data_1FBB # _entry.id 1FBB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.290 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1FBB RCSB RCSB011455 WWPDB D_1000011455 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1FBK _pdbx_database_related.details 'Crystal Structure of Cytoplasmically Open Conformation of Bacteriorhodopsin' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FBB _pdbx_database_status.recvd_initial_deposition_date 2000-07-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Subramaniam, S.' 1 'Henderson, R.' 2 # _citation.id primary _citation.title 'Molecular mechanism of vectorial proton translocation by bacteriorhodopsin.' _citation.journal_abbrev Nature _citation.journal_volume 406 _citation.page_first 653 _citation.page_last 657 _citation.year 2000 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10949309 _citation.pdbx_database_id_DOI 10.1038/35020614 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Subramaniam, S.' 1 primary 'Henderson, R.' 2 # _cell.entry_id 1FBB _cell.length_a 62.45 _cell.length_b 62.45 _cell.length_c 100.9 _cell.angle_alpha 90 _cell.angle_beta 90 _cell.angle_gamma 120 _cell.Z_PDB 3 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1FBB _symmetry.space_group_name_H-M 'P 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 143 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat BACTERIORHODOPSIN 26814.412 1 ? ? ? ? 2 non-polymer syn RETINAL 284.436 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYW ARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKA ESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSA GDGAAATS ; _entity_poly.pdbx_seq_one_letter_code_can ;QAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYW ARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKA ESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSA GDGAAATS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ALA n 1 3 GLN n 1 4 ILE n 1 5 THR n 1 6 GLY n 1 7 ARG n 1 8 PRO n 1 9 GLU n 1 10 TRP n 1 11 ILE n 1 12 TRP n 1 13 LEU n 1 14 ALA n 1 15 LEU n 1 16 GLY n 1 17 THR n 1 18 ALA n 1 19 LEU n 1 20 MET n 1 21 GLY n 1 22 LEU n 1 23 GLY n 1 24 THR n 1 25 LEU n 1 26 TYR n 1 27 PHE n 1 28 LEU n 1 29 VAL n 1 30 LYS n 1 31 GLY n 1 32 MET n 1 33 GLY n 1 34 VAL n 1 35 SER n 1 36 ASP n 1 37 PRO n 1 38 ASP n 1 39 ALA n 1 40 LYS n 1 41 LYS n 1 42 PHE n 1 43 TYR n 1 44 ALA n 1 45 ILE n 1 46 THR n 1 47 THR n 1 48 LEU n 1 49 VAL n 1 50 PRO n 1 51 ALA n 1 52 ILE n 1 53 ALA n 1 54 PHE n 1 55 THR n 1 56 MET n 1 57 TYR n 1 58 LEU n 1 59 SER n 1 60 MET n 1 61 LEU n 1 62 LEU n 1 63 GLY n 1 64 TYR n 1 65 GLY n 1 66 LEU n 1 67 THR n 1 68 MET n 1 69 VAL n 1 70 PRO n 1 71 PHE n 1 72 GLY n 1 73 GLY n 1 74 GLU n 1 75 GLN n 1 76 ASN n 1 77 PRO n 1 78 ILE n 1 79 TYR n 1 80 TRP n 1 81 ALA n 1 82 ARG n 1 83 TYR n 1 84 ALA n 1 85 ASP n 1 86 TRP n 1 87 LEU n 1 88 PHE n 1 89 THR n 1 90 THR n 1 91 PRO n 1 92 LEU n 1 93 LEU n 1 94 LEU n 1 95 LEU n 1 96 ASP n 1 97 LEU n 1 98 ALA n 1 99 LEU n 1 100 LEU n 1 101 VAL n 1 102 ASP n 1 103 ALA n 1 104 ASP n 1 105 GLN n 1 106 GLY n 1 107 THR n 1 108 ILE n 1 109 LEU n 1 110 ALA n 1 111 LEU n 1 112 VAL n 1 113 GLY n 1 114 ALA n 1 115 ASP n 1 116 GLY n 1 117 ILE n 1 118 MET n 1 119 ILE n 1 120 GLY n 1 121 THR n 1 122 GLY n 1 123 LEU n 1 124 VAL n 1 125 GLY n 1 126 ALA n 1 127 LEU n 1 128 THR n 1 129 LYS n 1 130 VAL n 1 131 TYR n 1 132 SER n 1 133 TYR n 1 134 ARG n 1 135 PHE n 1 136 VAL n 1 137 TRP n 1 138 TRP n 1 139 ALA n 1 140 ILE n 1 141 SER n 1 142 THR n 1 143 ALA n 1 144 ALA n 1 145 MET n 1 146 LEU n 1 147 TYR n 1 148 ILE n 1 149 LEU n 1 150 TYR n 1 151 VAL n 1 152 LEU n 1 153 PHE n 1 154 PHE n 1 155 GLY n 1 156 PHE n 1 157 THR n 1 158 SER n 1 159 LYS n 1 160 ALA n 1 161 GLU n 1 162 SER n 1 163 MET n 1 164 ARG n 1 165 PRO n 1 166 GLU n 1 167 VAL n 1 168 ALA