data_1F62
# 
_entry.id   1F62 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.391 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1F62         pdb_00001f62 10.2210/pdb1f62/pdb 
RCSB  RCSB011287   ?            ?                   
WWPDB D_1000011287 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-12-27 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-11-06 
5 'Structure model' 1 4 2024-05-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Database references'       
8 5 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_related  
2 4 'Structure model' pdbx_struct_assembly   
3 4 'Structure model' pdbx_struct_oper_list  
4 5 'Structure model' chem_comp_atom         
5 5 'Structure model' chem_comp_bond         
6 5 'Structure model' database_2             
7 5 'Structure model' pdbx_struct_conn_angle 
8 5 'Structure model' struct_conn            
9 5 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_pdbx_database_related.db_id'                
2  5 'Structure model' '_database_2.pdbx_DOI'                        
3  5 'Structure model' '_database_2.pdbx_database_accession'         
4  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
5  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
6  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
7  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
8  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
9  5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
14 5 'Structure model' '_pdbx_struct_conn_angle.value'               
15 5 'Structure model' '_struct_conn.pdbx_dist_value'                
16 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
17 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
18 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
19 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
20 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
21 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
22 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
23 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
24 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
25 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
26 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
27 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
28 5 'Structure model' '_struct_site.pdbx_auth_asym_id'              
29 5 'Structure model' '_struct_site.pdbx_auth_comp_id'              
30 5 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1F62 
_pdbx_database_status.recvd_initial_deposition_date   2000-06-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          2913 
_pdbx_database_related.details        'chemical shift list' 
_pdbx_database_related.content_type   unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pascual, J.'         1 
'Martinez-Yamout, M.' 2 
'Dyson, H.J.'         3 
'Wright, P.E.'        4 
# 
_citation.id                        primary 
_citation.title                     'Structure of the PHD zinc finger from human Williams-Beuren syndrome transcription factor.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            304 
_citation.page_first                723 
_citation.page_last                 729 
_citation.year                      2000 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11124022 
_citation.pdbx_database_id_DOI      10.1006/jmbi.2000.4113 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pascual, J.'         1 ? 
primary 'Martinez-Yamout, M.' 2 ? 
primary 'Dyson, H.J.'         3 ? 
primary 'Wright, P.E.'        4 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'TRANSCRIPTION FACTOR WSTF' 5822.804 1 ? ? 'PHD ZINC FINGER' ? 
2 non-polymer syn 'ZINC ION'                  65.409   2 ? ? ?                 ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       ARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPAT 
_entity_poly.pdbx_seq_one_letter_code_can   ARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPAT 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  ARG n 
1 3  CYS n 
1 4  LYS n 
1 5  VAL n 
1 6  CYS n 
1 7  ARG n 
1 8  LYS n 
1 9  LYS n 
1 10 GLY n 
1 11 GLU n 
1 12 ASP n 
1 13 ASP n 
1 14 LYS n 
1 15 LEU n 
1 16 ILE n 
1 17 LEU n 
1 18 CYS n 
1 19 ASP n 
1 20 GLU n 
1 21 CYS n 
1 22 ASN n 
1 23 LYS n 
1 24 ALA n 
1 25 PHE n 
1 26 HIS n 
1 27 LEU n 
1 28 PHE n 
1 29 CYS n 
1 30 LEU n 
1 31 ARG n 
1 32 PRO n 
1 33 ALA n 
1 34 LEU n 
1 35 TYR n 
1 36 GLU n 
1 37 VAL n 
1 38 PRO n 
1 39 ASP n 
1 40 GLY n 
1 41 GLU n 
1 42 TRP n 
1 43 GLN n 
1 44 CYS n 
1 45 PRO n 
1 46 ALA n 
1 47 CYS n 
1 48 GLN n 
1 49 PRO n 
1 50 ALA n 
