOH HOH A . D 4 HOH 29 429 429 HOH HOH A . D 4 HOH 30 430 430 HOH HOH A . D 4 HOH 31 431 431 HOH HOH A . D 4 HOH 32 432 432 HOH HOH A . D 4 HOH 33 433 433 HOH HOH A . D 4 HOH 34 434 434 HOH HOH A . D 4 HOH 35 435 435 HOH HOH A . D 4 HOH 36 436 436 HOH HOH A . D 4 HOH 37 437 437 HOH HOH A . D 4 HOH 38 438 438 HOH HOH A . D 4 HOH 39 439 439 HOH HOH A . D 4 HOH 40 440 440 HOH HOH A . D 4 HOH 41 441 441 HOH HOH A . D 4 HOH 42 442 442 HOH HOH A . D 4 HOH 43 443 443 HOH HOH A . D 4 HOH 44 444 444 HOH HOH A . D 4 HOH 45 445 445 HOH HOH A . D 4 HOH 46 446 446 HOH HOH A . D 4 HOH 47 447 447 HOH HOH A . D 4 HOH 48 448 448 HOH HOH A . D 4 HOH 49 449 449 HOH HOH A . D 4 HOH 50 450 450 HOH HOH A . D 4 HOH 51 451 451 HOH HOH A . D 4 HOH 52 452 452 HOH HOH A . D 4 HOH 53 453 453 HOH HOH A . D 4 HOH 54 454 454 HOH HOH A . D 4 HOH 55 455 455 HOH HOH A . D 4 HOH 56 456 456 HOH HOH A . D 4 HOH 57 457 457 HOH HOH A . D 4 HOH 58 458 458 HOH HOH A . D 4 HOH 59 459 459 HOH HOH A . D 4 HOH 60 460 460 HOH HOH A . D 4 HOH 61 461 461 HOH HOH A . D 4 HOH 62 462 462 HOH HOH A . D 4 HOH 63 463 463 HOH HOH A . D 4 HOH 64 464 464 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 SOLVE phasing . ? 3 X-PLOR refinement 3.851 ? 4 # _cell.entry_id 1F3O _cell.length_a 55.210 _cell.length_b 65.200 _cell.length_c 126.880 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1F3O _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # _exptl.entry_id 1F3O _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 41.98 _exptl_crystal.density_Matthews 2.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 6.8 _exptl_crystal_grow.temp 294.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'PEG 4000, Ammonium Acetate, Glycerol, ADP, Magnesium Chloride, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 21K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 130 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type BRANDEIS _diffrn_detector.pdbx_collection_date 2000-04-20 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.932 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X12C' _diffrn_source.pdbx_wavelength 0.932 _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X12C _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1F3O _reflns.observed_criterion_sigma_I 3.0 _reflns.observed_criterion_sigma_F 1.0 _reflns.d_resolution_low 30 _reflns.d_resolution_high 2.7 _reflns.number_obs 24520 _reflns.number_all 25396 _reflns.percent_possible_obs 93.5 _reflns.pdbx_Rmerge_I_obs 0.146 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 5.5 _reflns.B_iso_Wilson_estimate 24.1 _reflns.pdbx_redundancy 4.42 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.82 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 74.5 _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 3.9 _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1F3O _refine.ls_number_reflns_obs 5971 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I 1.0 _refine.pdbx_ls_sigma_F 1.0 _refine.pdbx_data_cutoff_high_absF 1000000.00 _refine.pdbx_data_cutoff_low_absF 0.01 _refine.ls_d_res_low 30.00 _refine.ls_d_res_high 2.70 _refine.ls_percent_reflns_obs 90.9 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.204 _refine.ls_R_factor_R_free 0.277 _refine.ls_R_factor_R_free_error 0.011 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 11.1 _refine.ls_number_reflns_R_free 663 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 41.4 _refine.aniso_B[1][1] 0.09 _refine.aniso_B[2][2] 0.08 _refine.aniso_B[3][3] -0.17 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'X-Plor 3.851' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1F3O _refine_analyze.Luzzati_coordinate_error_obs 0.31 _refine_analyze.Luzzati_sigma_a_obs 0.55 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.42 _refine_analyze.Luzzati_sigma_a_free 0.97 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1835 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 64 _refine_hist.number_atoms_total 1927 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 30.