n 1 169 SER n 1 170 THR n 1 171 PHE n 1 172 LYS n 1 173 VAL n 1 174 LEU n 1 175 ARG n 1 176 ASN n 1 177 VAL n 1 178 THR n 1 179 VAL n 1 180 VAL n 1 181 LEU n 1 182 TRP n 1 183 SER n 1 184 ALA n 1 185 TYR n 1 186 PRO n 1 187 VAL n 1 188 VAL n 1 189 TRP n 1 190 LEU n 1 191 ILE n 1 192 GLY n 1 193 SER n 1 194 GLU n 1 195 GLY n 1 196 ALA n 1 197 GLY n 1 198 ILE n 1 199 VAL n 1 200 PRO n 1 201 LEU n 1 202 ASN n 1 203 ILE n 1 204 GLU n 1 205 THR n 1 206 LEU n 1 207 LEU n 1 208 PHE n 1 209 MET n 1 210 VAL n 1 211 LEU n 1 212 ASP n 1 213 VAL n 1 214 SER n 1 215 ALA n 1 216 LYS n 1 217 VAL n 1 218 GLY n 1 219 PHE n 1 220 GLY n 1 221 LEU n 1 222 ILE n 1 223 LEU n 1 224 LEU n 1 225 ARG n 1 226 SER n 1 227 ARG n 1 228 ALA n 1 229 ILE n 1 230 PHE n 1 231 GLY n 1 232 GLU n 1 233 ALA n 1 234 GLU n 1 235 ALA n 1 236 PRO n 1 237 GLU n 1 238 PRO n 1 239 SER n 1 240 ALA n 1 241 GLY n 1 242 ASP n 1 243 GLY n 1 244 ALA n 1 245 ALA n 1 246 ALA n 1 247 THR n 1 248 SER n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Halobacterium salinarum' _entity_src_nat.pdbx_ncbi_taxonomy_id 2242 _entity_src_nat.genus Halobacterium _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_code BACR_HALN1 _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02945 _struct_ref.pdbx_align_begin 14 _struct_ref.pdbx_seq_one_letter_code ;QAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSMLLGYGLTMVPFGGEQNPIYW ARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKA ESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSA GDGAAATS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FBB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 248 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02945 _struct_ref_seq.db_align_beg 14 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 261 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 248 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RET non-polymer . RETINAL ? 'C20 H28 O' 284.436 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1FBB _exptl.method 'ELECTRON CRYSTALLOGRAPHY' _exptl.crystals_number 167 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'naturally occurring in vivo' _exptl_crystal_grow.pH 7 _exptl_crystal_grow.temp 310.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'crystal size is increased by fusion and annealing using detergents, pH 7, naturally occurring in vivo, temperature 37K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector FILM _diffrn_detector.type OTHER _diffrn_detector.pdbx_collection_date 1986-01-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type electron # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.033 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ELECTRON MICROSCOPE' _diffrn_source.type OTHER _diffrn_source.pdbx_wavelength 0.033 _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1FBB _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 200.0 _reflns.d_resolution_high 3.2 _reflns.number_obs 4749 _reflns.number_all 7297 _reflns.percent_possible_obs 65.1 _reflns.pdbx_Rmerge_I_obs 0.1730000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 1FBB _refine.ls_number_reflns_obs 4749 _refine.ls_number_reflns_all 7297 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 200.0 _refine.ls_d_res_high 3.2 _refine.ls_percent_reflns_obs 65.1 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2390000 _refine.ls_R_factor_R_free 0.3100000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 514 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ;For the tilt angles used, the maximal possible theoretical completeness of the data set is ~87%. The completeness of our data is close to this limit up to 3.5 Angstroms. The completeness drops to 65.1% when all of the data to 3.2 Angstroms is included. ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_phase_error ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'ELECTRON CRYSTALLOGRAPHY' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1733 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1753 _refine_hist.d_res_high 3.2 _refine_hist.d_res_low 200.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.009 ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? c_angle_deg 1.4 ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? # _struct.entry_id 1FBB _struct.title 'CRYSTAL STRUCTURE OF NATIVE CONFORMATION OF BACTERIORHODOPSIN' _struct.pdbx_descriptor BACTERIORHODOPSIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FBB _struct_keywords.pdbx_keywords 'PROTON TRANSPORT' _struct_keywords.text 'PROTON PUMP, MEMBRANE PROTEIN, RETINAL PROTEIN, TWO-DIMENSIONAL CRYSTAL ELECTRON DIFFRACTION, SINGLE CRYSTAL, PROTON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ;Trimer is present in vivo The crystals contain trimers related by crystal symmetry P3 ; _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 9 ? VAL A 29 ? GLU A 9 VAL A 29 1 ? 21 HELX_P HELX_P2 2 ASP A 36 ? GLY A 63 ? ASP A 36 GLY A 63 1 ? 28 HELX_P HELX_P3 3 TYR A 79 ? VAL A 101 ? TYR A 79 VAL A 101 1 ? 23 HELX_P HELX_P4 4 ASP A 104 ? ALA A 126 ? ASP A 104 ALA A 126 1 ? 23 HELX_P HELX_P5 5 VAL A 130 ? PHE A 154 ? VAL A 130 PHE A 154 1 ? 25 HELX_P HELX_P6 6 PHE A 154 ? GLU A 161 ? PHE A 154 GLU A 161 1 ? 8 HELX_P HELX_P7 7 ARG A 164 ? GLY A 192 ? ARG A 164 GLY A 192 1 ? 29 HELX_P HELX_P8 8 PRO A 200 ? VAL A 217 ? PRO A 200 VAL A 217 1 ? 18 HELX_P HELX_P9 9 VAL A 217 ? ARG A 225 ? VAL A 217 ARG A 225 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id RET _struct_conn.ptnr1_label_seq_id . _struct_conn.ptnr1_label_atom_id C15 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id LYS _struct_conn.ptnr2_label_seq_id 216 _struct_conn.ptnr2_label_atom_id NZ _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id RET _struct_conn.ptnr1_auth_seq_id 1216 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id LYS _struct_conn.ptnr2_auth_seq_id 216 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.342 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 68 ? PRO A 70 ? MET A 68 PRO A 70 A 2 GLN A 75 ? PRO A 77 ? GLN A 75 PRO A 77 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 69 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 69 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id ASN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 76 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 76 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE RET A 1216' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 TRP A 86 ? TRP A 86 . ? 2_555 ? 2 AC1 5 TYR A 185 ? TYR A 185 . ? 2_555 ? 3 AC1 5 PRO A 186 ? PRO A 186 . ? 2_555 ? 4 AC1 5 TRP A 189 ? TRP A 189 . ? 2_555 ? 5 AC1 5 LYS A 216 ? LYS A 216 . ? 2_555 ? # _database_PDB_matrix.entry_id 1FBB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FBB _atom_sites.fract_transf_matrix[1][1] 0.016013 _atom_sites.fract_transf_matrix[1][2] 0.009245 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018490 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009911 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 ILE 4 4 4 ILE ALA A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 TRP 12 12 12 TRP TRP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 MET 68 68 68 MET MET A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 TYR 133 133 133 TYR TYR A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 TRP 137 137 137 TRP TRP A . n A 1 138 TRP 138 138 138 TRP TRP A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 MET 145 145 145 MET MET A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 LYS 159 159 159 LYS LYS A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 