data_1FA4 # _entry.id 1FA4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1FA4 pdb_00001fa4 10.2210/pdb1fa4/pdb RCSB RCSB011431 ? ? WWPDB D_1000011431 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-08-16 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.value' 14 4 'Structure model' '_struct_conn.pdbx_dist_value' 15 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 27 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FA4 _pdbx_database_status.recvd_initial_deposition_date 2000-07-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ma, L.' 1 'Jorgensen, A.M.' 2 'Sorensen, G.O.' 3 'Ulstrup, J.' 4 'Led, J.J.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Elucidation of the Paramagnetic R1 Relaxation of Heteronuclei and Protons in Cu(II) Plastocyanin from Anabaena Variabilis' J.Am.Chem.Soc. 122 9473 9485 2000 JACSAT US 0002-7863 0004 ? -1 10.1021/ja001368z 1 'Solution Structure of Reduced Plastocyanin from the Blue-Green Alga Anabaena variabilis' Biochemistry 35 7021 7031 1996 BICHAW US 0006-2960 0033 ? ? 10.1021/bi960621y # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ma, L.' 1 ? primary 'Jorgensen, A.M.' 2 ? primary 'Soerensen, G.O.' 3 ? primary 'Ulstrup, J.' 4 ? primary 'Led, J.J.' 5 ? 1 'Badsberg, U.' 6 ? 1 'Jorgensen, A.M.' 7 ? 1 'Gesmar, H.' 8 ? 1 'Led, J.J.' 9 ? 1 'Hammerstad, J.M.' 10 ? 1 'Jespersen, L.L.' 11 ? 1 'Ulstrup, J.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat PLASTOCYANIN 11116.643 1 ? ? ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADA PAGEYTFYCEPHRGAGMVGKITVAG ; _entity_poly.pdbx_seq_one_letter_code_can ;ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADA PAGEYTFYCEPHRGAGMVGKITVAG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'COPPER (II) ION' _pdbx_entity_nonpoly.comp_id CU # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 THR n 1 3 TYR n 1 4 THR n 1 5 VAL n 1 6 LYS n 1 7 LEU n 1 8 GLY n 1 9 SER n 1 10 ASP n 1 11 LYS n 1 12 GLY n 1 13 LEU n 1 14 LEU n 1 15 VAL n 1 16 PHE n 1 17 GLU n 1 18 PRO n 1 19 ALA n 1 20 LYS n 1 21 LEU n 1 22 THR n 1 23 ILE n 1 24 LYS n 1 25 PRO n 1 26 GLY n 1 27 ASP n 1 28 THR n 1 29 VAL n 1 30 GLU n 1 31 PHE n 1 32 LEU n 1 33 ASN n 1 34 ASN n 1 35 LYS n 1 36 VAL n 1 37 PRO n 1 38 PRO n 1 39 HIS n 1 40 ASN n 1 41 VAL n 1 42 VAL n 1 43 PHE n 1 44 ASP n 1 45 ALA n 1 46 ALA n 1 47 LEU n 1 48 ASN n 1 49 PRO n 1 50 ALA n 1 51 LYS n 1 52 SER n 1 53 ALA n 1 54 ASP n 1 55 LEU n 1 56 ALA n 1 57 LYS n 1 58 SER n 1 59 LEU n 1 60 SER n 1 61 HIS n 1 62 LYS n 1 63 GLN n 1 64 LEU n 1 65 LEU n 1 66 MET n 1 67 SER n 1 68 PRO n 1 69 GLY n 1 70 GLN n 1 71 SER n 1 72 THR n 1 73 SER n 1 74 THR n 1 75 THR n 1 76 PHE n 1 77 PRO n 1 78 ALA n 1 79 ASP n 1 80 ALA n 1 81 PRO n 1 82 ALA n 1 83 GLY n 1 84 GLU n 1 85 TYR n 1 86 THR n 1 87 PHE n 1 88 TYR n 1 89 CYS n 1 90 GLU n 1 91 PRO n 1 92 HIS n 1 93 ARG n 1 94 GLY n 1 95 ALA n 1 96 GLY n 1 97 MET n 1 98 VAL n 1 99 GLY n 1 100 LYS n 1 101 ILE n 1 102 THR n 1 103 VAL n 1 104 ALA n 1 105 GLY n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Anabaena variabilis' _entity_src_nat.pdbx_ncbi_taxonomy_id 1172 _entity_src_nat.genus Anabaena _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 GLY 105 105 105 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CU _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 106 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id CU _pdbx_nonpoly_scheme.auth_mon_id CU _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 1FA4 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FA4 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1FA4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1FA4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1FA4 _struct.title 'ELUCIDATION OF THE PARAMAGNETIC RELAXATION OF HETERONUCLEI AND PROTONS IN CU(II) PLASTOCYANIN FROM ANABAENA VARIABILIS' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FA4 _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'PLASTOCYANIN, ANABAENA VARIABILIS, ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_code PLAS_ANAVA _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00301 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FA4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 105 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00301 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 105 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 105 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 39 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 39 A CU 106 1_555 ? ? ? ? ? ? ? 2.059 ? ? metalc2 metalc ? ? A CYS 89 SG ? ? ? 1_555 B CU . CU ? ? A CYS 89 A CU 106 1_555 ? ? ? ? ? ? ? 2.112 ? ? metalc3 metalc ? ? A HIS 92 ND1 ? ? ? 1_555 B CU . CU ? ? A HIS 92 A CU 106 1_555 ? ? ? ? ? ? ? 2.049 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 CU ? B CU . ? A CU 106 ? 1_555 SG ? A CYS 89 ? A CYS 89 ? 1_555 130.6 ? 2 ND1 ? A HIS 39 ? A HIS 39 ? 1_555 CU ? B CU . ? A CU 106 ? 1_555 ND1 ? A HIS 92 ? A HIS 92 ? 1_555 86.8 ? 3 SG ? A CYS 89 ? A CYS 89 ? 1_555 CU ? B CU . ? A CU 106 ? 1_555 ND1 ? A HIS 92 ? A HIS 92 ? 1_555 104.7 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 1 0.19 2 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 1 -1.76 3 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 2 0.18 4 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 2 -1.75 5 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 3 -0.27 6 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 3 -0.89 7 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 4 -0.05 8 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 4 -1.64 9 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 5 0.52 10 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 5 -1.39 11 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 6 0.27 12 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 6 -1.62 13 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 7 0.34 14 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 7 -1.50 15 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 8 0.19 16 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 8 -1.28 17 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 9 0.30 18 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 9 -1.66 19 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 10 0.40 20 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 10 -1.82 21 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 11 0.09 22 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 