1 51 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  ARG 2  2  2  ARG ARG A . n 
A 1 3  CYS 3  3  3  CYS CYS A . n 
A 1 4  LYS 4  4  4  LYS LYS A . n 
A 1 5  VAL 5  5  5  VAL VAL A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  ARG 7  7  7  ARG ARG A . n 
A 1 8  LYS 8  8  8  LYS LYS A . n 
A 1 9  LYS 9  9  9  LYS LYS A . n 
A 1 10 GLY 10 10 10 GLY GLY A . n 
A 1 11 GLU 11 11 11 GLU GLU A . n 
A 1 12 ASP 12 12 12 ASP ASP A . n 
A 1 13 ASP 13 13 13 ASP ASP A . n 
A 1 14 LYS 14 14 14 LYS LYS A . n 
A 1 15 LEU 15 15 15 LEU LEU A . n 
A 1 16 ILE 16 16 16 ILE ILE A . n 
A 1 17 LEU 17 17 17 LEU LEU A . n 
A 1 18 CYS 18 18 18 CYS CYS A . n 
A 1 19 ASP 19 19 19 ASP ASP A . n 
A 1 20 GLU 20 20 20 GLU GLU A . n 
A 1 21 CYS 21 21 21 CYS CYS A . n 
A 1 22 ASN 22 22 22 ASN ASN A . n 
A 1 23 LYS 23 23 23 LYS LYS A . n 
A 1 24 ALA 24 24 24 ALA ALA A . n 
A 1 25 PHE 25 25 25 PHE PHE A . n 
A 1 26 HIS 26 26 26 HIS HIS A . n 
A 1 27 LEU 27 27 27 LEU LEU A . n 
A 1 28 PHE 28 28 28 PHE PHE A . n 
A 1 29 CYS 29 29 29 CYS CYS A . n 
A 1 30 LEU 30 30 30 LEU LEU A . n 
A 1 31 ARG 31 31 31 ARG ARG A . n 
A 1 32 PRO 32 32 32 PRO PRO A . n 
A 1 33 ALA 33 33 33 ALA ALA A . n 
A 1 34 LEU 34 34 34 LEU LEU A . n 
A 1 35 TYR 35 35 35 TYR TYR A . n 
A 1 36 GLU 36 36 36 GLU GLU A . n 
A 1 37 VAL 37 37 37 VAL VAL A . n 
A 1 38 PRO 38 38 38 PRO PRO A . n 
A 1 39 ASP 39 39 39 ASP ASP A . n 
A 1 40 GLY 40 40 40 GLY GLY A . n 
A 1 41 GLU 41 41 41 GLU GLU A . n 
A 1 42 TRP 42 42 42 TRP TRP A . n 
A 1 43 GLN 43 43 43 GLN GLN A . n 
A 1 44 CYS 44 44 44 CYS CYS A . n 
A 1 45 PRO 45 45 45 PRO PRO A . n 
A 1 46 ALA 46 46 46 ALA ALA A . n 
A 1 47 CYS 47 47 47 CYS CYS A . n 
A 1 48 GLN 48 48 48 GLN GLN A . n 
A 1 49 PRO 49 49 49 PRO PRO A . n 
A 1 50 ALA 50 50 50 ALA ALA A . n 
A 1 51 THR 51 51 51 THR THR A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN 1 52 52 ZN ZN A . 
C 2 ZN 1 53 53 ZN ZN A . 
# 
_cell.entry_id           1F62 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1F62 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          1F62 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_database_PDB_matrix.entry_id          1F62 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1F62 
_struct.title                     WSTF-PHD 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1F62 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'Zn-finger, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BAZ1B_HUMAN 
_struct_ref.pdbx_db_accession          Q9UIG0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPAT 
_struct_ref.pdbx_align_begin           1185 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1F62 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 51 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UIG0 
_struct_ref_seq.db_align_beg                  1185 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1235 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       51 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       HIS 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        26 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ARG 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        31 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        HIS 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         26 
_struct_conf.end_auth_comp_id        ARG 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         31 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 3  SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 3  A ZN 52 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc2 metalc ? ? A CYS 6  SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 6  A ZN 52 1_555 ? ? ? ? ? ? ? 2.303 ? ? 
metalc3 metalc ? ? A CYS 18 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 18 A ZN 53 1_555 ? ? ? ? ? ? ? 2.293 ? ? 
metalc4 metalc ? ? A CYS 21 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 21 A ZN 53 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc5 metalc ? ? A HIS 26 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 26 A ZN 52 1_555 ? ? ? ? ? ? ? 2.100 ? ? 
metalc6 metalc ? ? A CYS 29 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 29 A ZN 52 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc7 metalc ? ? A CYS 44 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 44 A ZN 53 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc8 metalc ? ? A CYS 47 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 47 A ZN 53 1_555 ? ? ? ? ? ? ? 2.295 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 3  ? A CYS 3  ? 1_555 ZN ? B ZN . ? A ZN 52 ? 1_555 SG  ? A CYS 6  ? A CYS 6  ? 1_555 113.6 ? 
