data_1F55 # _entry.id 1F55 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1F55 pdb_00001f55 10.2210/pdb1f55/pdb RCSB RCSB011255 ? ? WWPDB D_1000011255 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-07-15 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-16 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.value' 14 4 'Structure model' '_struct_conn.pdbx_dist_value' 15 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 27 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1F55 _pdbx_database_status.recvd_initial_deposition_date 2000-06-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1F54 _pdbx_database_related.details '1F54 is the apo-form of the same protein' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ishida, H.' 1 'Takahashi, K.' 2 'Nakashima, K.' 3 'Kumaki, Y.' 4 'Nakata, M.' 5 'Hikichi, K.' 6 'Yazawa, M.' 7 # _citation.id primary _citation.title ;Solution Structures of the N-terminal Domain of Yeast Calmodulin: Ca2+-Dependent Conformational Change and Its Functional Implication ; _citation.journal_abbrev Biochemistry _citation.journal_volume 39 _citation.page_first 13660 _citation.page_last 13668 _citation.year 2000 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11076504 _citation.pdbx_database_id_DOI 10.1021/bi000582x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ishida, H.' 1 ? primary 'Takahashi, K.' 2 ? primary 'Nakashima, K.' 3 ? primary 'Kumaki, Y.' 4 ? primary 'Nakata, M.' 5 ? primary 'Hikichi, K.' 6 ? primary 'Yazawa, M.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man CALMODULIN 8546.367 1 ? ? 'N-TERMINAL DOMAIN' 'INTRACELLULAR CALCIUM SENSOR' 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLK _entity_poly.pdbx_seq_one_letter_code_can SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 ASN n 1 4 LEU n 1 5 THR n 1 6 GLU n 1 7 GLU n 1 8 GLN n 1 9 ILE n 1 10 ALA n 1 11 GLU n 1 12 PHE n 1 13 LYS n 1 14 GLU n 1 15 ALA n 1 16 PHE n 1 17 ALA n 1 18 LEU n 1 19 PHE n 1 20 ASP n 1 21 LYS n 1 22 ASP n 1 23 ASN n 1 24 ASN n 1 25 GLY n 1 26 SER n 1 27 ILE n 1 28 SER n 1 29 SER n 1 30 SER n 1 31 GLU n 1 32 LEU n 1 33 ALA n 1 34 THR n 1 35 VAL n 1 36 MET n 1 37 ARG n 1 38 SER n 1 39 LEU n 1 40 GLY n 1 41 LEU n 1 42 SER n 1 43 PRO n 1 44 SER n 1 45 GLU n 1 46 ALA n 1 47 GLU n 1 48 VAL n 1 49 ASN n 1 50 ASP n 1 51 LEU n 1 52 MET n 1 53 ASN n 1 54 GLU n 1 55 ILE n 1 56 ASP n 1 57 VAL n 1 58 ASP n 1 59 GLY n 1 60 ASN n 1 61 HIS n 1 62 GLN n 1 63 ILE n 1 64 GLU n 1 65 PHE n 1 66 SER n 1 67 GLU n 1 68 PHE n 1 69 LEU n 1 70 ALA n 1 71 LEU n 1 72 MET n 1 73 SER n 1 74 ARG n 1 75 GLN n 1 76 LEU n 1 77 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET-30B(+) AND PIC10' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 101 1 CA CA A . C 2 CA 1 102 2 CA CA A . # _exptl.entry_id 1F55 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1F55 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1F55 _struct.title 'SOLUTION STRUCTURE OF THE CALCIUM BOUND N-TERMINAL DOMAIN OF YEAST CALMODULIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1F55 _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'EF-hand, helix-loop-helix, TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_code CALM_YEAST _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P06787 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1F55 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06787 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 77 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 5 ? ASP A 20 ? THR A 5 ASP A 20 1 ? 16 HELX_P HELX_P2 2 SER A 29 ? LEU A 41 ? SER A 29 LEU A 41 1 ? 13 HELX_P HELX_P3 3 SER A 44 ? ASP A 56 ? SER A 44 ASP A 56 1 ? 13 HELX_P HELX_P4 4 PHE A 65 ? MET A 72 ? PHE A 65 MET A 72 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 20 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 20 A CA 101 1_555 ? ? ? ? ? ? ? 