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.019 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.8 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 24.3 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.67 ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 6.53 1.50 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 9.65 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 9.67 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 12.75 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 2.70 _refine_ls_shell.d_res_low 2.82 _refine_ls_shell.number_reflns_R_work 535 _refine_ls_shell.R_factor_R_work 0.368 _refine_ls_shell.percent_reflns_obs 74.5 _refine_ls_shell.R_factor_R_free 0.456 _refine_ls_shell.R_factor_R_free_error 0.057 _refine_ls_shell.percent_reflns_R_free 10.7 _refine_ls_shell.number_reflns_R_free 64 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _database_PDB_matrix.entry_id 1F3O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1F3O _struct.title 'Crystal structure of MJ0796 ATP-binding cassette' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1F3O _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS' _struct_keywords.text 'Transporter, STRUCTURAL GENOMICS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_code Y796_METJA _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession Q58206 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MIKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELTKI RRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARAL ANNPPIILADEPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVARFGERIIYLKDGEVEREEKLRGFDDR ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1F3O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 235 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q58206 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 235 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 235 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1F3O MSE A 1 ? UNP Q58206 MET 1 'modified residue' 1 1 1 1F3O MSE A 13 ? UNP Q58206 MET 13 'modified residue' 13 2 1 1F3O MSE A 37 ? UNP Q58206 MET 37 'modified residue' 37 3 1 1F3O MSE A 47 ? UNP Q58206 MET 47 'modified residue' 47 4 1 1F3O MSE A 116 ? UNP Q58206 MET 116 'modified residue' 116 5 1 1F3O MSE A 131 ? UNP Q58206 MET 131 'modified residue' 131 6 1 1F3O MSE A 185 ? UNP Q58206 MET 185 'modified residue' 185 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_565 x,-y+1,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 65.2000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a dimer' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 43 ? GLY A 52 ? GLY A 43 GLY A 52 1 ? 10 HELX_P HELX_P2 2 ASP A 73 ? LYS A 84 ? ASP A 73 LYS A 84 1 ? 12 HELX_P HELX_P3 3 THR A 99 ? TYR A 112 ? THR A 99 TYR A 112 1 ? 14 HELX_P HELX_P4 4 SER A 117 ? ALA A 132 ? SER A 117 ALA A 132 1 ? 16 HELX_P HELX_P5 5 GLU A 135 ? ALA A 139 ? GLU A 135 ALA A 139 5 ? 5 HELX_P HELX_P6 6 LYS A 142 ? LEU A 146 ? LYS A 142 LEU A 146 5 ? 5 HELX_P HELX_P7 7 SER A 147 ? ALA A 161 ? SER A 147 ALA A 161 1 ? 15 HELX_P HELX_P8 8 ASP A 177 ? GLU A 194 ? ASP A 177 GLU A 194 1 ? 18 HELX_P HELX_P9 9 ASP A 205 ? ARG A 210 ? ASP A 205 ARG A 210 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A ILE 2 N ? ? A MSE 1 A ILE 2 1_555 ? ? ? ? ? ? ? 1.305 ? ? covale2 covale both ? A LYS 12 C ? ? ? 1_555 A MSE 13 N ? ? A LYS 12 A MSE 13 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale3 covale both ? A MSE 13 C ? ? ? 1_555 A GLY 14 N ? ? A MSE 13 A GLY 14 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale4 covale both ? A ILE 36 C ? ? ? 1_555 A MSE 37 N ? ? A ILE 36 A MSE 37 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale5 covale both ? A MSE 37 C ? ? ? 1_555 A GLY 38 N ? ? A MSE 37 A GLY 38 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale6 covale both ? A THR 46 C ? ? ? 