2  SG  ? A CYS 3  ? A CYS 3  ? 1_555 ZN ? B ZN . ? A ZN 52 ? 1_555 ND1 ? A HIS 26 ? A HIS 26 ? 1_555 105.3 ? 
3  SG  ? A CYS 6  ? A CYS 6  ? 1_555 ZN ? B ZN . ? A ZN 52 ? 1_555 ND1 ? A HIS 26 ? A HIS 26 ? 1_555 105.3 ? 
4  SG  ? A CYS 3  ? A CYS 3  ? 1_555 ZN ? B ZN . ? A ZN 52 ? 1_555 SG  ? A CYS 29 ? A CYS 29 ? 1_555 109.6 ? 
5  SG  ? A CYS 6  ? A CYS 6  ? 1_555 ZN ? B ZN . ? A ZN 52 ? 1_555 SG  ? A CYS 29 ? A CYS 29 ? 1_555 111.4 ? 
6  ND1 ? A HIS 26 ? A HIS 26 ? 1_555 ZN ? B ZN . ? A ZN 52 ? 1_555 SG  ? A CYS 29 ? A CYS 29 ? 1_555 111.4 ? 
7  SG  ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 53 ? 1_555 SG  ? A CYS 21 ? A CYS 21 ? 1_555 105.5 ? 
8  SG  ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 53 ? 1_555 SG  ? A CYS 44 ? A CYS 44 ? 1_555 105.4 ? 
9  SG  ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? C ZN . ? A ZN 53 ? 1_555 SG  ? A CYS 44 ? A CYS 44 ? 1_555 113.6 ? 
10 SG  ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? C ZN . ? A ZN 53 ? 1_555 SG  ? A CYS 47 ? A CYS 47 ? 1_555 113.5 ? 
11 SG  ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? C ZN . ? A ZN 53 ? 1_555 SG  ? A CYS 47 ? A CYS 47 ? 1_555 108.1 ? 
12 SG  ? A CYS 44 ? A CYS 44 ? 1_555 ZN ? C ZN . ? A ZN 53 ? 1_555 SG  ? A CYS 47 ? A CYS 47 ? 1_555 110.6 ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 16 ? LEU A 17 ? ILE A 16 LEU A 17 
A 2 ALA A 24 ? PHE A 25 ? ALA A 24 PHE A 25 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    16 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     16 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   PHE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    25 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    PHE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     25 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 52 ? 4 'BINDING SITE FOR RESIDUE ZN A 52' 
AC2 Software A ZN 53 ? 4 'BINDING SITE FOR RESIDUE ZN A 53' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 3  ? CYS A 3  . ? 1_555 ? 