3.246 ? ? metalc2 metalc ? ? A ASP 20 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 20 A CA 101 1_555 ? ? ? ? ? ? ? 2.800 ? ? metalc3 metalc ? ? A ASP 22 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 22 A CA 101 1_555 ? ? ? ? ? ? ? 2.807 ? ? metalc4 metalc ? ? A ASN 24 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 24 A CA 101 1_555 ? ? ? ? ? ? ? 2.819 ? ? metalc5 metalc ? ? A SER 26 O ? ? ? 1_555 B CA . CA ? ? A SER 26 A CA 101 1_555 ? ? ? ? ? ? ? 2.813 ? ? metalc6 metalc ? ? A GLU 31 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 101 1_555 ? ? ? ? ? ? ? 2.804 ? ? metalc7 metalc ? ? A GLU 31 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 101 1_555 ? ? ? ? ? ? ? 2.805 ? ? metalc8 metalc ? ? A ASP 56 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 56 A CA 102 1_555 ? ? ? ? ? ? ? 2.803 ? ? metalc9 metalc ? ? A ASP 58 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 58 A CA 102 1_555 ? ? ? ? ? ? ? 3.126 ? ? metalc10 metalc ? ? A ASP 58 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 58 A CA 102 1_555 ? ? ? ? ? ? ? 2.482 ? ? metalc11 metalc ? ? A ASN 60 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 60 A CA 102 1_555 ? ? ? ? ? ? ? 2.787 ? ? metalc12 metalc ? ? A ASN 60 ND2 ? ? ? 1_555 C CA . CA ? ? A ASN 60 A CA 102 1_555 ? ? ? ? ? ? ? 3.071 ? ? metalc13 metalc ? ? A GLN 62 O ? ? ? 1_555 C CA . CA ? ? A GLN 62 A CA 102 1_555 ? ? ? ? ? ? ? 2.478 ? ? metalc14 metalc ? ? A GLU 67 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 102 1_555 ? ? ? ? ? ? ? 2.780 ? ? metalc15 metalc ? ? A GLU 67 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 102 1_555 ? ? ? ? ? ? ? 2.725 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 40.9 ? 2 OD2 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 115.7 ? 3 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 76.7 ? 4 OD2 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASN 24 ? A ASN 24 ? 1_555 102.0 ? 5 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASN 24 ? A ASN 24 ? 1_555 108.9 ? 6 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OD1 ? A ASN 24 ? A ASN 24 ? 1_555 81.1 ? 7 OD2 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A SER 26 ? A SER 26 ? 1_555 51.6 ? 8 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A SER 26 ? A SER 26 ? 1_555 72.3 ? 9 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A SER 26 ? A SER 26 ? 1_555 134.8 ? 10 OD1 ? A ASN 24 ? A ASN 24 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 O ? A SER 26 ? A SER 26 ? 1_555 140.0 ? 11 OD2 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 103.5 ? 12 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 84.1 ? 13 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 78.2 ? 14 OD1 ? A ASN 24 ? A ASN 24 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 152.2 ? 15 O ? A SER 26 ? A SER 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 66.7 ? 16 OD2 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 86.6 ? 17 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 49.3 ? 18 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 49.2 ? 19 OD1 ? A ASN 24 ? A ASN 24 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 126.7 ? 20 O ? A SER 26 ? A SER 26 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 85.6 ? 21 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 101 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 45.2 ? 22 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 78.0 ? 23 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 52.0 ? 24 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 43.3 ? 25 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 49.4 ? 26 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 58.1 ? 27 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 70.9 ? 28 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 92.4 ? 29 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 53.3 ? 