data_1FCL # _entry.id 1FCL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1FCL pdb_00001fcl 10.2210/pdb1fcl/pdb RCSB RCSB011479 ? ? WWPDB D_1000011479 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-09-19 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FCL _pdbx_database_status.recvd_initial_deposition_date 2000-07-18 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1FD6 'DELTA0: A Computationally Designed Core Variant of the B1 Domain of Streptococcal Protein G' unspecified PDB 1GB1 'Protein G (B1 Domain)' unspecified PDB 1GB4 'HYPERTHERMOPHILIC VARIANT OF THE B1 DOMAIN FROM STREPTOCOCCAL PROTEIN G' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ross, S.A.' 1 'Sarisky, C.A.' 2 'Su, A.' 3 'Mayo, S.L.' 4 # _citation.id primary _citation.title ;Designed protein G core variants fold to native-like structures: sequence selection by ORBIT tolerates variation in backbone specification. ; _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 10 _citation.page_first 450 _citation.page_last 454 _citation.year 2001 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11266631 _citation.pdbx_database_id_DOI 10.1110/ps.32501 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ross, S.A.' 1 ? primary 'Sarisky, C.A.' 2 ? primary 'Su, A.' 3 ? primary 'Mayo, S.L.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'IMMUNOGLOBULIN G BINDING PROTEIN G' _entity.formula_weight 6216.819 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'Y3F, L7I, F30L, A34I, V39I, F52W' _entity.pdbx_fragment GB1_DELTA1.5 _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IGG BINDING PROTEIN G' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code TTFKLIINGKTLKGETTTEAVDAATAEKVLKQYINDNGIDGEWTYDDATKTWTVTE _entity_poly.pdbx_seq_one_letter_code_can TTFKLIINGKTLKGETTTEAVDAATAEKVLKQYINDNGIDGEWTYDDATKTWTVTE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 THR n 1 3 PHE n 1 4 LYS n 1 5 LEU n 1 6 ILE n 1 7 ILE n 1 8 ASN n 1 9 GLY n 1 10 LYS n 1 11 THR n 1 12 LEU n 1 13 LYS n 1 14 GLY n 1 15 GLU n 1 16 THR n 1 17 THR n 1 18 THR n 1 19 GLU n 1 20 ALA n 1 21 VAL n 1 22 ASP n 1 23 ALA n 1 24 ALA n 1 25 THR n 1 26 ALA n 1 27 GLU n 1 28 LYS n 1 29 VAL n 1 30 LEU n 1 31 LYS n 1 32 GLN n 1 33 TYR n 1 34 ILE n 1 35 ASN n 1 36 ASP n 1 37 ASN n 1 38 GLY n 1 39 ILE n 1 40 ASP n 1 41 GLY n 1 42 GLU n 1 43 TRP n 1 44 THR n 1 45 TYR n 1 46 ASP n 1 47 ASP n 1 48 ALA n 1 49 THR n 1 50 LYS n 1 51 THR n 1 52 TRP n 1 53 THR n 1 54 VAL n 1 55 THR n 1 56 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptococcus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1306 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n # _cell.entry_id 1FCL _cell.length_a ? _cell.length_b ? _cell.length_c ? _cell.angle_alpha ? _cell.angle_beta ? _cell.angle_gamma ? _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _exptl.entry_id 1FCL _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1FCL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1FCL _struct.title 'DELTA1.5: A COMPUTATIONALLY DESIGNED CORE VARIANT OF THE B1 DOMAIN OF STREPTOCOCCAL PROTEIN G' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FCL _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'Designed Core Mutant, Streptococcal Protein G, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_code SPG2_STRSG _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P19909 _struct_ref.pdbx_align_begin 303 _struct_ref.pdbx_seq_one_letter_code DTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FCL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 56 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P19909 _struct_ref_seq.db_align_beg 302 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 357 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 56 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1FCL THR A 1 ? UNP P19909 ASP 302 'engineered mutation' 1 1 1 1FCL PHE A 3 ? UNP P19909 TYR 304 'engineered mutation' 3 2 1 1FCL ILE A 7 ? UNP P19909 VAL 308 'engineered mutation' 7 3 1 1FCL LEU A 30 ? UNP P19909 PHE 331 'engineered mutation' 30 4 1 1FCL ILE A 34 ? UNP P19909 ALA 335 'engineered mutation' 34 5 1 1FCL ILE A 39 ? UNP P19909 VAL 340 'engineered mutation' 39 6 1 1FCL TRP A 52 ? UNP P19909 PHE 353 'engineered mutation' 52 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 22 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 38 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 22 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 38 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 13 ? THR A 18 ? LYS A 13 THR A 18 A 2 PHE A 3 ? ASN A 8 ? PHE A 3 ASN A 8 A 3 THR A 53 ? THR A 55 ? THR A 53 THR A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 18 ? O THR A 18 N PHE A 3 ? N PHE A 3 A 2 3 N ASN A 8 ? N ASN A 8 O VAL A 54 ? O VAL A 54 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 O A THR 44 ? ? HG1 A THR 53 ? ? 1.53 2 14 O A THR 44 ? ? HG1 A THR 53 ? ? 1.53 3 38 OG1 A THR 1 ? ? HZ1 A LYS 50 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 8 ? ? -109.63 52.09 2 1 ILE A 39 ? ? -115.60 73.11 3 1 ALA A 48 ? ? -56.78 -72.48 4 1 VAL A 54 ? ? -171.62 88.15 5 2 ASN A 8 ? ? -113.79 53.30 6 2 ALA A 48 ? ? -56.76 -72.38 7 2 VAL A 54 ? ? -172.47 88.24 8 3 ASN A 8 ? ? -110.85 52.93 9 3 ILE A 39 ? ? -111.91 69.38 10 3 ALA A 48 ? ? -54.34 -70.14 11 3 VAL A 54 ? ? -172.45 90.15 12 4 ASN A 8 ? ? -110.39 54.28 13 4 THR A 11 ? ? -134.37 -43.70 14 4 ILE A 39 ? ? -115.92 73.20 15 4 ALA A 48 ? ? -55.09 -70.91 16 4 VAL A 54 ? ? -170.57 86.95 17 5 ASN A 8 ? ? -110.64 50.91 18 5 ILE A 39 ? ? -115.46 68.50 19 5 ALA A 48 ? ? -56.94 -71.30 20 5 VAL A 54 ? ? -171.38 87.62 21 6 ASN A 8 ? ? -110.05 51.35 22 6 ALA A 48 ? ? -56.11 -71.36 23 6 VAL A 54 ? ? -177.00 74.26 24 7 ASN A 8 ? ? -109.98 53.09 25 7 ILE A 39 ? ? -113.66 73.07 26 7 ALA A 48 ? ? -56.88 -73.50 27 7 VAL A 54 ? ? -171.99 87.37 28 8 ASN A 8 ? ? -107.30 51.60 29 8 ILE A 39 ? ? -114.47 72.51 30 8 ALA A 48 ? ? -58.95 -72.15 31 8 VAL A 54 ? ? -171.48 78.34 32 9 ASN A 8 ? ? -100.57 51.77 33 9 ILE A 39 ? ? -113.42 74.19 34 9 ALA A 48 ? ? -54.75 -70.10 35 9 VAL A 54 ? ? -170.86 78.97 36 10 ASN A 8 ? ? -107.31 51.66 37 10 ILE A 39 ? ? -116.94 67.69 38 10 ALA A 48 ? ? -57.48 -73.09 39 10 VAL A 54 ? ? -171.93 80.31 40 11 ASN A 8 ? ? -109.25 53.41 41 11 ILE A 39 ? ? -115.68 70.93 42 11 ALA A 48 ? ? -58.84 -72.63 43 11 VAL A 54 ? ? -170.60 91.29 44 12 ASN A 8 ? ? -116.18 52.82 45 12 ILE A 39 ? ? -117.22 73.99 46 12 ALA A 48 ? ? -56.62 -71.00 47 12 VAL A 54 ? ? -170.31 83.87 48 13 ASN A 8 ? ? -116.33 53.10 49 13 ALA A 48 ? ? -56.69 -72.01 50 13 VAL A 54 ? ? -170.28 83.60 51 14 ASN A 8 ? ? -110.75 52.90 52 14 ALA A 48 ? ? -57.03 -72.31 53 14 VAL A 54 ? ? -177.79 78.66 54 15 ASN A 8 ? ? -116.75 52.99 55 15 THR A 11 ? ? -133.68 -43.43 56 15 ILE A 39 ? ? -116.43 75.01 57 15 THR A 49 ? ? -146.33 44.97 58 15 LYS A 50 ? ? 38.72 46.12 59 15 VAL A 54 ? ? -169.72 84.20 60 16 ASN A 8 ? ? -116.90 52.49 61 16 THR A 11 ? ? -132.50 -43.07 62 16 ILE A 39 ? ? -114.38 76.40 63 16 ALA A 48 ? ? -57.38 -70.87 64 16 VAL A 54 ? ? -168.52 79.80 65 17 ASN A 8 ? ? -105.95 51.95 66 17 VAL A 54 ? ? -172.31 80.97 67 18 ASN A 8 ? ? -117.03 52.33 68 18 ILE A 39 ? ? -110.49 72.44 69 18 THR A 49 ? ? -154.34 23.45 70 18 VAL A 54 ? ? -172.36 85.25 71 19 ASN A 8 ? ? -114.30 53.82 72 19 THR A 49 ? ? -152.31 29.21 73 19 LYS A 50 ? ? 38.26 31.89 74 19 VAL A 54 ? ? -176.12 86.83 75 20 ASN A 8 ? ? -104.21 52.80 76 20 ILE A 39 ? ? -119.26 75.12 77 20 ALA A 48 ? ? -55.94 -70.37 78 20 VAL A 54 ? ? -170.96 79.39 79 21 ILE A 39 ? ? -113.99 75.71 80 21 ALA A 48 ? ? -56.03 -70.34 81 21 VAL A 54 ? ? -171.26 90.30 82 22 ASN A 8 ? ? -114.92 53.07 83 22 ILE A 39 ? ? -117.67 74.77 84 22 VAL A 54 ? ? -170.93 81.87 85 23 ASN A 8 ? ? -109.56 54.02 86 23 GLU A 27 ? ? -39.88 -35.72 87 23 ALA A 48 ? ? -55.53 -72.26 88 23 VAL A 54 ? ? -177.59 85.34 89 24 ASN A 8 ? ? -117.06 52.39 90 24 THR A 44 ? ? 