2 AC1 4 CYS A 6  ? CYS A 6  . ? 1_555 ? 
3 AC1 4 HIS A 26 ? HIS A 26 . ? 1_555 ? 
4 AC1 4 CYS A 29 ? CYS A 29 . ? 1_555 ? 
5 AC2 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 
6 AC2 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 
7 AC2 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 
8 AC2 4 CYS A 47 ? CYS A 47 . ? 1_555 ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  VAL A 5  ? ? -65.86  -71.32  
2  1  ASP A 13 ? ? -79.20  -80.45  
3  1  LYS A 14 ? ? -151.54 75.38   
4  2  VAL A 5  ? ? -65.36  -75.69  
5  2  GLU A 11 ? ? -97.35  47.43   
6  2  ILE A 16 ? ? -100.12 74.82   
7  2  PRO A 38 ? ? -102.71 -168.40 
8  2  PRO A 49 ? ? -58.36  84.88   
9  3  VAL A 5  ? ? -68.56  -72.33  
10 3  ARG A 7  ? ? 60.37   64.01   
11 3  ASP A 13 ? ? -85.67  -74.82  
12 3  LYS A 14 ? ? -159.99 82.60   
13 3  ARG A 31 ? ? -170.21 121.08  
14 3  ALA A 50 ? ? -156.94 67.46   
15 4  ARG A 2  ? ? -69.91  90.47   
16 4  VAL A 5  ? ? -65.36  -70.05  
17 4  GLU A 11 ? ? -80.43  41.96   
18 4  LYS A 14 ? ? -167.63 106.59  
19 5  ARG A 7  ? ? 72.89   -0.56   
20 5  ASP A 13 ? ? -85.58  -80.27  
21 5  LYS A 14 ? ? -169.17 81.05   
22 5  ASN A 22 ? ? 54.48   70.21   
23 5  LEU A 30 ? ? -61.77  -74.42  
24 5  PRO A 49 ? ? -63.56  83.41   
25 6  VAL A 5  ? ? -72.70  -73.35  
26 6  LEU A 30 ? ? -82.53  -72.73  
27 6  ASP A 39 ? ? -111.22 64.57   
28 7  GLU A 20 ? ? -67.41  -70.98  
29 7  ASN A 22 ? ? 58.82   74.60   
30 7  LEU A 30 ? ? -81.79  -78.91  
31 7  GLN A 48 ? ? -113.02 78.14   
32 8  ASP A 13 ? ? -92.87  -71.41  
33 8  ASN A 22 ? ? 60.63   60.23   
34 8  LEU A 30 ? ? -63.58  -70.42  
35 8  TYR A 35 ? ? -147.69 -50.23  
36 8  PRO A 45 ? ? -58.14  -9.84   
37 9  VAL A 5  ? ? -70.32  -75.22  
38 9  ASP A 13 ? ? -120.39 -55.29  
39 10 LYS A 9  ? ? -107.06 59.53   
40 10 ASP A 13 ? ? -96.87  -69.87  
41 10 LYS A 14 ? ? -165.63 77.43   
42 10 ILE A 16 ? ? -116.37 70.19   
43 10 PRO A 38 ? ? -83.88  -112.15 
44 10 ASP A 39 ? ? -89.47  39.56   
45 11 ARG A 7  ? ? 39.10   41.50   
46 11 ASP A 13 ? ? -96.35  -67.21  
47 11 LYS A 14 ? ? -164.92 76.68   
48 11 ALA A 50 ? ? -172.36 -178.71 
49 12 GLU A 11 ? ? -93.75  40.03   
50 12 ASP A 13 ? ? -93.21  -76.21  
51 12 LEU A 30 ? ? -64.25  -70.08  
52 12 GLN A 48 ? ? -116.53 79.79   
53 13 VAL A 5  ? ? -67.08  -74.82  
54 13 GLU A 11 ? ? -88.35  34.00   
55 13 ASN A 22 ? ? 54.37   75.71   
56 13 PRO A 49 ? ? -68.99  72.51   
57 14 ASP A 13 ? ? -120.77 -80.62  
58 14 ARG A 31 ? ? -168.14 107.01  
59 14 PRO A 45 ? ? -59.39  4.27    
60 14 CYS A 47 ? ? -75.69  -70.10  
61 15 VAL A 5  ? ? -59.95  -76.68  
62 15 GLU A 11 ? ? -77.35  47.96   
63 15 LYS A 14 ? ? -155.84 74.97   
64 15 ARG A 31 ? ? -170.45 108.94  