30 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 92.0 ? 31 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 43.4 ? 32 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLN 62 ? A GLN 62 ? 1_555 52.0 ? 33 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLN 62 ? A GLN 62 ? 1_555 109.9 ? 34 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLN 62 ? A GLN 62 ? 1_555 103.0 ? 35 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLN 62 ? A GLN 62 ? 1_555 52.2 ? 36 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 O ? A GLN 62 ? A GLN 62 ? 1_555 80.2 ? 37 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 84.7 ? 38 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 123.2 ? 39 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 84.1 ? 40 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 134.0 ? 41 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 176.0 ? 42 O ? A GLN 62 ? A GLN 62 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 100.0 ? 43 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 119.7 ? 44 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 99.5 ? 45 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 85.1 ? 46 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 155.0 ? 47 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 134.3 ? 48 O ? A GLN 62 ? A GLN 62 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 144.8 ? 49 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 102 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 46.1 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 26 ? SER A 28 ? SER A 26 SER A 28 A 2 GLN A 62 ? GLU A 64 ? GLN A 62 GLU A 64 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 27 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 63 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 63 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 101 ? 5 'BINDING SITE FOR RESIDUE CA A 101' AC2 Software A CA 102 ? 6 'BINDING SITE FOR RESIDUE CA A 102' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 20 ? ASP A 20 . ? 1_555 ? 2 AC1 5 ASP A 22 ? ASP A 22 . ? 1_555 ? 3 AC1 5 ASN A 24 ? ASN A 24 . ? 1_555 ? 4 AC1 5 SER A 26 ? SER A 26 . ? 1_555 ? 5 AC1 5 GLU A 31 ? GLU A 31 . ? 1_555 ? 6 AC2 6 ASP A 56 ? ASP A 56 . ? 1_555 ? 7 AC2 6 ASP A 58 ? ASP A 58 . ? 1_555 ? 8 AC2 6 ASN A 60 ? ASN A 60 . ? 1_555 ? 9 AC2 6 GLN A 62 ? GLN A 62 . ? 1_555 ? 10 AC2 6 ILE A 63 ? ILE A 63 . ? 1_555 ? 11 AC2 6 GLU A 67 ? GLU A 67 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.51 2 1 O A PHE 12 ? ? H A PHE 16 ? ? 1.56 3 1 OD1 A ASP 20 ? ? H A ASP 22 ? ? 1.59 4 2 OD2 A ASP 20 ? ? H A ASP 22 ? ? 1.49 5 3 O A THR 34 ? ? H A ARG 37 ? ? 1.49 6 3 OD2 A ASP 20 ? ? H A ASP 22 ? ? 1.49 7 4 O A ASP 20 ? ? H A ASN 23 ? ? 1.56 8 5 OD2 A ASP 20 ? ? H A ASP 22 ? ? 1.48 9 6 H A ILE 27 ? ? O A ILE 63 ? ? 1.52 10 6 O A ASP 20 ? ? H A ASN 23 ? ? 1.55 11 6 O A PHE 12 ? ? H A PHE 16 ? ? 1.58 12 7 O A PHE 12 ? ? H A PHE 16 ? ? 1.57 13 8 O A PHE 12 ? ? H A PHE 16 ? ? 1.55 14 8 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.58 15 9 O A ASP 50 ? ? H A GLU 54 ? ? 1.52 16 9 O A PHE 12 ? ? H A PHE 16 ? ? 1.58 17 9 O A ASP 20 ? ? H A ASP 22 ? ? 1.58 18 10 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.56 19 11 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.58 20 12 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.52 21 12 O A PHE 12 ? ? H A PHE 16 ? ? 1.57 22 13 O A ASP 50 ? ? H A GLU 54 ? ? 1.45 23 13 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.54 24 13 O A MET 36 ? ? H A LEU 41 ? ? 1.59 25 13 O A THR 34 ? ? H A ARG 37 ? ? 1.60 26 14 O A SER 30 ? ? HG1 A THR 34 ? ? 1.44 27 14 O A ASP 20 ? ? H A ASN 23 ? ? 1.53 28 14 O A ASP 50 ? ? H A GLU 54 ? ? 1.57 29 14 O A PHE 12 ? ? H A PHE 16 ? ? 1.59 30 15 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.53 31 15 O A PHE 12 ? ? H A PHE 16 ? ? 1.57 32 15 O A SER 1 ? ? H A ASN 3 ? ? 1.58 33 15 H A ILE 27 ? ? O A ILE 63 ? ? 