1_555 A MSE 47 N ? ? A THR 46 A MSE 47 1_555 ? ? ? ? ? ? ? 1.313 ? ? covale7 covale both ? A MSE 47 C ? ? ? 1_555 A LEU 48 N ? ? A MSE 47 A LEU 48 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale8 covale both ? A ALA 115 C ? ? ? 1_555 A MSE 116 N ? ? A ALA 115 A MSE 116 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale9 covale both ? A MSE 116 C ? ? ? 1_555 A SER 117 N ? ? A MSE 116 A SER 117 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale10 covale both ? A LYS 130 C ? ? ? 1_555 A MSE 131 N ? ? A LYS 130 A MSE 131 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale11 covale both ? A MSE 131 C ? ? ? 1_555 A ALA 132 N ? ? A MSE 131 A ALA 132 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale12 covale both ? A ILE 184 C ? ? ? 1_555 A MSE 185 N ? ? A ILE 184 A MSE 185 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale13 covale both ? A MSE 185 C ? ? ? 1_555 A GLN 186 N ? ? A MSE 185 A GLN 186 1_555 ? ? ? ? ? ? ? 1.318 ? ? metalc1 metalc ? ? A SER 45 OG ? ? ? 1_555 B MG . MG ? ? A SER 45 A MG 301 1_555 ? ? ? ? ? ? ? 1.812 ? ? metalc2 metalc ? ? C ADP . O1B ? ? ? 1_555 B MG . MG ? ? A ADP 300 A MG 301 1_555 ? ? ? ? ? ? ? 1.975 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id OG _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id SER _pdbx_struct_conn_angle.ptnr1_label_seq_id 45 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id SER _pdbx_struct_conn_angle.ptnr1_auth_seq_id 45 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id MG _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id B _pdbx_struct_conn_angle.ptnr2_label_comp_id MG _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id MG _pdbx_struct_conn_angle.ptnr2_auth_seq_id 301 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O1B _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id C _pdbx_struct_conn_angle.ptnr3_label_comp_id ADP _pdbx_struct_conn_angle.ptnr3_label_seq_id . _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id ADP _pdbx_struct_conn_angle.ptnr3_auth_seq_id 300 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 85.8 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 1 ? . . . . MSE A 1 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 13 ? . . . . MSE A 13 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 37 ? . . . . MSE A 37 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 47 ? . . . . MSE A 47 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 116 ? . . . . MSE A 116 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE A 131 ? . . . . MSE A 131 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 7 MSE A 185 ? . . . . MSE A 185 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? parallel B 4 5 ? parallel B 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 17 ? ILE A 28 ? ILE A 17 ILE A 28 A 2 ILE A 2 ? LYS A 12 ? ILE A 2 LYS A 12 A 3 GLU A 61 ? ILE A 64 ? GLU A 61 ILE A 64 A 4 ILE A 67 ? LYS A 68 ? ILE A 67 LYS A 68 B 1 ILE A 85 ? PHE A 87 ? ILE A 85 PHE A 87 B 2 ILE A 166 ? ASP A 170 ? ILE A 166 ASP A 170 B 3 THR A 198 ? THR A 203 ? THR A 198 THR A 203 B 4 VAL A 34 ? MSE A 37 ? VAL A 34 MSE A 37 B 5 ARG A 214 ? LYS A 219 ? ARG A 214 LYS A 219 B 6 GLU A 222 ? LYS A 228 ? GLU A 222 LYS A 228 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 28 ? N ILE A 28 O ILE A 2 ? O ILE A 2 A 2 3 O LYS A 5 ? O LYS A 5 N GLU A 61 ? N GLU A 61 A 3 4 N ILE A 64 ? N ILE A 64 O ILE A 67 ? O ILE A 67 B 1 2 N GLY A 86 ? N GLY A 86 O ILE A 166 ? O ILE A 166 B 2 3 N ILE A 167 ? N ILE A 167 O THR A 198 ? O THR A 198 B 3 4 O VAL A 199 ? O VAL A 199 N VAL A 34 ? N VAL A 34 B 4 5 N SER A 35 ? N SER A 35 O ARG A 214 ? O ARG A 214 B 5 6 N LYS A 219 ? N LYS A 219 O GLU A 222 ? O GLU A 222 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 301 ? 2 'BINDING SITE FOR RESIDUE MG A 301' AC2 Software A ADP 300 ? 15 'BINDING SITE FOR RESIDUE ADP A 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 SER A 45 ? SER A 45 . ? 