11 -0.97 23 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 12 0.12 24 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 12 -1.81 25 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 13 0.52 26 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 13 -1.47 27 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 14 -0.18 28 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 14 -1.89 29 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 15 0.65 30 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 15 -1.81 31 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 16 0.47 32 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 16 -1.43 33 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 17 0.33 34 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 17 -1.64 35 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 18 0.10 36 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 18 -2.15 37 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 19 0.12 38 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 19 -1.76 39 GLU 17 A . ? GLU 17 A PRO 18 A ? PRO 18 A 20 0.02 40 PRO 37 A . ? PRO 37 A PRO 38 A ? PRO 38 A 20 -1.76 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel B 1 2 ? parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 3 ? VAL A 5 ? TYR A 3 VAL A 5 A 2 VAL A 29 ? PHE A 31 ? VAL A 29 PHE A 31 A 3 THR A 72 ? THR A 74 ? THR A 72 THR A 74 B 1 LYS A 20 ? ILE A 23 ? LYS A 20 ILE A 23 B 2 LYS A 100 ? VAL A 103 ? LYS A 100 VAL A 103 C 1 VAL A 42 ? PHE A 43 ? VAL A 42 PHE A 43 C 2 PHE A 87 ? TYR A 88 ? PHE A 87 TYR A 88 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 3 ? O TYR A 3 N GLU A 30 ? N GLU A 30 A 2 3 O PHE A 31 ? O PHE A 31 N THR A 72 ? N THR A 72 B 1 2 N LEU A 21 ? N LEU A 21 O LYS A 100 ? O LYS A 100 C 1 2 O VAL A 42 ? O VAL A 42 N TYR A 88 ? N TYR A 88 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CU _struct_site.pdbx_auth_seq_id 106 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE CU A 106' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 39 ? HIS A 39 . ? 1_555 ? 2 AC1 4 CYS A 89 ? CYS A 89 . ? 1_555 ? 3 AC1 4 HIS A 92 ? HIS A 92 . ? 1_555 ? 4 AC1 4 MET A 97 ? MET A 97 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 21 ? ? H A THR 102 ? ? 1.56 2 1 O A ALA 56 ? ? H A LEU 59 ? ? 1.59 3 1 OD1 A ASP 10 ? ? H A LYS 11 ? ? 1.59 4 2 OD1 A ASN 33 ? ? H A GLY 69 ? ? 1.51 5 4 O A PRO 81 ? ? HH A TYR 85 ? ? 1.41 6 4 H A TYR 85 ? ? O A ILE 101 ? ? 1.53 7 4 O A TYR 85 ? ? H A ILE 101 ? ? 1.55 8 4 O A GLY 96 ? ? H A VAL 98 ? ? 1.57 9 5 O A TYR 3 ? ? H A GLU 30 ? ? 1.49 10 5 O A LEU 21 ? ? H A THR 102 ? ? 1.54 11 6 O A LEU 21 ? ? H A THR 102 ? ? 1.52 12 6 O A PRO 91 ? ? H A ARG 93 ? ? 1.60 13 7 O A TYR 3 ? ? H A GLU 30 ? ? 1.53 14 7 OD1 A ASN 33 ? ? H A GLY 69 ? ? 1.58 15 8 OD1 A ASN 33 ? ? H A GLY 69 ? ? 1.58 16 10 O A ALA 56 ? ? H A LEU 59 ? ? 1.47 17 11 O A PRO 81 ? ? HH A TYR 85 ? ? 1.45 18 11 OD1 A ASN 33 ? ? H A GLY 69 ? ? 1.58 19 12 O A ALA 56 ? ? H A LEU 59 ? ? 1.49 20 12 OD1 A ASN 33 ? ? H A GLY 69 ? ? 1.53 21 13 O A PRO 81 ? ? HH A TYR 85 ? ? 1.39 22 14 OD1 A ASN 33 ? ? H A GLY 69 ? ? 1.51 23 15 O A LEU 21 ? ? H A THR 102 ? ? 1.51 24 15 O A PRO 81 ? ? HH A TYR 85 ? ? 1.55 25 15 OD1 A ASN 48 ? ? H A SER 52 ? ? 