1.60 34 16 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.49 35 16 OD2 A ASP 20 ? ? H A ASN 24 ? ? 1.49 36 16 O A ASN 49 ? ? H A ASN 53 ? ? 1.51 37 16 O A PHE 12 ? ? H A PHE 16 ? ? 1.57 38 16 O A ASP 50 ? ? H A GLU 54 ? ? 1.58 39 17 H A GLU 64 ? ? OE1 A GLU 67 ? ? 1.53 40 17 O A PHE 12 ? ? H A PHE 16 ? ? 1.59 41 17 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.60 42 18 O A ASP 50 ? ? H A GLU 54 ? ? 1.45 43 18 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.48 44 18 O A PHE 12 ? ? H A PHE 16 ? ? 1.59 45 19 OD1 A ASP 20 ? ? H A ASP 22 ? ? 1.55 46 20 O A PHE 12 ? ? H A PHE 16 ? ? 1.55 47 21 O A PHE 12 ? ? H A PHE 16 ? ? 1.53 48 21 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.59 49 22 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.54 50 22 O A PHE 12 ? ? H A PHE 16 ? ? 1.59 51 23 O A ALA 17 ? ? H A LYS 21 ? ? 1.53 52 23 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.54 53 23 O A ASP 20 ? ? H A ASP 22 ? ? 1.56 54 23 O A PHE 12 ? ? H A PHE 16 ? ? 1.59 55 24 O A PHE 12 ? ? H A PHE 16 ? ? 1.49 56 24 O A GLU 31 ? ? H A THR 34 ? ? 1.59 57 25 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.49 58 25 OD2 A ASP 20 ? ? H A ASP 22 ? ? 1.49 59 27 OD1 A ASP 20 ? ? H A ASN 23 ? ? 1.45 60 27 O A THR 34 ? ? H A ARG 37 ? ? 1.50 61 27 O A ASP 50 ? ? H A GLU 54 ? ? 1.51 62 27 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.51 63 27 O A MET 36 ? ? H A LEU 41 ? ? 1.52 64 27 O A PHE 12 ? ? H A PHE 16 ? ? 1.58 65 27 O A ASN 49 ? ? H A ASN 53 ? ? 1.58 66 28 O A ASP 50 ? ? H A GLU 54 ? ? 1.47 67 29 O A LEU 4 ? ? HG1 A THR 5 ? ? 1.50 68 29 O A THR 34 ? ? HE A ARG 37 ? ? 1.53 69 29 O A ALA 33 ? ? H A MET 36 ? ? 1.58 70 30 HG A SER 26 ? ? OE1 A GLN 62 ? ? 1.46 71 30 OD1 A ASP 20 ? ? H A ASN 23 ? ? 1.46 72 30 O A PHE 12 ? ? H A PHE 16 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 4 ? ? -115.68 -108.97 2 1 THR A 5 ? ? 49.76 -144.35 3 1 LEU A 41 ? ? -144.10 -42.98 4 1 ASP A 56 ? ? -64.15 90.35 5 1 PHE A 65 ? ? -44.71 -71.35 6 1 MET A 72 ? ? -58.95 -92.00 7 1 ARG A 74 ? ? 61.07 -142.22 8 1 GLN A 75 ? ? -163.76 -46.06 9 1 LEU A 76 ? ? -132.55 -76.24 10 2 LEU A 4 ? ? -92.82 -119.42 11 2 THR A 5 ? ? 52.24 -145.08 12 2 ASP A 22 ? ? -155.38 20.02 13 2 ASN A 23 ? ? 42.23 29.78 14 2 SER A 28 ? ? -106.13 -158.77 15 2 GLU A 31 ? ? -42.34 -71.32 16 2 SER A 42 ? ? -176.92 64.15 17 2 ASP A 56 ? ? -56.22 95.28 18 2 PHE A 65 ? ? -43.32 -71.33 19 2 SER A 66 ? ? -34.93 -35.12 20 2 MET A 72 ? ? -51.66 -90.07 21 2 ARG A 74 ? ? 61.47 129.79 22 2 GLN A 75 ? ? -143.48 -54.63 23 2 LEU A 76 ? ? -47.56 175.25 24 3 ASN A 3 ? ? 57.47 94.53 25 3 LEU A 4 ? ? -81.54 -106.35 26 3 THR A 5 ? ? 51.40 -146.17 27 3 ASP A 22 ? ? -162.91 20.53 28 3 ASN A 23 ? ? 41.40 27.14 29 3 LEU A 39 ? ? -134.70 -62.71 30 3 SER A 42 ? ? -158.15 48.32 31 3 SER A 44 ? ? 69.53 145.71 32 3 ASN A 60 ? ? -97.60 34.34 33 3 HIS A 61 ? ? 58.36 13.82 34 3 PHE A 65 ? ? -50.28 -70.07 35 3 MET A 72 ? ? -68.50 -79.61 36 3 GLN A 75 ? ? 64.26 -147.09 37 4 ASN A 3 ? ? -128.46 -145.79 38 4 LEU A 4 ? ? -84.73 -115.13 39 4 THR A 5 ? ? 52.04 -145.98 40 4 SER A 29 ? ? -53.22 -87.20 41 4 GLU A 31 ? ? -42.66 -79.05 42 4 LEU A 41 ? ? -54.65 172.90 43 4 SER A 44 ? ? 67.67 147.02 44 4 PHE A 65 ? ? -58.05 -71.11 45 4 MET A 72 ? ? -61.54 -80.54 46 4 SER A 73 ? ? -44.24 164.03 47 5 SER A 2 ? ? -144.37 -74.29 48 5 LEU A 4 ? ? -114.87 -134.03 49 5 THR A 5 ? ? 50.33 -142.30 50 5 ASP A 22 ? ? -172.41 26.48 51 5 ASN A 23 ? ? 39.40 28.57 52 5 LEU A 41 ? ? -53.86 96.69 53 5 SER A 42 ? ? -175.39 56.35 54 5 PRO A 43 ? ? -77.75 -160.28 55 5 VAL A 48 ? ? -42.29 -70.80 56 5 ASP A 56 ? ? -64.30 92.63 57 5 PHE A 65 ? ? -44.12 -73.04 58 5 MET A 72 ? ? -66.57 -82.57 59 6 LEU A 4 ? ? -120.51 -107.70 60 6 THR A 5 ? ? 51.39 -145.79 61 6 SER A 28 ? ? -110.06 -161.22 62 6 SER A 29 ? ? -64.03 -88.82 63 6 MET A 36 ? ? -93.09 -74.32 64 6 SER A 38 ? ? -61.50 -88.21 65 6 LEU A 41 ? ? -174.83 148.39 66 6 PRO A 43 ? ? -72.92 -90.05 67 6 SER A 44 ? ? 