62.49 131.83 91 24 THR A 49 ? ? -158.22 29.15 92 24 VAL A 54 ? ? -175.10 83.03 93 25 ASN A 8 ? ? -113.16 51.73 94 25 ILE A 39 ? ? -115.01 75.47 95 25 ALA A 48 ? ? -54.75 -70.78 96 25 VAL A 54 ? ? -169.82 82.04 97 26 ASN A 8 ? ? -111.69 51.32 98 26 ILE A 39 ? ? -112.05 73.81 99 26 ALA A 48 ? ? -57.27 -70.55 100 26 VAL A 54 ? ? -172.49 80.09 101 27 ASN A 8 ? ? -106.99 53.74 102 27 ILE A 39 ? ? -112.81 76.67 103 27 THR A 49 ? ? -149.76 30.57 104 27 VAL A 54 ? ? -172.91 82.72 105 28 ASN A 8 ? ? -115.78 51.14 106 28 ASP A 40 ? ? -171.61 139.48 107 28 ALA A 48 ? ? -55.22 -72.33 108 28 VAL A 54 ? ? -176.91 72.78 109 29 ASN A 8 ? ? -106.90 51.21 110 29 ILE A 39 ? ? -114.47 73.99 111 29 LYS A 50 ? ? 37.42 56.04 112 29 VAL A 54 ? ? -175.79 96.76 113 30 ASN A 8 ? ? -111.40 51.98 114 30 ILE A 39 ? ? -115.90 74.19 115 30 ALA A 48 ? ? -54.99 -70.71 116 30 VAL A 54 ? ? -171.15 82.27 117 31 ASN A 8 ? ? -110.90 52.51 118 31 THR A 11 ? ? -136.92 -43.02 119 31 THR A 44 ? ? 62.24 131.22 120 31 THR A 49 ? ? -155.89 32.76 121 31 VAL A 54 ? ? -176.67 81.63 122 32 ASN A 8 ? ? -116.08 53.81 123 32 ILE A 39 ? ? -116.35 72.71 124 32 THR A 49 ? ? -154.44 31.30 125 32 LYS A 50 ? ? 35.91 37.58 126 32 VAL A 54 ? ? -169.81 84.80 127 33 ASN A 8 ? ? -111.65 51.45 128 33 ILE A 39 ? ? -116.49 65.84 129 33 ALA A 48 ? ? -56.70 -71.21 130 33 VAL A 54 ? ? -169.20 85.29 131 34 ASN A 8 ? ? -116.48 53.00 132 34 ILE A 39 ? ? -112.97 72.93 133 34 LYS A 50 ? ? 38.46 46.59 134 34 VAL A 54 ? ? -169.88 72.48 135 35 ASN A 8 ? ? -115.22 54.80 136 35 THR A 11 ? ? -131.52 -43.14 137 35 ILE A 39 ? ? -117.12 74.89 138 35 ALA A 48 ? ? -58.56 -72.40 139 35 VAL A 54 ? ? -170.17 87.28 140 36 ASN A 8 ? ? -101.24 52.41 141 36 THR A 49 ? ? -151.90 28.64 142 36 LYS A 50 ? ? 36.64 54.22 143 36 VAL A 54 ? ? -173.25 91.04 144 37 ASN A 8 ? ? -108.04 52.57 145 37 ILE A 39 ? ? -115.14 71.41 146 37 VAL A 54 ? ? -175.57 93.18 147 38 ASN A 8 ? ? -108.25 51.51 148 38 ALA A 48 ? ? -56.07 -70.42 149 38 VAL A 54 ? ? -171.42 91.59 150 39 ASN A 8 ? ? -102.10 52.25 151 39 ILE A 39 ? ? -117.49 73.26 152 39 THR A 49 ? ? -151.86 31.87 153 39 VAL A 54 ? ? -171.99 94.53 154 40 ASN A 8 ? ? -115.09 53.91 155 40 THR A 49 ? ? -152.50 30.21 156 40 LYS A 50 ? ? 39.43 31.10 157 40 VAL A 54 ? ? -176.77 85.88 # _pdbx_nmr_ensemble.entry_id 1FCL _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 40 _pdbx_nmr_ensemble.conformer_selection_criteria 'Structures with the Least Restraint Violations, Structures with the Lowest Energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1FCL _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM unlabeled protein in 50 mM sodium phosphate, pH 6.0' _pdbx_nmr_sample_details.solvent_system 'either D2O or 90:10 H2O:D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure Atmospheric _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mM