65 15 ALA A 50 ? ? -156.77 59.14   
66 16 VAL A 5  ? ? -72.66  -80.08  
67 16 ASP A 13 ? ? -111.84 -80.41  
68 16 ASN A 22 ? ? 59.43   73.86   
69 16 ARG A 31 ? ? -170.46 132.78  
70 17 VAL A 5  ? ? -71.23  -72.96  
71 17 GLU A 11 ? ? -78.27  46.78   
72 17 ASP A 13 ? ? -67.46  -70.38  
73 17 LYS A 14 ? ? -150.59 87.09   
74 17 ASN A 22 ? ? 60.78   74.93   
75 18 ASP A 13 ? ? -64.12  -70.95  
76 18 ASN A 22 ? ? 62.03   66.29   
77 18 LEU A 30 ? ? -79.00  -72.55  
78 19 ARG A 7  ? ? 62.85   -0.23   
79 20 ASP A 13 ? ? -84.46  -80.13  
80 20 LYS A 14 ? ? -156.48 72.60   
81 20 LEU A 30 ? ? -67.41  -71.38  
82 20 ASP A 39 ? ? -84.31  49.47   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 13 TYR A 35 ? ? 0.065 'SIDE CHAIN' 
2 15 ARG A 2  ? ? 0.085 'SIDE CHAIN' 
# 
_pdbx_nmr_ensemble.entry_id                                      1F62 
_pdbx_nmr_ensemble.conformers_calculated_total_number            20 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1F62 
_pdbx_nmr_representative.conformer_id         17 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1mM WSTF-PHD U-15N,13C;' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '50mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY 
2 2 2 3D_13C-separated_NOESY 
# 
_pdbx_nmr_refine.entry_id           1F62 
_pdbx_nmr_refine.method             
;Restrained molecular dynamics 
using AMBER-6 program
;
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
NMRPipe 1 processing           Delaglio 1 
DYANA   1 'structure solution' Guntert  2 
DYANA   1 refinement           Guntert  3 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
GLN N    N  N N 88  
GLN CA   C  N S 89  
GLN C    C  N N 90  
GLN O    O  N N 91  
GLN CB   C  N N 92  
GLN CG   C  N N 93  
GLN CD   C  N N 94  
GLN OE1  O  N N 95  
GLN NE2  N  N N 96  
GLN OXT  O  N N 97  
GLN H    H  N N 98  
GLN H2   H  N N 99  
GLN HA   H  N N 100 
GLN HB2  H  N N 101 
GLN HB3  H  N N 102 
GLN HG2  H  N N 103 
GLN HG3  H  N N 104 
GLN HE21 H  N N 105 
GLN HE22 H  N N 106 
GLN HXT  H  N N 107 
GLU N    N  N N 108 
GLU CA   C  N S 109 
GLU C    C  N N 110 
GLU O    O  N N 111 
GLU CB   C  N N 112 
GLU CG   C  N N 113 
GLU CD   C  N N 114 
GLU OE1  O  N N 115 
GLU OE2  O  N N 116 
GLU OXT  O  N N 117 
GLU H    H  N N 118 
GLU H2   H  N N 119 
GLU HA   H  N N 120 
GLU HB2  H  N N 121 
GLU HB3  H  N N 122 
GLU HG2  H  N N 123 
GLU HG3  H  N N 124 
GLU HE2  H  N N 125 
GLU HXT  H  N N 126 
GLY N    N  N N 127 
GLY CA   C  N N 128 
GLY C    C  N N 129 
GLY O    O  N N 130 
GLY OXT  O  N N 131 
GLY H    H  N N 132 
GLY H2   H  N N 133 
GLY HA2  H  N N 134 
GLY HA3  H  N N 135 
GLY HXT  H  N N 136 
HIS N    N  N N 137 
HIS CA   C  N S 138 
HIS C    C  N N 139 
HIS O    O  N N 140 