1_555 ? 2 AC1 2 ADP C . ? ADP A 300 . ? 1_555 ? 3 AC2 15 TYR A 11 ? TYR A 11 . ? 1_555 ? 4 AC2 15 ALA A 20 ? ALA A 20 . ? 1_555 ? 5 AC2 15 PRO A 39 ? PRO A 39 . ? 1_555 ? 6 AC2 15 SER A 40 ? SER A 40 . ? 1_555 ? 7 AC2 15 GLY A 41 ? GLY A 41 . ? 1_555 ? 8 AC2 15 SER A 42 ? SER A 42 . ? 1_555 ? 9 AC2 15 GLY A 43 ? GLY A 43 . ? 1_555 ? 10 AC2 15 LYS A 44 ? LYS A 44 . ? 1_555 ? 11 AC2 15 SER A 45 ? SER A 45 . ? 1_555 ? 12 AC2 15 THR A 46 ? THR A 46 . ? 1_555 ? 13 AC2 15 LYS A 56 ? LYS A 56 . ? 4_565 ? 14 AC2 15 ALA A 115 ? ALA A 115 . ? 5_445 ? 15 AC2 15 MG B . ? MG A 301 . ? 1_555 ? 16 AC2 15 HOH D . ? HOH A 404 . ? 1_555 ? 17 AC2 15 HOH D . ? HOH A 457 . ? 4_565 ? # _pdbx_entry_details.entry_id 1F3O _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 225 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OE2 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLU _pdbx_validate_close_contact.auth_seq_id_2 227 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.05 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A GLU 15 ? ? CD A GLU 15 ? ? 1.621 1.515 0.106 0.015 N 2 1 CD A GLU 15 ? ? OE2 A GLU 15 ? ? 1.322 1.252 0.070 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A MSE 1 ? ? CB A MSE 1 ? ? CG A MSE 1 ? ? 97.13 113.30 -16.17 1.70 N 2 1 NE A ARG 122 ? ? CZ A ARG 122 ? ? NH1 A ARG 122 ? ? 123.73 120.30 3.43 0.50 N 3 1 NE A ARG 122 ? ? CZ A ARG 122 ? ? NH2 A ARG 122 ? ? 116.32 120.30 -3.98 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 23 ? ? 33.62 48.36 2 1 ASN A 27 ? ? -164.08 106.56 3 1 LYS A 44 ? ? -47.80 -71.57 4 1 GLU A 59 ? ? -168.84 -167.56 5 1 ASN A 66 ? ? 75.54 -0.08 6 1 ASN A 93 ? ? 71.74 33.35 7 1 TYR A 112 ? ? -109.37 41.04 8 1 PRO A 143 ? ? -38.60 -77.79 9 1 ASN A 144 ? ? -54.02 0.11 10 1 GLU A 194 ? ? -90.17 -60.59 11 1 ARG A 230 ? ? -134.92 -62.00 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id GLU _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 15 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.076 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 13 A MSE 13 ? MET SELENOMETHIONINE 3 A MSE 37 A MSE 37 ? MET SELENOMETHIONINE 4 A MSE 47 A MSE 47 ? MET SELENOMETHIONINE 5 A MSE 116 A MSE 116 ? MET SELENOMETHIONINE 6 A MSE 131 A MSE 131 ? MET SELENOMETHIONINE 7 A MSE 185 A MSE 185 ? MET SELENOMETHIONINE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 233 ? A ASP 233 2 1 Y 1 A ASP 234 ? A ASP 234 3 1 Y 1 A ARG 235 ? A ARG 235 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ADP PB P N N 1 ADP O1B O N N 2 ADP O2B O N N 3 ADP O3B O N N 4 ADP PA P N S 5 ADP O1A O N N 6 ADP O2A O N N 7 ADP O3A O N N 8 ADP "O5'" O N N 9 ADP "C5'" C N N 10 ADP "C4'" C N R 11 ADP "O4'" O N N 12 ADP "C3'" C N S 13 ADP "O3'" O N N 14 ADP "C2'" C N R 15 ADP "O2'" O N N 16 ADP "C1'" C N R 17 ADP N9 N Y N 18 ADP C8 C Y N 19 ADP N7 N Y N 20 ADP C5 C Y N 21 ADP C6 C Y N 22 ADP N6 N N N 23 ADP N1 N Y N 24 ADP C2 C Y N 25 ADP N3 N Y N 26 ADP C4 C Y N 27 ADP HOB2 H N N 28 ADP HOB3 H N N 29 ADP HOA2 H N N 30 ADP "H5'1" H N N 31 ADP "H5'2" H N N 32 ADP "H4'" H N N 33 ADP "H3'" H N N 34 ADP "HO3'" H N N 35 ADP "H2'" H N N 36 ADP "HO2'" H N N 37 ADP "H1'" H N N 38 ADP H8 H N N 39 ADP HN61 H N N 40 ADP HN62 H N N 41 ADP H2 H N N 42 ALA N N N N 43 ALA CA C N S 44 ALA C C N N 45 ALA O O N N 46 ALA CB C N N 47 ALA OXT O N N 48 ALA H H N N 49 ALA H2 H N N 50 ALA HA H N N 51 ALA HB1 H N N 52 ALA HB2 H N N 53 ALA HB3 H N N 54 ALA HXT H N N 55 ARG N N N N 56 ARG CA C N S 57 ARG C C N N 58 ARG O O N N 59 ARG CB C N N 60 ARG CG C N N 61 ARG CD C N N 62 ARG NE N N N 63 ARG CZ C N N 64 ARG NH1 N N N 65 ARG NH2 N N N 66 ARG OXT O N N 67 ARG H H N N 68 ARG H2 H N N 69 ARG HA H N N 70 ARG HB2 H N N 71 ARG HB3 H N N 72 ARG HG2 H N N 73 ARG HG3 H N N 74 ARG HD2 H N N 75 ARG HD3 H N N 76 ARG HE H N N 77 ARG HH11 H N N 78 ARG HH12 H N N 79 ARG HH21 H N N 80 ARG HH22 H N N 81 ARG HXT H N N 82 ASN N N N N 83 ASN CA C N S 84 ASN C C N N 85 ASN O O N N 