MET 163 163 163 MET MET A . n A 1 164 ARG 164 164 164 ARG ARG A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 TRP 182 182 182 TRP TRP A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 TYR 185 185 185 TYR TYR A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 TRP 189 189 189 TRP TRP A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 ILE 191 191 191 ILE ILE A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 ASN 202 202 202 ASN ASN A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 THR 205 205 205 THR THR A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 PHE 208 208 208 PHE PHE A . n A 1 209 MET 209 209 209 MET MET A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 LYS 216 216 216 LYS LYR A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 PHE 219 219 219 PHE PHE A . n A 1 220 GLY 220 220 220 GLY GLY A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 ARG 225 225 225 ARG ARG A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 ARG 227 227 227 ARG ARG A . n A 1 228 ALA 228 228 ? ? ? A . n A 1 229 ILE 229 229 ? ? ? A . n A 1 230 PHE 230 230 ? ? ? A . n A 1 231 GLY 231 231 ? ? ? A . n A 1 232 GLU 232 232 ? ? ? A . n A 1 233 ALA 233 233 ? ? ? A . n A 1 234 GLU 234 234 ? ? ? A . n A 1 235 ALA 235 235 ? ? ? A . n A 1 236 PRO 236 236 ? ? ? A . n A 1 237 GLU 237 237 ? ? ? A . n A 1 238 PRO 238 238 ? ? ? A . n A 1 239 SER 239 239 ? ? ? A . n A 1 240 ALA 240 240 ? ? ? A . n A 1 241 GLY 241 241 ? ? ? A . n A 1 242 ASP 242 242 ? ? ? A . n A 1 243 GLY 243 243 ? ? ? A . n A 1 244 ALA 244 244 ? ? ? A . n A 1 245 ALA 245 245 ? ? ? A . n A 1 246 ALA 246 246 ? ? ? A . n A 1 247 THR 247 247 ? ? ? A . n A 1 248 SER 248 248 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id RET _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1216 _pdbx_nonpoly_scheme.auth_seq_num 216 _pdbx_nonpoly_scheme.pdb_mon_id RET _pdbx_nonpoly_scheme.auth_mon_id LYR _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6580 ? 1 MORE -53 ? 1 'SSA (A^2)' 27070 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-08-09 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-02-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Author supporting evidence' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Data processing' 7 4 'Structure model' 'Experimental preparation' 8 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' em_3d_reconstruction 2 4 'Structure model' em_image_scans 3 4 'Structure model' em_single_particle_entity 4 4 'Structure model' exptl_crystal_grow 5 4 'Structure model' software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_exptl_crystal_grow.pdbx_details' 2 4 'Structure model' '_exptl_crystal_grow.temp' # _software.name CNS _software.classification refinement _software.version 0.9 _software.citation_id ? _software.pdbx_ordinal 1 # _em_entity_assembly.id 1 _em_entity_assembly.name Bacteriorhodopsin _em_entity_assembly.parent_id 0 _em_entity_assembly.source . _em_entity_assembly.type COMPLEX _em_entity_assembly.details ? _em_entity_assembly.entity_id_list ? _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # loop_ _em_imaging.entry_id _em_imaging.id _em_imaging.specimen_id _em_imaging.accelerating_voltage _em_imaging.electron_source _em_imaging.illumination_mode _em_imaging.mode _em_imaging.microscope_model _em_imaging.calibrated_defocus_max _em_imaging.alignment_procedure _em_imaging.c2_aperture_diameter _em_imaging.calibrated_defocus_min _em_imaging.calibrated_magnification _em_imaging.cryogen _em_imaging.details _em_imaging.nominal_cs _em_imaging.nominal_defocus_max _em_imaging.nominal_defocus_min _em_imaging.nominal_magnification _em_imaging.residual_tilt _em_imaging.specimen_holder_model _em_imaging.recording_temperature_maximum _em_imaging.recording_temperature_minimum _em_imaging.citation_id _em_imaging.date _em_imaging.temperature _em_imaging.tilt_angle_min _em_imaging.tilt_angle_max _em_imaging.astigmatism _em_imaging.detector_distance _em_imaging.electron_beam_tilt_params _em_imaging.specimen_holder_type 1FBB 1 1 120 ? 