1.55 26 16 O A LEU 55 ? ? H A LEU 59 ? ? 1.59 27 17 O A LEU 21 ? ? H A THR 102 ? ? 1.52 28 17 H A VAL 5 ? ? O A GLU 30 ? ? 1.56 29 18 HD1 A HIS 61 ? ? O A LYS 62 ? ? 1.49 30 19 O A LEU 21 ? ? H A THR 102 ? ? 1.56 31 19 O A PRO 81 ? ? HH A TYR 85 ? ? 1.58 32 20 O A GLY 8 ? ? HD21 A ASN 34 ? ? 1.52 33 20 OD1 A ASN 33 ? ? H A GLY 69 ? ? 1.56 34 20 O A LEU 21 ? ? H A THR 102 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 6 ? ? -69.46 79.21 2 1 SER A 9 ? ? -69.86 -82.45 3 1 ASP A 10 ? ? 163.45 -50.17 4 1 LEU A 13 ? ? -138.65 -156.51 5 1 PHE A 16 ? ? -44.47 165.83 6 1 ASP A 27 ? ? -53.30 -176.14 7 1 ASN A 34 ? ? -101.50 -109.01 8 1 VAL A 36 ? ? -153.02 61.98 9 1 LYS A 51 ? ? -40.37 92.94 10 1 SER A 52 ? ? -140.71 -159.21 11 1 ALA A 53 ? ? -155.81 56.95 12 1 ASP A 54 ? ? -138.78 -60.99 13 1 LEU A 59 ? ? -127.00 -54.88 14 1 LYS A 62 ? ? -125.06 -160.20 15 1 GLN A 63 ? ? 65.87 135.51 16 1 SER A 71 ? ? -120.01 -78.46 17 1 THR A 72 ? ? -160.14 119.00 18 1 ALA A 80 ? ? -39.95 110.88 19 1 THR A 86 ? ? -165.18 101.23 20 1 ALA A 104 ? ? -46.03 161.64 21 2 SER A 9 ? ? -50.47 -82.17 22 2 ASP A 10 ? ? -176.88 -93.67 23 2 LYS A 11 ? ? -100.06 54.28 24 2 LEU A 13 ? ? -144.89 -159.32 25 2 ASN A 34 ? ? -97.10 -129.63 26 2 VAL A 36 ? ? -154.96 67.89 27 2 LYS A 51 ? ? 34.28 35.58 28 2 LYS A 62 ? ? -121.25 -163.07 29 2 GLN A 63 ? ? 59.19 -165.82 30 2 SER A 71 ? ? -124.62 -168.87 31 2 PHE A 76 ? ? -39.79 160.03 32 2 ASP A 79 ? ? -98.85 -61.41 33 2 ALA A 80 ? ? 42.88 94.70 34 2 TYR A 85 ? ? -100.71 70.76 35 2 THR A 86 ? ? -62.83 97.53 36 2 HIS A 92 ? ? -106.84 67.25 37 2 ALA A 95 ? ? -93.43 39.08 38 2 MET A 97 ? ? -86.59 47.17 39 2 ALA A 104 ? ? -119.39 -151.49 40 3 LEU A 7 ? ? -50.86 100.12 41 3 SER A 9 ? ? -48.00 -95.80 42 3 ASP A 10 ? ? 176.86 33.27 43 3 LYS A 11 ? ? -136.08 -43.05 44 3 ASP A 27 ? ? -55.81 -178.69 45 3 ASN A 34 ? ? -110.02 -95.49 46 3 LYS A 35 ? ? -143.05 33.14 47 3 VAL A 36 ? ? -151.49 59.58 48 3 PRO A 38 ? ? -82.42 -158.57 49 3 LYS A 51 ? ? 34.53 36.79 50 3 ALA A 53 ? ? -166.12 80.31 51 3 ASP A 54 ? ? -155.92 -48.96 52 3 SER A 58 ? ? -94.39 49.57 53 3 LEU A 59 ? ? -136.27 -60.89 54 3 LYS A 62 ? ? -142.11 -46.17 55 3 GLN A 70 ? ? -179.22 100.09 56 3 SER A 71 ? ? -103.80 -79.63 57 3 THR A 72 ? ? -160.72 107.95 58 3 PHE A 76 ? ? -39.95 157.15 59 3 ASP A 79 ? ? -98.60 -67.22 60 3 ALA A 80 ? ? 40.65 76.49 61 3 ALA A 82 ? ? 50.89 106.06 62 3 GLU A 84 ? ? -160.32 53.33 63 3 MET A 97 ? ? -92.04 37.25 64 4 SER A 9 ? ? -45.27 -88.44 65 4 ASP A 10 ? ? 179.60 -47.39 66 4 LEU A 13 ? ? -130.87 -155.24 67 4 ASP A 27 ? ? -46.66 172.52 68 4 ASN A 34 ? ? -134.73 -93.27 69 4 VAL A 36 ? ? -157.11 61.11 70 4 PRO A 38 ? ? -84.47 -157.10 71 4 ASP A 44 ? ? -50.77 -177.35 72 4 ALA A 46 ? ? -140.71 15.37 73 4 ALA A 50 ? ? -140.20 29.64 74 4 LYS A 51 ? ? 30.54 96.35 75 4 ALA A 53 ? ? 170.59 -33.33 76 4 LYS A 62 ? ? 56.65 118.94 77 4 GLN A 63 ? ? 160.46 169.83 78 4 GLN A 70 ? ? -48.50 108.73 79 4 SER A 71 ? ? -140.42 -159.57 80 4 PHE A 76 ? ? -44.74 165.11 81 4 ASP A 79 ? ? -99.96 -66.31 82 4 PRO A 81 ? ? -76.27 -159.81 83 4 ALA A 82 ? ? 69.62 -84.84 84 4 GLU A 84 ? ? -160.02 96.67 85 4 HIS A 92 ? ? -101.32 65.42 86 4 ALA A 95 ? ? -95.91 35.01 87 4 MET A 97 ? ? -68.39 60.73 88 4 ALA A 104 ? ? -45.02 109.04 89 5 LEU A 7 ? ? -45.15 100.70 90 5 SER A 9 ? ? -76.21 -81.30 91 5 ASP A 10 ? ? 