HIS CB   C  N N 141 
HIS CG   C  Y N 142 
HIS ND1  N  Y N 143 
HIS CD2  C  Y N 144 
HIS CE1  C  Y N 145 
HIS NE2  N  Y N 146 
HIS OXT  O  N N 147 
HIS H    H  N N 148 
HIS H2   H  N N 149 
HIS HA   H  N N 150 
HIS HB2  H  N N 151 
HIS HB3  H  N N 152 
HIS HD1  H  N N 153 
HIS HD2  H  N N 154 
HIS HE1  H  N N 155 
HIS HE2  H  N N 156 
HIS HXT  H  N N 157 
ILE N    N  N N 158 
ILE CA   C  N S 159 
ILE C    C  N N 160 
ILE O    O  N N 161 
ILE CB   C  N S 162 
ILE CG1  C  N N 163 
ILE CG2  C  N N 164 
ILE CD1  C  N N 165 
ILE OXT  O  N N 166 
ILE H    H  N N 167 
ILE H2   H  N N 168 
ILE HA   H  N N 169 
ILE HB   H  N N 170 
ILE HG12 H  N N 171 
ILE HG13 H  N N 172 
ILE HG21 H  N N 173 
ILE HG22 H  N N 174 
ILE HG23 H  N N 175 
ILE HD11 H  N N 176 
ILE HD12 H  N N 177 
ILE HD13 H  N N 178 
ILE HXT  H  N N 179 
LEU N    N  N N 180 
LEU CA   C  N S 181 
LEU C    C  N N 182 
LEU O    O  N N 183 
LEU CB   C  N N 184 
LEU CG   C  N N 185 
LEU CD1  C  N N 186 
LEU CD2  C  N N 187 
LEU OXT  O  N N 188 
LEU H    H  N N 189 
LEU H2   H  N N 190 
LEU HA   H  N N 191 
LEU HB2  H  N N 192 
LEU HB3  H  N N 193 
LEU HG   H  N N 194 
LEU HD11 H  N N 195 
LEU HD12 H  N N 196 
LEU HD13 H  N N 197 
LEU HD21 H  N N 198 
LEU HD22 H  N N 199 
LEU HD23 H  N N 200 
LEU HXT  H  N N 201 
LYS N    N  N N 202 
LYS CA   C  N S 203 
LYS C    C  N N 204 
LYS O    O  N N 205 
LYS CB   C  N N 206 
LYS CG   C  N N 207 
LYS CD   C  N N 208 
LYS CE   C  N N 209 
LYS NZ   N  N N 210 
LYS OXT  O  N N 211 
LYS H    H  N N 212 
LYS H2   H  N N 213 
LYS HA   H  N N 214 
LYS HB2  H  N N 215 
LYS HB3  H  N N 216 
LYS HG2  H  N N 217 
LYS HG3  H  N N 218 
LYS HD2  H  N N 219 
LYS HD3  H  N N 220 
LYS HE2  H  N N 221 
LYS HE3  H  N N 222 
LYS HZ1  H  N N 223 
LYS HZ2  H  N N 224 
LYS HZ3  H  N N 225 
LYS HXT  H  N N 226 
PHE N    N  N N 227 
PHE CA   C  N S 228 
PHE C    C  N N 229 
PHE O    O  N N 230 
PHE CB   C  N N 231 
PHE CG   C  Y N 232 
PHE CD1  C  Y N 233 
PHE CD2  C  Y N 234 
PHE CE1  C  Y N 235 
PHE CE2  C  Y N 236 
PHE CZ   C  Y N 237 
PHE OXT  O  N N 238 
PHE H    H  N N 239 
PHE H2   H  N N 240 
PHE HA   H  N N 241 
PHE HB2  H  N N 242 
PHE HB3  H  N N 243 
PHE HD1  H  N N 244 
PHE HD2  H  N N 245 
PHE HE1  H  N N 246 
PHE HE2  H  N N 247 
PHE HZ   H  N N 248 
PHE HXT  H  N N 249 
PRO N    N  N N 250 
PRO CA   C  N S 251 
PRO C    C  N N 252 
PRO O    O  N N 253 
PRO CB   C  N N 254 
PRO CG   C  N N 255 
PRO CD   C  N N 256 
PRO OXT  O  N N 257 
PRO H    H  N N 258 
PRO HA   H  N N 259 
PRO HB2  H  N N 260 
PRO HB3  H  N N 261 
PRO HG2  H  N N 262 
PRO HG3  H  N N 263 
PRO HD2  H  N N 264 
PRO HD3  H  N N 265 
PRO HXT  H  N N 266 
THR N    N  N N 267 
THR CA   C  N S 268 
THR C    C  N N 269 