175.13 162.64 68 6 PHE A 65 ? ? -66.36 -72.63 69 6 MET A 72 ? ? -49.08 -80.92 70 6 ARG A 74 ? ? 63.10 -157.99 71 6 GLN A 75 ? ? -106.46 -152.93 72 7 SER A 2 ? ? -108.10 -89.18 73 7 THR A 5 ? ? 36.76 -128.00 74 7 GLU A 6 ? ? -38.19 -29.92 75 7 SER A 28 ? ? -79.22 -168.17 76 7 LEU A 39 ? ? -119.59 51.17 77 7 LEU A 41 ? ? 56.07 161.33 78 7 VAL A 57 ? ? -142.91 -36.80 79 7 PHE A 65 ? ? -44.66 -71.45 80 7 SER A 66 ? ? -35.39 -37.96 81 7 ARG A 74 ? ? 42.65 93.40 82 7 GLN A 75 ? ? -65.59 -155.96 83 7 LEU A 76 ? ? 47.12 86.16 84 8 SER A 2 ? ? -164.59 30.29 85 8 THR A 5 ? ? 44.40 -138.44 86 8 ASP A 22 ? ? -168.84 24.66 87 8 SER A 38 ? ? -57.87 -85.86 88 8 LEU A 41 ? ? 179.93 -162.86 89 8 SER A 42 ? ? -175.99 57.09 90 8 PRO A 43 ? ? -74.25 -159.69 91 8 ASP A 56 ? ? -62.97 75.90 92 8 PHE A 65 ? ? -47.24 -73.28 93 8 SER A 73 ? ? 47.01 -91.58 94 8 ARG A 74 ? ? -177.51 -54.19 95 8 GLN A 75 ? ? -83.72 -157.84 96 9 SER A 2 ? ? 55.24 -85.65 97 9 LEU A 4 ? ? -86.69 -111.68 98 9 THR A 5 ? ? 52.13 -146.47 99 9 LYS A 21 ? ? 64.11 -61.30 100 9 ASN A 23 ? ? 40.05 28.60 101 9 SER A 28 ? ? -111.72 -165.51 102 9 LEU A 41 ? ? 59.56 170.91 103 9 PRO A 43 ? ? -74.04 -159.85 104 9 PHE A 65 ? ? -66.79 -74.45 105 9 SER A 66 ? ? -34.99 -35.13 106 9 ARG A 74 ? ? 61.57 157.16 107 9 GLN A 75 ? ? -106.21 -152.72 108 10 LEU A 4 ? ? -85.37 -113.46 109 10 THR A 5 ? ? 55.14 -151.25 110 10 SER A 42 ? ? -161.12 65.22 111 10 VAL A 57 ? ? -138.38 -35.10 112 10 PHE A 65 ? ? -44.33 -70.71 113 10 MET A 72 ? ? -62.14 -80.97 114 10 LEU A 76 ? ? 61.16 144.07 115 11 LEU A 4 ? ? -89.95 -108.54 116 11 THR A 5 ? ? 54.65 -150.71 117 11 SER A 28 ? ? -104.84 -166.37 118 11 SER A 38 ? ? -46.06 -82.36 119 11 PRO A 43 ? ? -72.58 -89.94 120 11 SER A 44 ? ? 177.19 162.99 121 11 VAL A 57 ? ? -131.84 -33.49 122 11 PHE A 65 ? ? -44.81 -73.35 123 11 MET A 72 ? ? -70.91 -79.50 124 11 SER A 73 ? ? -46.10 96.92 125 11 LEU A 76 ? ? -77.67 -151.47 126 12 ASN A 3 ? ? 52.83 -141.73 127 12 LEU A 4 ? ? -97.21 -102.21 128 12 THR A 5 ? ? 49.26 -146.17 129 12 SER A 28 ? ? -102.95 -167.24 130 12 SER A 29 ? ? -59.19 -77.00 131 12 GLU A 31 ? ? -42.76 -73.22 132 12 PRO A 43 ? ? -74.63 -159.56 133 12 ASP A 56 ? ? -61.86 84.88 134 12 PHE A 65 ? ? -44.53 -72.15 135 12 SER A 73 ? ? -70.53 -141.70 136 12 ARG A 74 ? ? 50.62 -160.56 137 12 GLN A 75 ? ? 55.52 -85.21 138 12 LEU A 76 ? ? -160.77 -41.93 139 13 SER A 2 ? ? -168.14 113.44 140 13 LEU A 4 ? ? -118.85 -138.48 141 13 THR A 5 ? ? 47.67 -140.72 142 13 ASP A 22 ? ? -164.06 22.99 143 13 ASN A 23 ? ? 41.34 29.11 144 13 LEU A 41 ? ? 56.54 89.41 145 13 SER A 42 ? ? -163.68 51.94 146 13 GLU A 45 ? ? -34.82 -34.05 147 13 ASP A 56 ? ? -48.60 92.54 148 13 PHE A 65 ? ? -67.06 -72.58 149 13 MET A 72 ? ? -67.97 -79.07 150 13 SER A 73 ? ? 41.05 -145.65 151 14 ASN A 3 ? ? -75.69 -155.85 152 14 LEU A 4 ? ? -90.35 -109.32 153 14 THR A 5 ? ? 51.73 -145.96 154 14 SER A 28 ? ? -157.44 -147.06 155 14 SER A 29 ? ? -72.50 -90.77 156 14 GLU A 31 ? ? -63.87 -72.78 157 14 LEU A 41 ? ? -52.45 93.78 158 14 SER A 42 ? ? -162.04 50.59 159 14 SER A 44 ? ? 69.73 145.63 160 14 PHE A 65 ? ? -44.70 -71.98 161 14 MET A 72 ? ? -53.78 -71.23 162 14 GLN A 75 ? ? -82.47 -152.67 163 15 SER A 2 ? ? -67.27 59.89 164 15 LEU A 4 ? ? -106.28 -136.68 165 15 THR A 5 ? ? 48.37 -142.53 166 15 ASP A 22 ? ? -178.02 26.75 167 15 ASN A 23 ? ? 36.71 29.09 168 15 SER A 28 ? ? -125.79 -157.83 169 15 SER A 38 ? ? -56.47 -78.88 170 15 LEU A 41 ? ? 173.63 124.25 171 15 PRO A 43 ? ? -74.82 -91.27 172 15 SER A 44 ? ? 174.33 156.36 173 15 PHE A 65 ? ? -67.64 -72.84 174 15 SER A 66 ? ? -34.81 -38.63 175 15 GLN A 75 ? ? 52.83 171.33 176 15 LEU A 76 ? ? 47.58 -156.60 177 16 LEU A 4 ? ? -102.01 -120.14 178 16 THR A 5 ? ? 51.42 -145.31 179 16 ASP A 22 ? ? -170.35 25.14 180 16 ASN A 23 ? ? 36.34 35.62 181 16 SER A 28 ? ? -129.54 -165.49 182 16 LEU A 41 ? ? -59.22 89.58 183 16 SER A 42 ? ? -156.89 47.57 184 16 SER A 44 ? ? 