sodium phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 DQF-COSY 3 1 1 E-COSY 4 1 1 TOCSY # _pdbx_nmr_details.entry_id 1FCL _pdbx_nmr_details.text none # _pdbx_nmr_refine.entry_id 1FCL _pdbx_nmr_refine.method 'Standard Distance Geometry/simulated Annealing Methods' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR '5.2f, 5.3a, 6.1b' collection Varian 1 NMRCompass 2.5 processing MSI 2 ANSIG 3.3 processing 'P. Kraulis' 3 X-PLOR 3.1 refinement Brunger 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 ILE N N N N 96 ILE CA C N S 97 ILE C C N N 98 ILE O O N N 99 ILE CB C N S 100 ILE CG1 C N N 101 ILE CG2 C N N 102 ILE CD1 C N N 103 ILE OXT O N N 104 ILE H H N N 105 ILE H2 H N N 106 ILE HA H N N 107 ILE HB H N N 108 ILE HG12 H N N 109 ILE HG13 H N N 110 ILE HG21 H N N 111 ILE HG22 H N N 112 ILE HG23 H N N 113 ILE HD11 H N N 114 ILE HD12 H N N 115 ILE HD13 H N N 116 ILE HXT H N N 117 LEU N N N N 118 LEU CA C N S 119 LEU C C N N 120 LEU O O N N 121 LEU CB C N N 122 LEU CG C N N 123 LEU CD1 C N N 124 LEU CD2 C N N 125 LEU OXT O N N 126 LEU H H N N 127 LEU H2 H N N 128 LEU HA H N N 129 LEU HB2 H N N 130 LEU HB3 H N N 131 LEU HG H N N 132 LEU HD11 H N N 133 LEU HD12 H N N 134 LEU HD13 H N N 135 LEU HD21 H N N 136 LEU HD22 H N N 137 LEU HD23 H N N 138 LEU HXT H N N 139 LYS N N N N 140 LYS CA C N S 141 LYS C C N N 142 LYS O O N N 143 LYS CB C N N 144 LYS CG C N N 145 LYS CD C N N 146 LYS CE C N N 147 LYS NZ N N N 148 LYS OXT O N N 149 LYS H H N N 150 LYS H2 H N N 151 LYS HA H N N 152 LYS HB2 H N N 153 LYS HB3 H N N 154 LYS HG2 H N N 155 LYS HG3 H N N 156 LYS HD2 H N N 157 LYS HD3 H N N 158 LYS HE2 H N N 159 LYS HE3 H N N 160 LYS HZ1 H N N 161 LYS HZ2 H N N 162 LYS HZ3 H N N 163 LYS HXT H N N 164 PHE N N N N 165 PHE CA C N S 166 PHE C C N N 167 PHE O O N N 168 PHE CB C N N 169 PHE CG C Y N 170 PHE CD1 C Y N 171 PHE CD2 C Y N 172 PHE CE1 C Y N 173 PHE CE2 C Y N 174 PHE CZ C Y N 175 PHE OXT O N N 176 PHE H H N N 177 PHE H2 H N N 178 PHE HA H N N 179 PHE HB2 H N N 180 PHE HB3 H N N 181 PHE HD1 H N N 182 PHE HD2 H N N 183 PHE HE1 H N N 184 PHE HE2 H N N 185 PHE HZ H N N 186 PHE HXT H N N 187 THR N N N N 188 THR CA C N S 189 THR C C N N 190 THR O O N N 191 THR CB C N R 192 THR OG1 O N N 193 THR CG2 C N N 194 THR OXT O N N 195 THR H H N N 196 THR H2 H N N 197 THR HA H N N 198 THR HB H N N 199 THR HG1 H N N 200 THR HG21 H N N 201 THR HG22 H N N 202 THR HG23 H N N 203 THR HXT H N N 204 TRP N N N N 205 TRP CA C N S 206 TRP C C N N 207 TRP O O N N 208 TRP CB C N N 209 TRP CG C Y N 210 TRP CD1 C Y N 211 TRP CD2 C Y N 212 TRP NE1 N Y N 213 TRP CE2 C Y N 214 TRP CE3 C Y N 215 TRP CZ2 C Y N 216 TRP CZ3 C Y N 217 TRP CH2 C Y N 