'FLOOD BEAM' DIFFRACTION 'FEI/PHILIPS EM420' ? ? ? ? ? ? '60 degree tilted specimens' ? ? ? ? ? ? 153 ? ? ? ? ? ? ? ? ? ? 1FBB 2 1 100 ? 'FLOOD BEAM' 'BRIGHT FIELD' 'SIEMENS SULEIKA' ? ? ? ? ? HELIUM '0, 20, 45 degree + random degree tilts' ? ? ? 66000 ? ? 5 ? ? ? ? ? ? ? ? ? ? 1FBB 3 1 100 'FIELD EMISSION GUN' 'SPOT SCAN' 'BRIGHT FIELD' 'JEOL 100B' ? ? ? ? ? NITROGEN ', 20, 45 degree + random degree tilts' ? ? ? 55000 ? ? 158 ? ? ? ? ? ? ? ? ? ? # _em_experiment.entry_id 1FBB _em_experiment.id 1 _em_experiment.entity_assembly_id 1 _em_experiment.aggregation_state '2D ARRAY' _em_experiment.reconstruction_method CRYSTALLOGRAPHY # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 5 ? ? 174.14 50.44 2 1 ARG A 7 ? ? -130.34 -46.57 3 1 ILE A 11 ? ? -63.48 -81.76 4 1 VAL A 29 ? ? -92.51 48.90 5 1 LYS A 30 ? ? -158.70 -9.58 6 1 VAL A 34 ? ? 27.10 107.27 7 1 TYR A 43 ? ? -44.79 -71.43 8 1 THR A 46 ? ? -55.45 8.77 9 1 TYR A 64 ? ? -22.11 -38.45 10 1 LEU A 66 ? ? -58.61 173.04 11 1 TYR A 79 ? ? -64.02 84.17 12 1 TYR A 83 ? ? -39.96 -39.40 13 1 ASP A 85 ? ? -44.59 -74.77 14 1 LEU A 100 ? ? -55.98 -70.17 15 1 VAL A 101 ? ? -75.04 45.77 16 1 ASP A 102 ? ? 9.89 73.64 17 1 MET A 118 ? ? -61.51 -73.09 18 1 ALA A 126 ? ? -77.03 35.94 19 1 TYR A 150 ? ? -62.94 -71.40 20 1 VAL A 151 ? ? -62.82 19.15 21 1 PHE A 154 ? ? -101.44 -70.18 22 1 PHE A 156 ? ? -37.81 -17.72 23 1 SER A 158 ? ? -54.26 -70.78 24 1 SER A 162 ? ? -169.18 37.46 25 1 MET A 163 ? ? -150.02 -120.03 26 1 VAL A 173 ? ? -46.98 -78.71 27 1 LEU A 181 ? ? -40.52 -76.19 28 1 TYR A 185 ? ? -53.21 -71.00 29 1 ILE A 198 ? ? -96.47 -65.87 30 1 ILE A 203 ? ? -85.62 -71.16 31 1 GLU A 204 ? ? -18.10 -71.91 32 1 ASP A 212 ? ? -69.90 -74.40 33 1 LEU A 223 ? ? -54.31 -89.21 34 1 LEU A 224 ? ? -30.68 -28.77 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 57 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.083 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 4 ? CG1 ? A ILE 4 CG1 2 1 Y 1 A ILE 4 ? CG2 ? A ILE 4 CG2 3 1 Y 1 A ILE 4 ? CD1 ? A ILE 4 CD1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 1 ? A GLN 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A ALA 228 ? A ALA 228 5 1 Y 1 A ILE 229 ? A ILE 229 6 1 Y 1 A PHE 230 ? A PHE 230 7 1 Y 1 A GLY 231 ? A GLY 231 8 1 Y 1 A GLU 232 ? A GLU 232 9 1 Y 1 A ALA 233 ? A ALA 233 10 1 Y 1 A GLU 234 ? A GLU 234 11 1 Y 1 A ALA 235 ? A ALA 235 12 1 Y 1 A PRO 236 ? A PRO 236 13 1 Y 1 A GLU 237 ? A GLU 237 14 1 Y 1 A PRO 238 ? A PRO 238 15 1 Y 1 A SER 239 ? A SER 239 16 1 Y 1 A ALA 240 ? A ALA 240 17 1 Y 1 A GLY 241 ? A GLY 241 18 1 Y 1 A ASP 242 ? A ASP 242 19 1 Y 1 A GLY 243 ? A GLY 243 20 1 Y 1 A ALA 244 ? A ALA 244 21 1 Y 1 A ALA 245 ? A ALA 245 22 1 Y 1 A ALA 246 ? A ALA 246 23 1 Y 1 A THR 247 ? A THR 247 24 1 Y 1 A SER 248 ? A SER 248 # loop_ _em_image_recording.id _em_image_recording.imaging_id _em_image_recording.film_or_detector_model _em_image_recording.avg_electron_dose_per_image _em_image_recording.average_exposure_time _em_image_recording.details _em_image_recording.num_grids_imaged _em_image_recording.num_diffraction_images _em_image_recording.num_real_images _em_image_recording.detector_mode 2 2 'GENERIC FILM' 20 12 ? ? ? 52 ? 3 3 'GENERIC FILM' 15 ? ? ? ? 20 ? 1 1 'GENERIC FILM' ? ? ? ? 150 ? ? # _em_specimen.experiment_id 1 _em_specimen.id 1 _em_specimen.embedding_applied YES _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES _em_specimen.concentration ? _em_specimen.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name RETINAL _pdbx_entity_nonpoly.comp_id RET #