86 ASN CB C N N 87 ASN CG C N N 88 ASN OD1 O N N 89 ASN ND2 N N N 90 ASN OXT O N N 91 ASN H H N N 92 ASN H2 H N N 93 ASN HA H N N 94 ASN HB2 H N N 95 ASN HB3 H N N 96 ASN HD21 H N N 97 ASN HD22 H N N 98 ASN HXT H N N 99 ASP N N N N 100 ASP CA C N S 101 ASP C C N N 102 ASP O O N N 103 ASP CB C N N 104 ASP CG C N N 105 ASP OD1 O N N 106 ASP OD2 O N N 107 ASP OXT O N N 108 ASP H H N N 109 ASP H2 H N N 110 ASP HA H N N 111 ASP HB2 H N N 112 ASP HB3 H N N 113 ASP HD2 H N N 114 ASP HXT H N N 115 CYS N N N N 116 CYS CA C N R 117 CYS C C N N 118 CYS O O N N 119 CYS CB C N N 120 CYS SG S N N 121 CYS OXT O N N 122 CYS H H N N 123 CYS H2 H N N 124 CYS HA H N N 125 CYS HB2 H N N 126 CYS HB3 H N N 127 CYS HG H N N 128 CYS HXT H N N 129 GLN N N N N 130 GLN CA C N S 131 GLN C C N N 132 GLN O O N N 133 GLN CB C N N 134 GLN CG C N N 135 GLN CD C N N 136 GLN OE1 O N N 137 GLN NE2 N N N 138 GLN OXT O N N 139 GLN H H N N 140 GLN H2 H N N 141 GLN HA H N N 142 GLN HB2 H N N 143 GLN HB3 H N N 144 GLN HG2 H N N 145 GLN HG3 H N N 146 GLN HE21 H N N 147 GLN HE22 H N N 148 GLN HXT H N N 149 GLU N N N N 150 GLU CA C N S 151 GLU C C N N 152 GLU O O N N 153 GLU CB C N N 154 GLU CG C N N 155 GLU CD C N N 156 GLU OE1 O N N 157 GLU OE2 O N N 158 GLU OXT O N N 159 GLU H H N N 160 GLU H2 H N N 161 GLU HA H N N 162 GLU HB2 H N N 163 GLU HB3 H N N 164 GLU HG2 H N N 165 GLU HG3 H N N 166 GLU HE2 H N N 167 GLU HXT H N N 168 GLY N N N N 169 GLY CA C N N 170 GLY C C N N 171 GLY O O N N 172 GLY OXT O N N 173 GLY H H N N 174 GLY H2 H N N 175 GLY HA2 H N N 176 GLY HA3 H N N 177 GLY HXT H N N 178 HIS N N N N 179 HIS CA C N S 180 HIS C C N N 181 HIS O O N N 182 HIS CB C N N 183 HIS CG C Y N 184 HIS ND1 N Y N 185 HIS CD2 C Y N 186 HIS CE1 C Y N 187 HIS NE2 N Y N 188 HIS OXT O N N 189 HIS H H N N 190 HIS H2 H N N 191 HIS HA H N N 192 HIS HB2 H N N 193 HIS HB3 H N N 194 HIS HD1 H N N 195 HIS HD2 H N N 196 HIS HE1 H N N 197 HIS HE2 H N N 198 HIS HXT H N N 199 HOH O O N N 200 HOH H1 H N N 201 HOH H2 H N N 202 ILE N N N N 203 ILE CA C N S 204 ILE C C N N 205 ILE O O N N 206 ILE CB C N S 207 ILE CG1 C N N 208 ILE CG2 C N N 209 ILE CD1 C N N 210 ILE OXT O N N 211 ILE H H N N 212 ILE H2 H N N 213 ILE HA H N N 214 ILE HB H N N 215 ILE HG12 H N N 216 ILE HG13 H N N 217 ILE HG21 H N N 218 ILE HG22 H N N 219 ILE HG23 H N N 220 ILE HD11 H N N 221 ILE HD12 H N N 222 ILE HD13 H N N 223 ILE HXT H N N 224 LEU N N N N 225 LEU CA C N S 226 LEU C C N N 227 LEU O O N N 228 LEU CB C N N 229 LEU CG C N N 230 LEU CD1 C N N 231 LEU CD2 C N N 232 LEU OXT O N N 233 LEU H H N N 234 LEU H2 H N N 235 LEU HA H N N 236 LEU HB2 H N N 237 LEU HB3 H N N 238 LEU HG H N N 239 LEU HD11 H N N 240 LEU HD12 H N N 241 LEU HD13 H N N 242 LEU HD21 H N N 243 LEU HD22 H N N 244 LEU HD23 H N N 245 LEU HXT H N N 246 LYS N N N N 247 LYS CA C N S 248 LYS C C N N 249 LYS O O N N 250 LYS CB C N N 251 LYS CG C N N 252 LYS CD C N N 253 LYS CE C N N 254 LYS NZ N N N 255 LYS OXT O N N 256 LYS H H N N 257 LYS H2 H N N 258 LYS HA H N N 259 LYS HB2 H N N 260 LYS HB3 H N N 261 LYS HG2 H N N 262 LYS HG3 H N N 263 LYS HD2 H N N 264 LYS HD3 H N N 265 LYS HE2 H N N 266 LYS HE3 H N N 267 LYS HZ1 H N N 268 LYS HZ2 H N N 269 LYS HZ3 H N N 270 LYS HXT H N N 271 MET N N N N 272 MET CA C N S 273 MET C C N N 274 MET O O N N 275 MET CB C N N 276 MET CG C N N 277 MET SD S N N 278 MET CE C N N 279 MET OXT O N N 280 MET H H N N 281 MET H2 H N N 282 MET HA H N N 283 MET HB2 H N N 284 MET HB3 H N N 285 MET HG2 H N N 286 MET HG3 H N N 287 MET HE1 H N N 288 MET HE2 H N N 289 MET HE3 H N N 290 MET HXT H N N 291 MG MG MG N N 292 MSE N N N N 293 MSE CA C N S 294 MSE C C N N 295 MSE O O N N 296 MSE OXT O N N 297 MSE CB C N N 298 MSE CG C N N 299 MSE SE SE N N 300 MSE CE C N N 301 MSE H H N N 302 MSE H2 H N N 303 MSE HA H N N 304 MSE HXT H N N 305 MSE HB2 H N N 306 MSE HB3 H N N 307 MSE HG2 H N N 308 MSE HG3 H N N 309 MSE HE1 H N N 310 MSE HE2 H N N 311 MSE HE3 H N N 312 PHE N N N N 313 PHE CA C N S 314 