70.98 141.75 185 16 ASP A 56 ? ? -69.45 80.64 186 16 PHE A 65 ? ? -65.28 -71.75 187 16 SER A 66 ? ? -34.83 -38.71 188 16 MET A 72 ? ? -60.08 -81.44 189 16 SER A 73 ? ? -59.25 94.01 190 16 ARG A 74 ? ? -99.46 -62.59 191 16 GLN A 75 ? ? 55.50 -158.87 192 17 LEU A 4 ? ? -127.09 -121.46 193 17 THR A 5 ? ? 52.65 -145.43 194 17 SER A 28 ? ? -103.66 -165.03 195 17 SER A 29 ? ? -60.40 -77.00 196 17 VAL A 35 ? ? -156.50 -44.99 197 17 LEU A 41 ? ? 175.46 124.78 198 17 PRO A 43 ? ? -73.89 -159.59 199 17 ASP A 56 ? ? -59.83 79.65 200 17 PHE A 65 ? ? -49.50 -74.62 201 17 MET A 72 ? ? -70.35 -81.05 202 17 SER A 73 ? ? -45.73 163.92 203 17 GLN A 75 ? ? -60.34 -151.90 204 17 LEU A 76 ? ? -150.82 77.12 205 18 ASN A 3 ? ? -146.07 -43.67 206 18 LEU A 4 ? ? -102.18 -137.07 207 18 THR A 5 ? ? 52.38 -146.03 208 18 ASP A 22 ? ? 179.07 -26.72 209 18 LEU A 41 ? ? -58.30 93.46 210 18 SER A 42 ? ? -161.39 50.31 211 18 SER A 44 ? ? 69.28 145.20 212 18 ASP A 56 ? ? -61.50 77.63 213 18 PHE A 65 ? ? -61.08 -70.58 214 18 MET A 72 ? ? -66.10 -87.84 215 18 ARG A 74 ? ? -160.26 59.79 216 18 GLN A 75 ? ? -73.97 -166.89 217 19 SER A 2 ? ? -100.15 -169.01 218 19 ASN A 3 ? ? 57.74 -142.46 219 19 THR A 5 ? ? 37.44 -133.07 220 19 GLU A 6 ? ? -36.63 -30.25 221 19 GLU A 31 ? ? -76.86 -82.17 222 19 SER A 38 ? ? -50.28 -85.16 223 19 LEU A 41 ? ? -92.36 -153.98 224 19 SER A 42 ? ? -174.66 55.96 225 19 PRO A 43 ? ? -74.66 -159.71 226 19 GLU A 45 ? ? -35.80 -39.10 227 19 ASP A 56 ? ? -63.90 81.99 228 19 HIS A 61 ? ? 58.45 14.05 229 19 PHE A 65 ? ? -44.68 -71.23 230 19 MET A 72 ? ? -64.48 -79.62 231 19 ARG A 74 ? ? 54.15 105.49 232 19 GLN A 75 ? ? -71.77 -153.14 233 20 SER A 2 ? ? 57.77 -167.87 234 20 ASN A 3 ? ? 59.13 104.76 235 20 THR A 5 ? ? 45.82 -139.69 236 20 GLU A 6 ? ? -39.63 -34.42 237 20 ASP A 22 ? ? -161.10 20.11 238 20 ASN A 23 ? ? 39.27 37.34 239 20 LEU A 41 ? ? 46.58 -175.79 240 20 SER A 42 ? ? -174.55 52.44 241 20 VAL A 48 ? ? -52.99 -70.37 242 20 ASP A 56 ? ? -65.03 85.62 243 20 PHE A 65 ? ? -57.18 -73.15 244 20 MET A 72 ? ? -64.96 -76.04 245 20 SER A 73 ? ? -52.24 177.46 246 20 ARG A 74 ? ? -118.54 -141.61 247 20 GLN A 75 ? ? -170.11 -76.35 248 21 SER A 2 ? ? -174.48 47.04 249 21 ASN A 3 ? ? -167.98 93.50 250 21 THR A 5 ? ? 44.04 -137.87 251 21 LEU A 39 ? ? -132.32 -66.04 252 21 LEU A 41 ? ? -67.05 89.75 253 21 SER A 42 ? ? -159.27 51.91 254 21 SER A 44 ? ? 57.68 127.00 255 21 VAL A 48 ? ? -51.09 -73.40 256 21 ASP A 56 ? ? -69.23 89.95 257 21 PHE A 65 ? ? -44.49 -72.38 258 21 MET A 72 ? ? -59.07 -70.01 259 21 SER A 73 ? ? -56.46 -160.45 260 21 LEU A 76 ? ? 43.09 72.00 261 22 ASN A 3 ? ? -163.86 -158.35 262 22 LEU A 4 ? ? -160.02 -101.69 263 22 THR A 5 ? ? 47.28 -141.57 264 22 SER A 28 ? ? -119.21 -167.81 265 22 LEU A 39 ? ? -123.43 -71.76 266 22 LEU A 41 ? ? -68.60 88.80 267 22 SER A 42 ? ? -156.37 47.18 268 22 SER A 44 ? ? 70.81 143.05 269 22 ASP A 56 ? ? -63.84 71.43 270 22 PHE A 65 ? ? -48.22 -71.89 271 22 MET A 72 ? ? -75.36 -79.12 272 22 SER A 73 ? ? 49.34 -90.46 273 22 ARG A 74 ? ? 51.56 174.77 274 22 GLN A 75 ? ? -140.61 -89.54 275 22 LEU A 76 ? ? -163.42 61.87 276 23 SER A 2 ? ? -70.38 -77.28 277 23 LEU A 4 ? ? -108.54 -136.62 278 23 THR A 5 ? ? 47.83 -141.47 279 23 LYS A 21 ? ? 66.44 -57.26 280 23 SER A 28 ? ? -119.21 -163.96 281 23 MET A 36 ? ? -140.95 -63.59 282 23 LEU A 41 ? ? 55.99 161.84 283 23 PRO A 43 ? ? -74.97 -159.42 284 23 VAL A 57 ? ? -132.88 -34.67 285 23 PHE A 65 ? ? -64.32 -70.49 286 23 SER A 66 ? ? -35.14 -38.51 287 23 MET A 72 ? ? -76.83 -74.72 288 23 ARG A 74 ? ? 54.97 93.95 289 23 GLN A 75 ? ? -101.28 -162.43 290 23 LEU A 76 ? ? 43.16 -159.02 291 24 LEU A 4 ? ? -102.39 -128.36 292 24 THR A 5 ? ? 50.87 -143.75 293 24 LYS A 21 ? ? 43.83 26.56 294 24 ASP A 22 ? ? -146.52 -29.73 295 24 MET A 36 ? ? -128.90 -63.81 296 24 LEU A 39 ? ? -110.12 53.97 297 24 PRO A 43 ? ? -72.52 -159.80 298 24 PHE A 65 ? ? -44.43 -71.00 299 24 ARG A 74 ? ? 