THR O    O  N N 270 
THR CB   C  N R 271 
THR OG1  O  N N 272 
THR CG2  C  N N 273 
THR OXT  O  N N 274 
THR H    H  N N 275 
THR H2   H  N N 276 
THR HA   H  N N 277 
THR HB   H  N N 278 
THR HG1  H  N N 279 
THR HG21 H  N N 280 
THR HG22 H  N N 281 
THR HG23 H  N N 282 
THR HXT  H  N N 283 
TRP N    N  N N 284 
TRP CA   C  N S 285 
TRP C    C  N N 286 
TRP O    O  N N 287 
TRP CB   C  N N 288 
TRP CG   C  Y N 289 
TRP CD1  C  Y N 290 
TRP CD2  C  Y N 291 
TRP NE1  N  Y N 292 
TRP CE2  C  Y N 293 
TRP CE3  C  Y N 294 
TRP CZ2  C  Y N 295 
TRP CZ3  C  Y N 296 
TRP CH2  C  Y N 297 
TRP OXT  O  N N 298 
TRP H    H  N N 299 
TRP H2   H  N N 300 
TRP HA   H  N N 301 
TRP HB2  H  N N 302 
TRP HB3  H  N N 303 
TRP HD1  H  N N 304 
TRP HE1  H  N N 305 
TRP HE3  H  N N 306 
TRP HZ2  H  N N 307 
TRP HZ3  H  N N 308 
TRP HH2  H  N N 309 
TRP HXT  H  N N 310 
TYR N    N  N N 311 
TYR CA   C  N S 312 
TYR C    C  N N 313 
TYR O    O  N N 314 
TYR CB   C  N N 315 
TYR CG   C  Y N 316 
TYR CD1  C  Y N 317 
TYR CD2  C  Y N 318 
TYR CE1  C  Y N 319 
TYR CE2  C  Y N 320 
TYR CZ   C  Y N 321 
TYR OH   O  N N 322 
TYR OXT  O  N N 323 
TYR H    H  N N 324 
TYR H2   H  N N 325 
TYR HA   H  N N 326 
TYR HB2  H  N N 327 
TYR HB3  H  N N 328 
TYR HD1  H  N N 329 
TYR HD2  H  N N 330 
TYR HE1  H  N N 331 
TYR HE2  H  N N 332 
TYR HH   H  N N 333 
TYR HXT  H  N N 334 
VAL N    N  N N 335 
VAL CA   C  N S 336 
VAL C    C  N N 337 
VAL O    O  N N 338 
VAL CB   C  N N 339 
VAL CG1  C  N N 340 
VAL CG2  C  N N 341 
VAL OXT  O  N N 342 
VAL H    H  N N 343 
VAL H2   H  N N 344 
VAL HA   H  N N 345 
VAL HB   H  N N 346 
VAL HG11 H  N N 347 
VAL HG12 H  N N 348 
VAL HG13 H  N N 349 
VAL HG21 H  N N 350 
VAL HG22 H  N N 351 
VAL HG23 H  N N 352 
VAL HXT  H  N N 353 
ZN  ZN   ZN N N 354 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
PHE N   CA   sing N N 216 
PHE N   H    sing N N 217 
PHE N   H2   sing N N 218 
PHE CA  C    sing N N 219 
PHE CA  CB   sing N N 220 
PHE CA  HA   sing N N 221 
PHE C   O    doub N N 222 
PHE C   OXT  sing N N 223 
PHE CB  CG   sing N N 224 
PHE CB  HB2  sing N N 225 
PHE CB  HB3  sing N N 226 
PHE CG  CD1  doub Y N 227 
PHE CG  CD2  sing Y N 228 
PHE CD1 CE1  sing Y N 229 
PHE CD1 HD1  sing N N 230 
PHE CD2 CE2  doub Y N 231 
PHE CD2 HD2  sing N N 232 
PHE CE1 CZ   doub Y N 233 
PHE CE1 HE1  sing N N 234 
PHE CE2 CZ   sing Y N 235 
PHE CE2 HE2  sing N N 236 
PHE CZ  HZ   sing N N 237 
PHE OXT HXT  sing N N 238 
PRO N   CA   sing N N 239 
PRO N   CD   sing N N 240 
PRO N   H    sing N N 241 
PRO CA  C    sing N N 242 
PRO CA  CB   sing N N 243 
PRO CA  HA   sing N N 244 
PRO C   O    doub N N 245 
PRO C   OXT  sing N N 246 
PRO CB  CG   sing N N 247 