PHE C C N N 315 PHE O O N N 316 PHE CB C N N 317 PHE CG C Y N 318 PHE CD1 C Y N 319 PHE CD2 C Y N 320 PHE CE1 C Y N 321 PHE CE2 C Y N 322 PHE CZ C Y N 323 PHE OXT O N N 324 PHE H H N N 325 PHE H2 H N N 326 PHE HA H N N 327 PHE HB2 H N N 328 PHE HB3 H N N 329 PHE HD1 H N N 330 PHE HD2 H N N 331 PHE HE1 H N N 332 PHE HE2 H N N 333 PHE HZ H N N 334 PHE HXT H N N 335 PRO N N N N 336 PRO CA C N S 337 PRO C C N N 338 PRO O O N N 339 PRO CB C N N 340 PRO CG C N N 341 PRO CD C N N 342 PRO OXT O N N 343 PRO H H N N 344 PRO HA H N N 345 PRO HB2 H N N 346 PRO HB3 H N N 347 PRO HG2 H N N 348 PRO HG3 H N N 349 PRO HD2 H N N 350 PRO HD3 H N N 351 PRO HXT H N N 352 SER N N N N 353 SER CA C N S 354 SER C C N N 355 SER O O N N 356 SER CB C N N 357 SER OG O N N 358 SER OXT O N N 359 SER H H N N 360 SER H2 H N N 361 SER HA H N N 362 SER HB2 H N N 363 SER HB3 H N N 364 SER HG H N N 365 SER HXT H N N 366 THR N N N N 367 THR CA C N S 368 THR C C N N 369 THR O O N N 370 THR CB C N R 371 THR OG1 O N N 372 THR CG2 C N N 373 THR OXT O N N 374 THR H H N N 375 THR H2 H N N 376 THR HA H N N 377 THR HB H N N 378 THR HG1 H N N 379 THR HG21 H N N 380 THR HG22 H N N 381 THR HG23 H N N 382 THR HXT H N N 383 TYR N N N N 384 TYR CA C N S 385 TYR C C N N 386 TYR O O N N 387 TYR CB C N N 388 TYR CG C Y N 389 TYR CD1 C Y N 390 TYR CD2 C Y N 391 TYR CE1 C Y N 392 TYR CE2 C Y N 393 TYR CZ C Y N 394 TYR OH O N N 395 TYR OXT O N N 396 TYR H H N N 397 TYR H2 H N N 398 TYR HA H N N 399 TYR HB2 H N N 400 TYR HB3 H N N 401 TYR HD1 H N N 402 TYR HD2 H N N 403 TYR HE1 H N N 404 TYR HE2 H N N 405 TYR HH H N N 406 TYR HXT H N N 407 VAL N N N N 408 VAL CA C N S 409 VAL C C N N 410 VAL O O N N 411 VAL CB C N N 412 VAL CG1 C N N 413 VAL CG2 C N N 414 VAL OXT O N N 415 VAL H H N N 416 VAL H2 H N N 417 VAL HA H N N 418 VAL HB H N N 419 VAL HG11 H N N 420 VAL HG12 H N N 421 VAL HG13 H N N 422 VAL HG21 H N N 423 VAL HG22 H N N 424 VAL HG23 H N N 425 VAL HXT H N N 426 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ADP PB O1B doub N N 1 ADP PB O2B sing N N 2 ADP PB O3B sing N N 3 ADP PB O3A sing N N 4 ADP O2B HOB2 sing N N 5 ADP O3B HOB3 sing N N 6 ADP PA O1A doub N N 7 ADP PA O2A sing N N 8 ADP PA O3A sing N N 9 ADP PA "O5'" sing N N 10 ADP O2A HOA2 sing N N 11 ADP "O5'" "C5'" sing N N 12 ADP "C5'" "C4'" sing N N 13 ADP "C5'" "H5'1" sing N N 14 ADP "C5'" "H5'2" sing N N 15 ADP "C4'" "O4'" sing N N 16 ADP "C4'" "C3'" sing N N 17 ADP "C4'" "H4'" sing N N 18 ADP "O4'" "C1'" sing N N 19 ADP "C3'" "O3'" sing N N 20 ADP "C3'" "C2'" sing N N 21 ADP "C3'" "H3'" sing N N 22 ADP "O3'" "HO3'" sing N N 23 ADP "C2'" "O2'" sing N N 24 ADP "C2'" "C1'" sing N N 25 ADP "C2'" "H2'" sing N N 26 ADP "O2'" "HO2'" sing N N 27 ADP "C1'" N9 sing N N 28 ADP "C1'" "H1'" sing N N 29 ADP N9 C8 sing Y N 30 ADP N9 C4 sing Y N 31 ADP C8 N7 doub Y N 32 ADP C8 H8 sing N N 33 ADP N7 C5 sing Y N 34 ADP C5 C6 sing Y N 35 ADP C5 C4 doub Y N 36 ADP C6 N6 sing N N 37 ADP C6 N1 doub Y N 38 ADP N6 HN61 sing N N 39 ADP N6 HN62 sing N N 40 ADP N1 C2 sing Y N 41 ADP C2 N3 doub Y N 42 ADP C2 H2 sing N N 43 ADP N3 C4 sing Y N 44 ALA N CA sing N N 45 ALA N H sing N N 46 ALA N H2 sing N N 47 ALA CA C sing N N 48 ALA CA CB sing N N 49 ALA CA HA sing N N 50 ALA C O doub N N 51 ALA C OXT sing N N 52 ALA CB HB1 sing N N 53 ALA CB HB2 sing N N 54 ALA CB HB3 sing N N 55 ALA OXT HXT sing N N 56 ARG N CA sing N N 57 ARG N H sing N N 58 ARG N H2 sing N N 59 ARG CA C sing N N 60 ARG CA CB sing N N 61 ARG CA HA sing N N 62 ARG C O doub N N 63 ARG C OXT sing N N 64 ARG CB CG sing N N 65 ARG CB HB2 sing N N 66 ARG CB HB3 sing N N 67 ARG CG CD sing N N 68 ARG CG HG2 sing N N 69 ARG CG HG3 sing N N 70 ARG CD NE sing N N 71 ARG CD HD2 sing N N 72 ARG CD HD3 sing N N 73 ARG NE CZ sing N N 74 ARG NE HE sing N N 75 ARG CZ NH1 sing N N 76 ARG CZ NH2 doub N N 77 ARG NH1 HH11 sing N N 78 ARG NH1 HH12 sing N N 79 ARG NH2 HH21 sing N N 80 ARG NH2 HH22 sing N N 81 ARG OXT HXT sing N N 82 ASN N CA