65.02 178.74 300 24 GLN A 75 ? ? -79.66 -150.55 301 24 LEU A 76 ? ? -126.68 -62.34 302 25 LEU A 4 ? ? -93.63 -121.96 303 25 THR A 5 ? ? 51.38 -144.64 304 25 ASP A 22 ? ? -166.23 24.02 305 25 LEU A 39 ? ? -152.76 -63.90 306 25 SER A 44 ? ? 67.86 146.96 307 25 ASP A 56 ? ? -58.01 82.16 308 25 PHE A 65 ? ? -50.62 -71.91 309 25 MET A 72 ? ? -73.45 -78.72 310 25 SER A 73 ? ? -102.35 -153.45 311 25 ARG A 74 ? ? 60.49 -142.98 312 25 GLN A 75 ? ? 56.83 -163.16 313 25 LEU A 76 ? ? -49.75 98.54 314 26 ASN A 3 ? ? 54.43 167.29 315 26 LEU A 4 ? ? -97.52 -104.23 316 26 THR A 5 ? ? 51.14 -147.10 317 26 SER A 28 ? ? -112.45 -166.66 318 26 SER A 29 ? ? -63.85 -71.60 319 26 LEU A 39 ? ? -99.88 -67.96 320 26 LEU A 41 ? ? -61.59 -165.18 321 26 VAL A 57 ? ? -135.72 -35.45 322 26 PHE A 65 ? ? -49.87 -71.60 323 26 MET A 72 ? ? -77.96 -81.35 324 26 LEU A 76 ? ? 57.25 163.07 325 27 SER A 2 ? ? 48.76 70.19 326 27 LEU A 4 ? ? -103.62 -130.48 327 27 THR A 5 ? ? 49.79 -142.81 328 27 LEU A 41 ? ? 56.11 96.74 329 27 SER A 42 ? ? -177.42 57.64 330 27 GLU A 45 ? ? -35.34 -38.67 331 27 ASP A 56 ? ? -61.26 77.12 332 27 PHE A 65 ? ? -44.62 -70.87 333 27 MET A 72 ? ? -59.68 -80.02 334 27 SER A 73 ? ? -42.97 166.51 335 27 GLN A 75 ? ? -149.51 -38.24 336 28 ASN A 3 ? ? -140.23 48.88 337 28 THR A 5 ? ? 44.40 -138.25 338 28 SER A 29 ? ? -61.08 -87.73 339 28 GLU A 31 ? ? -45.53 -71.49 340 28 LEU A 41 ? ? -53.14 97.49 341 28 SER A 42 ? ? -179.02 58.78 342 28 GLU A 45 ? ? -34.90 -36.25 343 28 PHE A 65 ? ? -45.28 -73.17 344 28 MET A 72 ? ? -74.32 -79.16 345 29 SER A 2 ? ? -93.68 -90.65 346 29 ASN A 3 ? ? 171.68 176.21 347 29 LEU A 4 ? ? -107.04 -124.79 348 29 THR A 5 ? ? 50.72 -143.25 349 29 SER A 28 ? ? -140.08 -157.47 350 29 LEU A 39 ? ? -162.29 -37.71 351 29 LEU A 41 ? ? 55.95 161.33 352 29 PRO A 43 ? ? -73.12 -89.82 353 29 VAL A 57 ? ? -134.05 -34.79 354 29 PHE A 65 ? ? -61.16 -71.50 355 29 MET A 72 ? ? -65.32 -80.22 356 29 GLN A 75 ? ? 60.23 -168.94 357 30 SER A 2 ? ? -143.29 -150.30 358 30 LEU A 4 ? ? -89.12 -116.63 359 30 THR A 5 ? ? 52.41 -146.52 360 30 SER A 29 ? ? -56.37 -84.75 361 30 GLU A 31 ? ? -42.51 -79.18 362 30 VAL A 35 ? ? -155.50 -42.74 363 30 LEU A 41 ? ? -175.18 105.69 364 30 PRO A 43 ? ? -74.23 -159.81 365 30 PHE A 65 ? ? -44.65 -71.70 366 30 MET A 72 ? ? -54.42 -70.74 367 30 ARG A 74 ? ? -144.05 -88.90 368 30 GLN A 75 ? ? -134.98 -146.11 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 37 ? ? 0.146 'SIDE CHAIN' 2 1 ARG A 74 ? ? 0.300 'SIDE CHAIN' 3 2 ARG A 37 ? ? 0.226 'SIDE CHAIN' 4 2 ARG A 74 ? ? 0.268 'SIDE CHAIN' 5 3 ARG A 37 ? ? 0.292 'SIDE CHAIN' 6 3 ARG A 74 ? ? 0.284 'SIDE CHAIN' 7 4 ARG A 37 ? ? 0.228 'SIDE CHAIN' 8 4 ARG A 74 ? ? 0.305 'SIDE CHAIN' 9 5 ARG A 37 ? ? 0.175 'SIDE CHAIN' 10 5 ARG A 74 ? ? 0.237 'SIDE CHAIN' 11 6 ARG A 37 ? ? 0.312 'SIDE CHAIN' 12 6 ARG A 74 ? ? 0.202 'SIDE CHAIN' 13 7 ARG A 37 ? ? 0.289 'SIDE CHAIN' 14 7 ARG A 74 ? ? 0.317 'SIDE CHAIN' 15 8 ARG A 37 ? ? 0.304 'SIDE CHAIN' 16 8 ARG A 74 ? ? 0.298 'SIDE CHAIN' 17 9 ARG A 37 ? ? 0.318 'SIDE CHAIN' 18 9 ARG A 74 ? ? 0.197 'SIDE CHAIN' 19 10 ARG A 37 ? ? 0.248 'SIDE CHAIN' 20 10 ARG A 74 ? ? 0.216 'SIDE CHAIN' 21 11 ARG A 37 ? ? 0.279 'SIDE CHAIN' 22 11 ARG A 74 ? ? 0.152 'SIDE CHAIN' 23 12 ARG A 37 ? ? 0.222 'SIDE CHAIN' 24 12 ARG A 74 ? ? 0.306 'SIDE CHAIN' 25 13 ARG A 37 ? ? 0.317 'SIDE CHAIN' 26 13 ARG A 74 ? ? 0.263 'SIDE CHAIN' 27 14 ARG A 37 ? ? 0.279 'SIDE CHAIN' 28 14 ARG A 74 ? ? 0.237 'SIDE CHAIN' 29 15 ARG A 37 ? ? 0.225 'SIDE CHAIN' 30 15 ARG A 74 ? ? 0.309 'SIDE CHAIN' 31 16 ARG A 37 ? ? 0.284 'SIDE CHAIN' 32 16 ARG A 74 ? ? 0.261 'SIDE CHAIN' 33 17 ARG A 37 ? ? 0.215 'SIDE CHAIN' 34 17 ARG A 74 ? ? 0.278 'SIDE CHAIN' 35 18 ARG A 37 ? ? 0.318 'SIDE CHAIN' 36 18 ARG A 74 ? ? 0.207 'SIDE CHAIN' 37 19 ARG A 37 ? ? 0.197 'SIDE CHAIN' 38 19 ARG A 74 ? ? 0.227 'SIDE CHAIN' 39 20 ARG A 37 ? ? 0.173 'SIDE CHAIN' 40 20 ARG A 74 ? ? 