167.83 -30.19 92 5 LEU A 13 ? ? -164.34 -148.73 93 5 ASP A 27 ? ? -62.91 -170.86 94 5 ASN A 34 ? ? -111.64 -96.36 95 5 LYS A 35 ? ? -147.13 30.91 96 5 VAL A 36 ? ? -151.10 59.42 97 5 LYS A 51 ? ? 38.55 48.17 98 5 HIS A 61 ? ? -125.00 -164.74 99 5 LYS A 62 ? ? -65.43 -162.98 100 5 GLN A 70 ? ? 172.30 111.68 101 5 SER A 71 ? ? -111.14 -78.89 102 5 PHE A 76 ? ? -36.83 146.54 103 5 ALA A 80 ? ? -37.04 96.58 104 5 TYR A 88 ? ? -143.49 -156.77 105 5 ALA A 104 ? ? -64.43 -172.80 106 6 LEU A 13 ? ? -148.20 -91.30 107 6 PHE A 16 ? ? -45.39 151.09 108 6 ASP A 27 ? ? -51.43 -176.93 109 6 PHE A 31 ? ? -153.52 84.63 110 6 ASN A 34 ? ? -92.98 -62.78 111 6 LYS A 35 ? ? -158.19 35.53 112 6 VAL A 36 ? ? -154.73 57.42 113 6 ALA A 45 ? ? -84.53 45.99 114 6 ALA A 46 ? ? -137.68 -30.52 115 6 LEU A 47 ? ? -103.12 77.36 116 6 LYS A 51 ? ? 35.75 87.39 117 6 ASP A 54 ? ? -143.97 -41.05 118 6 SER A 58 ? ? -98.28 32.32 119 6 LEU A 59 ? ? -133.10 -51.37 120 6 MET A 66 ? ? -145.45 -48.52 121 6 GLN A 70 ? ? 167.70 108.22 122 6 SER A 71 ? ? -100.10 -100.24 123 6 THR A 72 ? ? -146.32 -157.85 124 6 ALA A 80 ? ? -40.08 99.97 125 6 THR A 86 ? ? -163.63 115.41 126 6 HIS A 92 ? ? -66.96 63.98 127 6 ALA A 95 ? ? -146.47 36.40 128 6 MET A 97 ? ? -66.85 67.77 129 6 ALA A 104 ? ? -179.79 -74.03 130 7 ASP A 10 ? ? 77.07 -3.06 131 7 LEU A 13 ? ? -140.38 -151.42 132 7 ASP A 27 ? ? -54.80 -176.03 133 7 ASN A 34 ? ? -109.35 -85.18 134 7 LYS A 35 ? ? -150.91 29.75 135 7 VAL A 36 ? ? -148.68 58.50 136 7 ASP A 44 ? ? -54.28 -166.80 137 7 ALA A 45 ? ? -147.69 25.80 138 7 LEU A 47 ? ? -110.82 55.68 139 7 LYS A 51 ? ? 34.46 59.21 140 7 ALA A 53 ? ? -152.82 16.80 141 7 SER A 71 ? ? -105.66 -167.92 142 7 PHE A 76 ? ? -44.08 156.74 143 7 ALA A 80 ? ? -36.61 98.13 144 7 HIS A 92 ? ? -90.25 43.58 145 8 VAL A 5 ? ? -91.79 48.00 146 8 LYS A 6 ? ? -47.54 92.55 147 8 LEU A 7 ? ? -53.97 170.54 148 8 SER A 9 ? ? -68.55 -70.12 149 8 ASP A 10 ? ? 179.79 -59.54 150 8 LYS A 11 ? ? -140.06 41.25 151 8 ASP A 27 ? ? -55.09 -179.21 152 8 ASN A 34 ? ? -97.59 -73.65 153 8 LYS A 35 ? ? -163.50 31.91 154 8 VAL A 36 ? ? -157.47 63.95 155 8 LYS A 51 ? ? 34.00 38.55 156 8 LYS A 62 ? ? -85.83 -159.74 157 8 GLN A 63 ? ? 77.33 136.40 158 8 GLN A 70 ? ? -162.32 101.45 159 8 SER A 71 ? ? -112.11 -103.77 160 8 THR A 72 ? ? -161.02 117.94 161 8 PHE A 76 ? ? -42.80 161.34 162 8 ASP A 79 ? ? -99.41 -65.60 163 8 ALA A 80 ? ? 61.26 133.09 164 8 THR A 86 ? ? -167.19 111.68 165 8 HIS A 92 ? ? -90.21 34.23 166 8 ALA A 95 ? ? -98.23 32.97 167 9 LYS A 6 ? ? -51.07 106.74 168 9 ASP A 10 ? ? 80.40 29.54 169 9 ASN A 34 ? ? -100.38 -88.09 170 9 LYS A 35 ? ? -144.14 33.72 171 9 VAL A 36 ? ? -153.77 64.53 172 9 LYS A 51 ? ? 36.47 39.08 173 9 SER A 52 ? ? -108.76 -157.63 174 9 ALA A 53 ? ? -169.07 33.92 175 9 LEU A 59 ? ? -131.37 -52.71 176 9 GLN A 70 ? ? 177.01 119.93 177 9 SER A 71 ? ? -109.97 -75.14 178 9 THR A 72 ? ? -160.75 107.84 179 9 PHE A 76 ? ? -36.69 150.75 180 9 ALA A 80 ? ? -33.82 105.27 181 9 PRO A 81 ? ? -77.84 41.44 182 9 ALA A 82 ? ? 46.87 -178.25 183 9 THR A 86 ? ? 61.79 100.49 184 9 ALA A 95 ? ? -99.12 38.66 185 9 ALA A 104 ? ? 53.09 -171.44 186 10 ASP A 10 ? ? 