sing N N 83 ASN N H sing N N 84 ASN N H2 sing N N 85 ASN CA C sing N N 86 ASN CA CB sing N N 87 ASN CA HA sing N N 88 ASN C O doub N N 89 ASN C OXT sing N N 90 ASN CB CG sing N N 91 ASN CB HB2 sing N N 92 ASN CB HB3 sing N N 93 ASN CG OD1 doub N N 94 ASN CG ND2 sing N N 95 ASN ND2 HD21 sing N N 96 ASN ND2 HD22 sing N N 97 ASN OXT HXT sing N N 98 ASP N CA sing N N 99 ASP N H sing N N 100 ASP N H2 sing N N 101 ASP CA C sing N N 102 ASP CA CB sing N N 103 ASP CA HA sing N N 104 ASP C O doub N N 105 ASP C OXT sing N N 106 ASP CB CG sing N N 107 ASP CB HB2 sing N N 108 ASP CB HB3 sing N N 109 ASP CG OD1 doub N N 110 ASP CG OD2 sing N N 111 ASP OD2 HD2 sing N N 112 ASP OXT HXT sing N N 113 CYS N CA sing N N 114 CYS N H sing N N 115 CYS N H2 sing N N 116 CYS CA C sing N N 117 CYS CA CB sing N N 118 CYS CA HA sing N N 119 CYS C O doub N N 120 CYS C OXT sing N N 121 CYS CB SG sing N N 122 CYS CB HB2 sing N N 123 CYS CB HB3 sing N N 124 CYS SG HG sing N N 125 CYS OXT HXT sing N N 126 GLN N CA sing N N 127 GLN N H sing N N 128 GLN N H2 sing N N 129 GLN CA C sing N N 130 GLN CA CB sing N N 131 GLN CA HA sing N N 132 GLN C O doub N N 133 GLN C OXT sing N N 134 GLN CB CG sing N N 135 GLN CB HB2 sing N N 136 GLN CB HB3 sing N N 137 GLN CG CD sing N N 138 GLN CG HG2 sing N N 139 GLN CG HG3 sing N N 140 GLN CD OE1 doub N N 141 GLN CD NE2 sing N N 142 GLN NE2 HE21 sing N N 143 GLN NE2 HE22 sing N N 144 GLN OXT HXT sing N N 145 GLU N CA sing N N 146 GLU N H sing N N 147 GLU N H2 sing N N 148 GLU CA C sing N N 149 GLU CA CB sing N N 150 GLU CA HA sing N N 151 GLU C O doub N N 152 GLU C OXT sing N N 153 GLU CB CG sing N N 154 GLU CB HB2 sing N N 155 GLU CB HB3 sing N N 156 GLU CG CD sing N N 157 GLU CG HG2 sing N N 158 GLU CG HG3 sing N N 159 GLU CD OE1 doub N N 160 GLU CD OE2 sing N N 161 GLU OE2 HE2 sing N N 162 GLU OXT HXT sing N N 163 GLY N CA sing N N 164 GLY N H sing N N 165 GLY N H2 sing N N 166 GLY CA C sing N N 167 GLY CA HA2 sing N N 168 GLY CA HA3 sing N N 169 GLY C O doub N N 170 GLY C OXT sing N N 171 GLY OXT HXT sing N N 172 HIS N CA sing N N 173 HIS N H sing N N 174 HIS N H2 sing N N 175 HIS CA C sing N N 176 HIS CA CB sing N N 177 HIS CA HA sing N N 178 HIS C O doub N N 179 HIS C OXT sing N N 180 HIS CB CG sing N N 181 HIS CB HB2 sing N N 182 HIS CB HB3 sing N N 183 HIS CG ND1 sing Y N 184 HIS CG CD2 doub Y N 185 HIS ND1 CE1 doub Y N 186 HIS ND1 HD1 sing N N 187 HIS CD2 NE2 sing Y N 188 HIS CD2 HD2 sing N N 189 HIS CE1 NE2 sing Y N 190 HIS CE1 HE1 sing N N 191 HIS NE2 HE2 sing N N 192 HIS OXT HXT sing N N 193 HOH O H1 sing N N 194 HOH O H2 sing N N 195 ILE N CA sing N N 196 ILE N H sing N N 197 ILE N H2 sing N N 198 ILE CA C sing N N 199 ILE CA CB sing N N 200 ILE CA HA sing N N 201 ILE C O doub N N 202 ILE C OXT sing N N 203 ILE CB CG1 sing N N 204 ILE CB CG2 sing N N 205 ILE CB HB sing N N 206 ILE CG1 CD1 sing N N 207 ILE CG1 HG12 sing N N 208 ILE CG1 HG13 sing N N 209 ILE CG2 HG21 sing N N 210 ILE CG2 HG22 sing N N 211 ILE CG2 HG23 sing N N 212 ILE CD1 HD11 sing N N 213 ILE CD1 HD12 sing N N 214 ILE CD1 HD13 sing N N 215 ILE OXT HXT sing N N 216 LEU N CA sing N N 217 LEU N H sing N N 218 LEU N H2 sing N N 219 LEU CA C sing N N 220 LEU CA CB sing N N 221 LEU CA HA sing N N 222 LEU C O doub N N 223 LEU C OXT sing N N 224 LEU CB CG sing N N 225 LEU CB HB2 sing N N 226 LEU CB HB3 sing N N 227 LEU CG CD1 sing N N 228 LEU CG CD2 sing N N 229 LEU CG HG sing N N 230 LEU CD1 HD11 sing N N 231 LEU CD1 HD12 sing N N 232 LEU CD1 HD13 sing N N 233 LEU CD2 HD21 sing N N 234 LEU CD2 HD22 sing N N 235 LEU CD2 HD23 sing N N 236 LEU OXT HXT sing N N 237 LYS N CA sing N N 238 LYS N H sing N N 239 LYS N H2 sing N N 240 LYS CA C sing N N 241 LYS CA CB sing N N 242 LYS CA HA sing N N 243 LYS C O doub N N 244 LYS C OXT sing N N 245 LYS CB CG sing N N 246 LYS CB HB2 sing N N 247 LYS CB HB3 sing N N 248 LYS CG CD sing N N 249 LYS CG HG2 sing N N 250 LYS CG HG3 sing N N 251 LYS CD CE sing N N 252 LYS CD