218 TRP OXT O N N 219 TRP H H N N 220 TRP H2 H N N 221 TRP HA H N N 222 TRP HB2 H N N 223 TRP HB3 H N N 224 TRP HD1 H N N 225 TRP HE1 H N N 226 TRP HE3 H N N 227 TRP HZ2 H N N 228 TRP HZ3 H N N 229 TRP HH2 H N N 230 TRP HXT H N N 231 TYR N N N N 232 TYR CA C N S 233 TYR C C N N 234 TYR O O N N 235 TYR CB C N N 236 TYR CG C Y N 237 TYR CD1 C Y N 238 TYR CD2 C Y N 239 TYR CE1 C Y N 240 TYR CE2 C Y N 241 TYR CZ C Y N 242 TYR OH O N N 243 TYR OXT O N N 244 TYR H H N N 245 TYR H2 H N N 246 TYR HA H N N 247 TYR HB2 H N N 248 TYR HB3 H N N 249 TYR HD1 H N N 250 TYR HD2 H N N 251 TYR HE1 H N N 252 TYR HE2 H N N 253 TYR HH H N N 254 TYR HXT H N N 255 VAL N N N N 256 VAL CA C N S 257 VAL C C N N 258 VAL O O N N 259 VAL CB C N N 260 VAL CG1 C N N 261 VAL CG2 C N N 262 VAL OXT O N N 263 VAL H H N N 264 VAL H2 H N N 265 VAL HA H N N 266 VAL HB H N N 267 VAL HG11 H N N 268 VAL HG12 H N N 269 VAL HG13 H N N 270 VAL HG21 H N N 271 VAL HG22 H N N 272 VAL HG23 H N N 273 VAL HXT H N N 274 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 ILE N CA sing N N 90 ILE N H sing N N 91 ILE N H2 sing N N 92 ILE CA C sing N N 93 ILE CA CB sing N N 94 ILE CA HA sing N N 95 ILE C O doub N N 96 ILE C OXT sing N N 97 ILE CB CG1 sing N N 98 ILE CB CG2 sing N N 99 ILE CB HB sing N N 100 ILE CG1 CD1 sing N N 101 ILE CG1 HG12 sing N N 102 ILE CG1 HG13 sing N N 103 ILE CG2 HG21 sing N N 104 ILE CG2 HG22 sing N N 105 ILE CG2 HG23 sing N N 106 ILE CD1 HD11 sing N N 107 ILE CD1 HD12 sing N N 108 ILE CD1 HD13 sing N N 109 ILE OXT HXT sing N N 110 LEU N CA sing N N 111 LEU N H sing N N 112 LEU N H2 sing N N 113 LEU CA C sing N N 114 LEU CA CB sing N N 115 LEU CA HA sing N N 116 LEU C O doub N N 117 LEU C OXT sing N N 118 LEU CB CG sing N N 119 LEU CB HB2 sing N N 120 LEU CB HB3 sing N N 121 LEU CG CD1 sing N N 122 LEU CG CD2 sing N N 123 LEU CG HG sing N N 124 LEU CD1 HD11 sing N N 125 LEU CD1 HD12 sing N N 126 LEU CD1 HD13 sing N N 127 LEU CD2 HD21 sing N N 128 LEU CD2 HD22 sing N N 129 LEU CD2 HD23 sing N N 130 LEU OXT HXT sing N N 131 LYS N CA sing N N 132 LYS N H sing N N 133 LYS N H2 sing N N 134 LYS CA C sing N N 135 LYS CA CB sing N N 136 LYS CA HA sing N N 137 LYS C O doub N N 138 LYS C OXT sing N N 139 LYS CB CG sing N N 140 LYS CB HB2 sing N N 141 LYS CB HB3 sing N N 142 LYS CG CD sing N N 143 LYS CG HG2 sing N N 144 LYS CG HG3 sing N N 145 LYS CD CE sing N N 146 LYS CD HD2 sing N N 147 LYS CD HD3 sing N N 148 LYS CE NZ sing N N 149 LYS CE HE2 sing N N 150 LYS CE HE3 sing N N 151 LYS NZ HZ1 sing N N 152 LYS NZ HZ2 sing N N 153 LYS NZ HZ3 sing N N 154 LYS OXT HXT sing N N 155 PHE N CA sing N N 156 PHE N H sing N N 157 PHE N H2 sing N N 158 PHE CA C sing N N 159 