168.47 -25.65 187 10 PHE A 16 ? ? -49.31 153.73 188 10 ASP A 27 ? ? -50.54 -178.21 189 10 ASN A 34 ? ? -112.88 -73.68 190 10 LYS A 35 ? ? -162.91 28.39 191 10 VAL A 36 ? ? -148.05 58.61 192 10 LEU A 47 ? ? -113.88 61.08 193 10 LYS A 51 ? ? -35.88 95.43 194 10 ALA A 53 ? ? -159.86 23.94 195 10 LEU A 64 ? ? -49.26 165.01 196 10 GLN A 70 ? ? 170.15 117.54 197 10 SER A 71 ? ? -115.51 -146.82 198 10 PHE A 76 ? ? -45.58 153.12 199 10 ALA A 80 ? ? -32.85 93.58 200 10 TYR A 88 ? ? -160.47 -162.41 201 10 ALA A 95 ? ? -91.81 34.35 202 11 LEU A 7 ? ? -59.68 172.48 203 11 SER A 9 ? ? -47.67 -91.31 204 11 ASP A 10 ? ? 177.36 -34.63 205 11 LEU A 13 ? ? -149.60 -148.30 206 11 ASP A 27 ? ? -125.77 -142.66 207 11 ASN A 34 ? ? -94.97 -94.49 208 11 LYS A 35 ? ? -143.54 37.29 209 11 VAL A 36 ? ? -150.81 62.80 210 11 LYS A 51 ? ? 36.48 91.13 211 11 ALA A 56 ? ? 163.88 -50.27 212 11 HIS A 61 ? ? -108.99 -154.23 213 11 LYS A 62 ? ? -148.05 -62.14 214 11 GLN A 70 ? ? -170.83 94.01 215 11 SER A 71 ? ? -103.20 -79.91 216 11 THR A 72 ? ? -160.95 110.11 217 11 THR A 74 ? ? -62.40 96.77 218 11 PHE A 76 ? ? -33.88 146.05 219 11 ASP A 79 ? ? -98.88 -71.21 220 11 ALA A 80 ? ? 31.51 98.05 221 11 TYR A 88 ? ? -157.10 -156.42 222 11 HIS A 92 ? ? -88.34 32.97 223 11 ALA A 104 ? ? -175.80 -157.19 224 12 LYS A 6 ? ? -51.35 108.97 225 12 SER A 9 ? ? -68.14 -104.00 226 12 ASP A 10 ? ? -171.77 26.03 227 12 ASN A 34 ? ? -103.41 -76.21 228 12 LYS A 35 ? ? -157.61 34.33 229 12 VAL A 36 ? ? -154.17 65.05 230 12 LYS A 51 ? ? 36.21 47.22 231 12 LYS A 62 ? ? 70.62 -65.67 232 12 GLN A 70 ? ? -172.74 92.36 233 12 SER A 71 ? ? -99.07 -140.37 234 12 PHE A 76 ? ? -43.13 160.43 235 12 ALA A 80 ? ? -39.65 109.86 236 12 TYR A 88 ? ? -160.24 -148.40 237 12 HIS A 92 ? ? -55.03 87.26 238 12 MET A 97 ? ? -102.04 56.86 239 12 ALA A 104 ? ? -105.49 -74.96 240 13 LYS A 6 ? ? -69.80 85.97 241 13 LEU A 7 ? ? -62.54 -172.58 242 13 SER A 9 ? ? -60.55 -90.43 243 13 ASP A 10 ? ? -175.57 29.55 244 13 ASP A 27 ? ? -66.22 -179.17 245 13 LYS A 35 ? ? -172.72 36.02 246 13 VAL A 36 ? ? -148.65 55.79 247 13 ASP A 44 ? ? -43.34 167.64 248 13 LYS A 51 ? ? 39.82 54.35 249 13 ALA A 53 ? ? -142.85 47.84 250 13 ASP A 54 ? ? -115.09 -71.78 251 13 LEU A 64 ? ? -44.47 157.90 252 13 SER A 71 ? ? -103.31 -135.91 253 13 THR A 74 ? ? -162.78 108.20 254 13 PHE A 76 ? ? -45.34 163.63 255 13 ASP A 79 ? ? -99.37 -76.16 256 13 ALA A 80 ? ? 37.70 57.52 257 13 PRO A 81 ? ? -77.93 -160.37 258 13 ALA A 82 ? ? 72.70 -73.83 259 13 TYR A 88 ? ? -158.78 -157.40 260 13 HIS A 92 ? ? -86.01 40.61 261 13 ALA A 104 ? ? -42.98 95.54 262 14 LEU A 7 ? ? -110.03 73.46 263 14 ASP A 27 ? ? -43.80 165.35 264 14 ASN A 34 ? ? -104.47 -154.28 265 14 ASP A 44 ? ? -45.74 169.00 266 14 LEU A 47 ? ? -94.10 48.83 267 14 LYS A 51 ? ? -40.40 93.70 268 14 ALA A 53 ? ? -119.01 72.03 269 14 ASP A 54 ? ? -167.73 -38.40 270 14 LEU A 59 ? ? -104.10 -62.53 271 14 GLN A 63 ? ? -46.65 163.76 272 14 ASP A 79 ? ? -99.12 -77.60 273 14 ALA A 80 ? ? 56.66 109.31 274 14 ALA A 82 ? ? -46.41 109.30 275 14 GLU A 84 ? ? -160.44 106.23 276 14 TYR A 88 ? ? -159.12 -154.11 277 14 HIS A 92 ? ? -69.98 64.44 278 14 ALA A 95 ? ? -151.39 39.30 279 15 ASP A 10 ? ? 174.46 -62.58 280 15 LEU A 14 ? ? -100.64 52.37 281 15 GLU A 17 ? ? -160.16 108.01 282 15 ASN A 34 ? ? -157.31 -58.16 283 15 LYS A 35 ? ? -71.51 -150.80 284 15 LYS A 51 ? ? 