PRO CB  HB2  sing N N 248 
PRO CB  HB3  sing N N 249 
PRO CG  CD   sing N N 250 
PRO CG  HG2  sing N N 251 
PRO CG  HG3  sing N N 252 
PRO CD  HD2  sing N N 253 
PRO CD  HD3  sing N N 254 
PRO OXT HXT  sing N N 255 
THR N   CA   sing N N 256 
THR N   H    sing N N 257 
THR N   H2   sing N N 258 
THR CA  C    sing N N 259 
THR CA  CB   sing N N 260 
THR CA  HA   sing N N 261 
THR C   O    doub N N 262 
THR C   OXT  sing N N 263 
THR CB  OG1  sing N N 264 
THR CB  CG2  sing N N 265 
THR CB  HB   sing N N 266 
THR OG1 HG1  sing N N 267 
THR CG2 HG21 sing N N 268 
THR CG2 HG22 sing N N 269 
THR CG2 HG23 sing N N 270 
THR OXT HXT  sing N N 271 
TRP N   CA   sing N N 272 
TRP N   H    sing N N 273 
TRP N   H2   sing N N 274 
TRP CA  C    sing N N 275 
TRP CA  CB   sing N N 276 
TRP CA  HA   sing N N 277 
TRP C   O    doub N N 278 
TRP C   OXT  sing N N 279 
TRP CB  CG   sing N N 280 
TRP CB  HB2  sing N N 281 
TRP CB  HB3  sing N N 282 
TRP CG  CD1  doub Y N 283 
TRP CG  CD2  sing Y N 284 
TRP CD1 NE1  sing Y N 285 
TRP CD1 HD1  sing N N 286 
TRP CD2 CE2  doub Y N 287 
TRP CD2 CE3  sing Y N 288 
TRP NE1 CE2  sing Y N 289 
TRP NE1 HE1  sing N N 290 
TRP CE2 CZ2  sing Y N 291 
TRP CE3 CZ3  doub Y N 292 
TRP CE3 HE3  sing N N 293 
TRP CZ2 CH2  doub Y N 294 
TRP CZ2 HZ2  sing N N 295 
TRP CZ3 CH2  sing Y N 296 
TRP CZ3 HZ3  sing N N 297 
TRP CH2 HH2  sing N N 298 
TRP OXT HXT  sing N N 299 
TYR N   CA   sing N N 300 
TYR N   H    sing N N 301 
TYR N   H2   sing N N 302 
TYR CA  C    sing N N 303 
TYR CA  CB   sing N N 304 
TYR CA  HA   sing N N 305 
TYR C   O    doub N N 306 
TYR C   OXT  sing N N 307 
TYR CB  CG   sing N N 308 
TYR CB  HB2  sing N N 309 
TYR CB  HB3  sing N N 310 
TYR CG  CD1  doub Y N 311 
TYR CG  CD2  sing Y N 312 
TYR CD1 CE1  sing Y N 313 
TYR CD1 HD1  sing N N 314 
TYR CD2 CE2  doub Y N 315 
TYR CD2 HD2  sing N N 316 
TYR CE1 CZ   doub Y N 317 
TYR CE1 HE1  sing N N 318 
TYR CE2 CZ   sing Y N 319 
TYR CE2 HE2  sing N N 320 
TYR CZ  OH   sing N N 321 
TYR OH  HH   sing N N 322 
TYR OXT HXT  sing N N 323 
VAL N   CA   sing N N 324 
VAL N   H    sing N N 325 
VAL N   H2   sing N N 326 
VAL CA  C    sing N N 327 
VAL CA  CB   sing N N 328 
VAL CA  HA   sing N N 329 
VAL C   O    doub N N 330 
VAL C   OXT  sing N N 331 
VAL CB  CG1  sing N N 332 
VAL CB  CG2  sing N N 333 
VAL CB  HB   sing N N 334 
VAL CG1 HG11 sing N N 335 
VAL CG1 HG12 sing N N 336 
VAL CG1 HG13 sing N N 337 
VAL CG2 HG21 sing N N 338 
VAL CG2 HG22 sing N N 339 
VAL CG2 HG23 sing N N 340 
VAL OXT HXT  sing N N 341 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker AMX 500 
2 ? Bruker DMX 750 
# 
_atom_sites.entry_id                    1F62 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_