0.283 'SIDE CHAIN' 41 21 ARG A 37 ? ? 0.283 'SIDE CHAIN' 42 21 ARG A 74 ? ? 0.153 'SIDE CHAIN' 43 22 ARG A 37 ? ? 0.309 'SIDE CHAIN' 44 22 ARG A 74 ? ? 0.308 'SIDE CHAIN' 45 23 ARG A 37 ? ? 0.133 'SIDE CHAIN' 46 23 ARG A 74 ? ? 0.198 'SIDE CHAIN' 47 24 ARG A 37 ? ? 0.088 'SIDE CHAIN' 48 24 ARG A 74 ? ? 0.278 'SIDE CHAIN' 49 25 ARG A 37 ? ? 0.079 'SIDE CHAIN' 50 25 ARG A 74 ? ? 0.201 'SIDE CHAIN' 51 26 ARG A 37 ? ? 0.317 'SIDE CHAIN' 52 26 ARG A 74 ? ? 0.197 'SIDE CHAIN' 53 27 ARG A 37 ? ? 0.100 'SIDE CHAIN' 54 27 ARG A 74 ? ? 0.259 'SIDE CHAIN' 55 28 ARG A 37 ? ? 0.253 'SIDE CHAIN' 56 28 ARG A 74 ? ? 0.317 'SIDE CHAIN' 57 29 ARG A 37 ? ? 0.158 'SIDE CHAIN' 58 29 ARG A 74 ? ? 0.314 'SIDE CHAIN' 59 30 ARG A 37 ? ? 0.296 'SIDE CHAIN' 60 30 ARG A 74 ? ? 0.317 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1F55 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '5 mM N-terminal domain of Yeast Calmodulin; 50 mM KCl; 15 mM CaCl2; 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '3 mM N-terminal domain of Yeast Calmodulin U-15N; 50 mM KCl; 9 mM CaCl2; 90% H2O, 10% D2O' '90% H2O/10% D2O' 3 '3 mM N-terminal domain of Yeast Calmodulin; 50 mM KCl; 9 mM CaCl2; 99.99% D2O' '99.99% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM KCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 DQF-COSY 3 1 1 '2D TOCSY' 4 2 1 3D_15N-separated_NOESY 5 2 1 3D_15N-separated_TOCSY 6 2 1 15N-HSQC 7 3 1 '2D NOESY' # _pdbx_nmr_details.entry_id 1F55 _pdbx_nmr_details.text 'The structure was determined using double-resonance NMR spectroscopy on 15N-labeled protein' # _pdbx_nmr_refine.entry_id 1F55 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structures are based on a total of 920 restraints, 863 are NOE-derived distance constraints, 17 dihedral angle restraints, 28 distance restraints from hydrogen bonds, 12 calcium-ligand distance restraints ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.851 'structure solution' Brunger 1 X-PLOR 3.851 refinement Brunger 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MET N N N N 214 MET CA C N S 215 MET C C N N 216 MET O O N N 217 MET CB C N N 218 MET CG C N N 219 MET SD S N N 220 MET CE C N N 221 MET OXT O N N 222 MET H H N N 223 MET H2 H N N 224 MET HA H N N 225 MET HB2 H N N 226 MET HB3 H N N 227 MET HG2 H N N 228 MET HG3 H N N 229 MET HE1 H N N 230 MET HE2 H N N 231 MET HE3 H N N 232 MET HXT H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 PRO N N N N 257 PRO CA C N S 258 PRO C C N N 259 PRO O O N N 260 PRO CB C N N 261 PRO CG C N N 262 PRO CD C N N 263 PRO OXT O N N 264 PRO H H N N 265 PRO HA H N N 266 PRO HB2 H N N 267 PRO HB3 H N N 268 PRO HG2 H N N 269 PRO HG3 H N N 270 PRO HD2 H N N 271 PRO HD3 H N N 272 PRO HXT H N N 273 SER N N N N 274 SER CA C N S 275 SER C C N N 276 SER O O N N 277 SER CB C N N 278 SER OG O N N 279 SER OXT O N N 280 SER H H N N 281 SER H2 H N N 282 SER HA H N N 283 SER HB2 H N N 284 SER HB3 H N N 285 SER HG H N N 286 SER HXT H N N 287 THR N N N N 288 THR CA C N S 289 THR C C N N 290 THR O O N N 291 THR CB C N R 292 THR OG1 O N N 293 THR CG2 C N N 294 THR OXT O N N 295 THR H H N N 296 THR H2 H N N 297 THR HA H N N 298 THR HB H N N 299 THR HG1 H N N 300 THR HG21 H N N 301 THR HG22 H N N 302 THR HG23 H N N 303 THR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 VAL N CA sing N N 291 VAL N H sing N N 292 VAL N H2 sing N N 293 VAL CA C sing N N 294 VAL CA CB sing N N 295 VAL CA HA sing N N 296 VAL C O doub N N 297 VAL C OXT sing N N 298 VAL CB CG1 sing N N 299 VAL CB CG2 sing N N 300 VAL CB HB sing N N 301 VAL CG1 HG11 sing N N 302 VAL CG1 HG12 sing N N 303 VAL CG1 HG13 sing N N 304 VAL CG2 HG21 sing N N 305 VAL CG2 HG22 sing N N 306 VAL CG2 HG23 sing N N 307 VAL OXT HXT sing N N 308 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? JEOL A 500 2 ? JEOL A 600 # _atom_sites.entry_id 1F55 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_