28.49 40.88 285 15 ALA A 53 ? ? -146.34 19.58 286 15 GLN A 70 ? ? 178.55 112.36 287 15 SER A 71 ? ? -104.85 -82.19 288 15 SER A 73 ? ? -102.68 67.31 289 15 THR A 74 ? ? -46.26 99.28 290 15 PHE A 76 ? ? -47.85 162.45 291 15 ASP A 79 ? ? -99.32 -71.01 292 15 ALA A 80 ? ? 42.76 88.26 293 15 THR A 86 ? ? -164.83 103.58 294 15 TYR A 88 ? ? -159.96 -153.38 295 15 HIS A 92 ? ? -65.93 75.36 296 15 ALA A 95 ? ? -98.03 33.59 297 16 VAL A 5 ? ? -104.98 79.97 298 16 ASP A 10 ? ? 83.36 20.05 299 16 ASN A 34 ? ? -115.70 -84.00 300 16 LYS A 35 ? ? -145.95 35.15 301 16 VAL A 36 ? ? -156.87 60.36 302 16 ASP A 44 ? ? -47.16 158.35 303 16 LEU A 47 ? ? -101.43 64.50 304 16 LYS A 51 ? ? 34.28 49.75 305 16 SER A 71 ? ? -99.88 -105.89 306 16 THR A 74 ? ? -59.67 101.51 307 16 PHE A 76 ? ? -36.22 147.97 308 16 ALA A 80 ? ? -34.60 104.54 309 16 THR A 86 ? ? -166.79 98.40 310 16 ALA A 95 ? ? -136.92 -129.62 311 16 ALA A 104 ? ? -105.70 -152.31 312 17 LEU A 7 ? ? -47.42 173.23 313 17 SER A 9 ? ? -49.92 -75.98 314 17 ASP A 10 ? ? -173.16 -71.72 315 17 ASP A 27 ? ? 49.61 -176.20 316 17 ASN A 34 ? ? -114.64 -142.05 317 17 LYS A 35 ? ? -99.36 36.11 318 17 VAL A 36 ? ? -151.46 61.95 319 17 LEU A 47 ? ? -140.32 46.66 320 17 LYS A 51 ? ? -40.06 95.27 321 17 LEU A 59 ? ? -135.64 -48.64 322 17 LYS A 62 ? ? -110.48 -161.66 323 17 GLN A 63 ? ? 66.90 106.92 324 17 SER A 71 ? ? -132.80 -155.03 325 17 PHE A 76 ? ? -36.24 151.97 326 17 ALA A 80 ? ? -38.20 105.28 327 17 TYR A 85 ? ? -84.44 -156.12 328 17 THR A 86 ? ? -163.88 87.04 329 17 MET A 97 ? ? -107.37 53.82 330 18 LYS A 6 ? ? -49.48 98.81 331 18 SER A 9 ? ? -100.72 -68.99 332 18 ASP A 10 ? ? 167.24 -49.35 333 18 LEU A 13 ? ? -121.98 -169.10 334 18 ASP A 27 ? ? -66.40 -178.84 335 18 ASN A 34 ? ? -150.04 -37.46 336 18 LYS A 35 ? ? -99.40 -144.32 337 18 LYS A 51 ? ? 35.32 36.79 338 18 ALA A 53 ? ? -92.50 54.78 339 18 ASP A 54 ? ? -140.63 23.22 340 18 ALA A 56 ? ? -142.90 -47.12 341 18 LYS A 62 ? ? 54.65 -170.78 342 18 GLN A 63 ? ? 75.45 -179.75 343 18 MET A 66 ? ? -160.74 -37.35 344 18 SER A 71 ? ? -104.77 -104.27 345 18 PHE A 76 ? ? -43.01 165.13 346 18 ASP A 79 ? ? -99.43 -74.61 347 18 ALA A 80 ? ? 34.84 69.70 348 18 ALA A 82 ? ? -49.07 98.61 349 18 PRO A 91 ? ? -78.10 -75.61 350 18 HIS A 92 ? ? -65.50 69.18 351 18 MET A 97 ? ? -65.35 72.85 352 18 ALA A 104 ? ? -75.25 -147.90 353 19 VAL A 5 ? ? -106.13 -155.22 354 19 LYS A 6 ? ? -175.22 127.93 355 19 SER A 9 ? ? -46.56 150.39 356 19 ASP A 10 ? ? -88.28 36.90 357 19 PRO A 18 ? ? -77.53 -163.59 358 19 ASP A 27 ? ? -108.16 -164.98 359 19 ASN A 34 ? ? -110.07 -78.87 360 19 LYS A 35 ? ? -151.25 34.71 361 19 VAL A 36 ? ? -156.39 56.34 362 19 LYS A 51 ? ? 39.45 31.46 363 19 ASP A 54 ? ? -163.49 -46.01 364 19 GLN A 63 ? ? 167.53 29.44 365 19 LEU A 64 ? ? 47.66 123.62 366 19 SER A 71 ? ? -99.95 -80.28 367 19 THR A 72 ? ? -160.33 107.80 368 19 PHE A 76 ? ? -41.41 157.11 369 19 ALA A 80 ? ? -40.40 100.60 370 19 TYR A 88 ? ? -160.70 -147.70 371 20 SER A 9 ? ? -52.58 -88.59 372 20 ASP A 10 ? ? -172.38 37.03 373 20 ASP A 27 ? ? -62.47 -168.51 374 20 ASN A 34 ? ? -151.19 -58.52 375 20 LYS A 35 ? ? -60.72 -147.78 376 20 PRO A 38 ? ? -84.57 -156.09 377 20 LYS A 51 ? ? 