HD2 sing N N 253 LYS CD HD3 sing N N 254 LYS CE NZ sing N N 255 LYS CE HE2 sing N N 256 LYS CE HE3 sing N N 257 LYS NZ HZ1 sing N N 258 LYS NZ HZ2 sing N N 259 LYS NZ HZ3 sing N N 260 LYS OXT HXT sing N N 261 MET N CA sing N N 262 MET N H sing N N 263 MET N H2 sing N N 264 MET CA C sing N N 265 MET CA CB sing N N 266 MET CA HA sing N N 267 MET C O doub N N 268 MET C OXT sing N N 269 MET CB CG sing N N 270 MET CB HB2 sing N N 271 MET CB HB3 sing N N 272 MET CG SD sing N N 273 MET CG HG2 sing N N 274 MET CG HG3 sing N N 275 MET SD CE sing N N 276 MET CE HE1 sing N N 277 MET CE HE2 sing N N 278 MET CE HE3 sing N N 279 MET OXT HXT sing N N 280 MSE N CA sing N N 281 MSE N H sing N N 282 MSE N H2 sing N N 283 MSE CA C sing N N 284 MSE CA CB sing N N 285 MSE CA HA sing N N 286 MSE C O doub N N 287 MSE C OXT sing N N 288 MSE OXT HXT sing N N 289 MSE CB CG sing N N 290 MSE CB HB2 sing N N 291 MSE CB HB3 sing N N 292 MSE CG SE sing N N 293 MSE CG HG2 sing N N 294 MSE CG HG3 sing N N 295 MSE SE CE sing N N 296 MSE CE HE1 sing N N 297 MSE CE HE2 sing N N 298 MSE CE HE3 sing N N 299 PHE N CA sing N N 300 PHE N H sing N N 301 PHE N H2 sing N N 302 PHE CA C sing N N 303 PHE CA CB sing N N 304 PHE CA HA sing N N 305 PHE C O doub N N 306 PHE C OXT sing N N 307 PHE CB CG sing N N 308 PHE CB HB2 sing N N 309 PHE CB HB3 sing N N 310 PHE CG CD1 doub Y N 311 PHE CG CD2 sing Y N 312 PHE CD1 CE1 sing Y N 313 PHE CD1 HD1 sing N N 314 PHE CD2 CE2 doub Y N 315 PHE CD2 HD2 sing N N 316 PHE CE1 CZ doub Y N 317 PHE CE1 HE1 sing N N 318 PHE CE2 CZ sing Y N 319 PHE CE2 HE2 sing N N 320 PHE CZ HZ sing N N 321 PHE OXT HXT sing N N 322 PRO N CA sing N N 323 PRO N CD sing N N 324 PRO N H sing N N 325 PRO CA C sing N N 326 PRO CA CB sing N N 327 PRO CA HA sing N N 328 PRO C O doub N N 329 PRO C OXT sing N N 330 PRO CB CG sing N N 331 PRO CB HB2 sing N N 332 PRO CB HB3 sing N N 333 PRO CG CD sing N N 334 PRO CG HG2 sing N N 335 PRO CG HG3 sing N N 336 PRO CD HD2 sing N N 337 PRO CD HD3 sing N N 338 PRO OXT HXT sing N N 339 SER N CA sing N N 340 SER N H sing N N 341 SER N H2 sing N N 342 SER CA C sing N N 343 SER CA CB sing N N 344 SER CA HA sing N N 345 SER C O doub N N 346 SER C OXT sing N N 347 SER CB OG sing N N 348 SER CB HB2 sing N N 349 SER CB HB3 sing N N 350 SER OG HG sing N N 351 SER OXT HXT sing N N 352 THR N CA sing N N 353 THR N H sing N N 354 THR N H2 sing N N 355 THR CA C sing N N 356 THR CA CB sing N N 357 THR CA HA sing N N 358 THR C O doub N N 359 THR C OXT sing N N 360 THR CB OG1 sing N N 361 THR CB CG2 sing N N 362 THR CB HB sing N N 363 THR OG1 HG1 sing N N 364 THR CG2 HG21 sing N N 365 THR CG2 HG22 sing N N 366 THR CG2 HG23 sing N N 367 THR OXT HXT sing N N 368 TYR N CA sing N N 369 TYR N H sing N N 370 TYR N H2 sing N N 371 TYR CA C sing N N 372 TYR CA CB sing N N 373 TYR CA HA sing N N 374 TYR C O doub N N 375 TYR C OXT sing N N 376 TYR CB CG sing N N 377 TYR CB HB2 sing N N 378 TYR CB HB3 sing N N 379 TYR CG CD1 doub Y N 380 TYR CG CD2 sing Y N 381 TYR CD1 CE1 sing Y N 382 TYR CD1 HD1 sing N N 383 TYR CD2 CE2 doub Y N 384 TYR CD2 HD2 sing N N 385 TYR CE1 CZ doub Y N 386 TYR CE1 HE1 sing N N 387 TYR CE2 CZ sing Y N 388 TYR CE2 HE2 sing N N 389 TYR CZ OH sing N N 390 TYR OH HH sing N N 391 TYR OXT HXT sing N N 392 VAL N CA sing N N 393 VAL N H sing N N 394 VAL N H2 sing N N 395 VAL CA C sing N N 396 VAL CA CB sing N N 397 VAL CA HA sing N N 398 VAL C O doub N N 399 VAL C OXT sing N N 400 VAL CB CG1 sing N N 401 VAL CB CG2 sing N N 402 VAL CB HB sing N N 403 VAL CG1 HG11 sing N N 404 VAL CG1 HG12 sing N N 405 VAL CG1 HG13 sing N N 406 VAL CG2 HG21 sing N N 407 VAL CG2 HG22 sing N N 408 VAL CG2 HG23 sing N N 409 VAL OXT HXT sing N N 410 # _atom_sites.entry_id 1F3O _atom_sites.fract_transf_matrix[1][1] 0.018113 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015337 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007881 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S SE # loop_