PHE CA CB sing N N 160 PHE CA HA sing N N 161 PHE C O doub N N 162 PHE C OXT sing N N 163 PHE CB CG sing N N 164 PHE CB HB2 sing N N 165 PHE CB HB3 sing N N 166 PHE CG CD1 doub Y N 167 PHE CG CD2 sing Y N 168 PHE CD1 CE1 sing Y N 169 PHE CD1 HD1 sing N N 170 PHE CD2 CE2 doub Y N 171 PHE CD2 HD2 sing N N 172 PHE CE1 CZ doub Y N 173 PHE CE1 HE1 sing N N 174 PHE CE2 CZ sing Y N 175 PHE CE2 HE2 sing N N 176 PHE CZ HZ sing N N 177 PHE OXT HXT sing N N 178 THR N CA sing N N 179 THR N H sing N N 180 THR N H2 sing N N 181 THR CA C sing N N 182 THR CA CB sing N N 183 THR CA HA sing N N 184 THR C O doub N N 185 THR C OXT sing N N 186 THR CB OG1 sing N N 187 THR CB CG2 sing N N 188 THR CB HB sing N N 189 THR OG1 HG1 sing N N 190 THR CG2 HG21 sing N N 191 THR CG2 HG22 sing N N 192 THR CG2 HG23 sing N N 193 THR OXT HXT sing N N 194 TRP N CA sing N N 195 TRP N H sing N N 196 TRP N H2 sing N N 197 TRP CA C sing N N 198 TRP CA CB sing N N 199 TRP CA HA sing N N 200 TRP C O doub N N 201 TRP C OXT sing N N 202 TRP CB CG sing N N 203 TRP CB HB2 sing N N 204 TRP CB HB3 sing N N 205 TRP CG CD1 doub Y N 206 TRP CG CD2 sing Y N 207 TRP CD1 NE1 sing Y N 208 TRP CD1 HD1 sing N N 209 TRP CD2 CE2 doub Y N 210 TRP CD2 CE3 sing Y N 211 TRP NE1 CE2 sing Y N 212 TRP NE1 HE1 sing N N 213 TRP CE2 CZ2 sing Y N 214 TRP CE3 CZ3 doub Y N 215 TRP CE3 HE3 sing N N 216 TRP CZ2 CH2 doub Y N 217 TRP CZ2 HZ2 sing N N 218 TRP CZ3 CH2 sing Y N 219 TRP CZ3 HZ3 sing N N 220 TRP CH2 HH2 sing N N 221 TRP OXT HXT sing N N 222 TYR N CA sing N N 223 TYR N H sing N N 224 TYR N H2 sing N N 225 TYR CA C sing N N 226 TYR CA CB sing N N 227 TYR CA HA sing N N 228 TYR C O doub N N 229 TYR C OXT sing N N 230 TYR CB CG sing N N 231 TYR CB HB2 sing N N 232 TYR CB HB3 sing N N 233 TYR CG CD1 doub Y N 234 TYR CG CD2 sing Y N 235 TYR CD1 CE1 sing Y N 236 TYR CD1 HD1 sing N N 237 TYR CD2 CE2 doub Y N 238 TYR CD2 HD2 sing N N 239 TYR CE1 CZ doub Y N 240 TYR CE1 HE1 sing N N 241 TYR CE2 CZ sing Y N 242 TYR CE2 HE2 sing N N 243 TYR CZ OH sing N N 244 TYR OH HH sing N N 245 TYR OXT HXT sing N N 246 VAL N CA sing N N 247 VAL N H sing N N 248 VAL N H2 sing N N 249 VAL CA C sing N N 250 VAL CA CB sing N N 251 VAL CA HA sing N N 252 VAL C O doub N N 253 VAL C OXT sing N N 254 VAL CB CG1 sing N N 255 VAL CB CG2 sing N N 256 VAL CB HB sing N N 257 VAL CG1 HG11 sing N N 258 VAL CG1 HG12 sing N N 259 VAL CG1 HG13 sing N N 260 VAL CG2 HG21 sing N N 261 VAL CG2 HG22 sing N N 262 VAL CG2 HG23 sing N N 263 VAL OXT HXT sing N N 264 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model UNITYPLUS _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1FCL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_