32.50 45.88 378 20 GLN A 63 ? ? 70.27 126.73 379 20 GLN A 70 ? ? -153.11 82.04 380 20 PHE A 76 ? ? -40.46 150.26 381 20 ALA A 80 ? ? -38.59 99.11 382 20 THR A 86 ? ? -166.59 105.72 383 20 HIS A 92 ? ? -89.78 30.34 384 20 ARG A 93 ? ? -60.26 91.99 385 20 ALA A 95 ? ? -91.32 37.19 386 20 MET A 97 ? ? -91.26 53.57 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 93 ? ? 0.184 'SIDE CHAIN' 2 2 ARG A 93 ? ? 0.200 'SIDE CHAIN' 3 3 ARG A 93 ? ? 0.234 'SIDE CHAIN' 4 5 ARG A 93 ? ? 0.081 'SIDE CHAIN' 5 6 ARG A 93 ? ? 0.307 'SIDE CHAIN' 6 7 ARG A 93 ? ? 0.225 'SIDE CHAIN' 7 8 ARG A 93 ? ? 0.268 'SIDE CHAIN' 8 9 ARG A 93 ? ? 0.294 'SIDE CHAIN' 9 10 ARG A 93 ? ? 0.317 'SIDE CHAIN' 10 11 ARG A 93 ? ? 0.178 'SIDE CHAIN' 11 12 ARG A 93 ? ? 0.230 'SIDE CHAIN' 12 13 ARG A 93 ? ? 0.196 'SIDE CHAIN' 13 14 ARG A 93 ? ? 0.218 'SIDE CHAIN' 14 15 ARG A 93 ? ? 0.244 'SIDE CHAIN' 15 16 ARG A 93 ? ? 0.219 'SIDE CHAIN' 16 17 ARG A 93 ? ? 0.205 'SIDE CHAIN' 17 18 ARG A 93 ? ? 0.312 'SIDE CHAIN' 18 19 ARG A 93 ? ? 0.280 'SIDE CHAIN' 19 20 ARG A 93 ? ? 0.315 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1FA4 _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1FA4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2.9 to 3.2 mM unlabeled A. v. PCu; 100 mM NaCl' '90% H2O/10% D2O' 2 '2.9 to 3.2 mM unlabeled A. v. PCu; 100 mM NaCl' '99.9% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 ambient 6.9 '100 mM' ? K 2 298 ambient 6.9 '100 mM' ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 2 2 '2D NOESY' # _pdbx_nmr_details.entry_id 1FA4 _pdbx_nmr_details.text ;INPUT DATA FOR STRUCTURE CALCULATION: 595 INTRARESIDUAL RESTRAINTS, 279 SEQUENTIAL RESTRAINTS, 585 INTERRESIDUAL RESTRAINTS, 49 DIHEDRAL (PHI) RESTRAINTS, 29 DIHEDRAL (CHI) RESTRAINTS, 9 DIHEDRAL (OMIGA_PROLIN) RESTRAINTS, 0 HYDROGEN BOND RESTRAINTS, 4 COPPER RESTRAINTS. THE RMS DEVIATION FROM IDEALIZED GEOMETRY: BONDS:0.0031 ANGSTROMS, ANGLES:1.06 ANGSTROMS, IMPROPERS:0.42 ANGSTROMS. ; # _pdbx_nmr_refine.entry_id 1FA4 _pdbx_nmr_refine.method 'Distance geometry, simulated annealing and restrained energy minimization' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.851 'structure solution' Brunger 1 X-PLOR 3.851 refinement Brunger 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CU CU CU N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TYR N N N N 319 TYR CA C N S 320 TYR C C N N 321 TYR O O N N 322 TYR CB C N N 323 TYR CG C Y N 324 TYR CD1 C Y N 325 TYR CD2 C Y N 326 TYR CE1 C Y N 327 TYR CE2 C Y N 328 TYR CZ C Y N 329 TYR OH O N N 330 TYR OXT O N N 331 TYR H H N N 332 TYR H2 H N N 333 TYR HA H N N 334 TYR HB2 H N N 335 TYR HB3 H N N 336 TYR HD1 H N N 337 TYR HD2 H N N 338 TYR HE1 H N N 339 TYR HE2 H N N 340 TYR HH H N N 341 TYR HXT H N N 342 VAL N N N N 343 VAL CA C N S 344 VAL C C N N 345 VAL O O N N 346 VAL CB C N N 347 VAL CG1 C N N 348 VAL CG2 C N N 349 VAL OXT O N N 350 VAL H H N N 351 VAL H2 H N N 352 VAL HA H N N 353 VAL HB H N N 354 VAL HG11 H N N 355 VAL HG12 H N N 356 VAL HG13 H N N 357 VAL HG21 H N N 358 VAL HG22 H N N 359 VAL HG23 H N N 360 VAL HXT H N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 500 2 ? Varian INOVA 750 # _atom_sites.entry_id 1FA4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CU H N O S # loop_