data_1FF7 # _entry.id 1FF7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1FF7 pdb_00001ff7 10.2210/pdb1ff7/pdb RCSB RCSB000510 ? ? WWPDB D_1000000510 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-06-16 2 'Structure model' 1 1 2008-04-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-07-29 5 'Structure model' 1 4 2023-12-27 6 'Structure model' 1 5 2024-10-16 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Structure summary' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Structure summary' 9 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp 2 4 'Structure model' entity 3 4 'Structure model' pdbx_chem_comp_identifier 4 4 'Structure model' pdbx_entity_nonpoly 5 4 'Structure model' pdbx_nmr_software 6 4 'Structure model' pdbx_struct_assembly 7 4 'Structure model' pdbx_struct_oper_list 8 4 'Structure model' struct_conn 9 4 'Structure model' struct_site 10 4 'Structure model' struct_site_gen 11 5 'Structure model' chem_comp 12 5 'Structure model' chem_comp_atom 13 5 'Structure model' chem_comp_bond 14 5 'Structure model' database_2 15 6 'Structure model' pdbx_entry_details 16 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_chem_comp.name' 2 4 'Structure model' '_chem_comp.type' 3 4 'Structure model' '_entity.pdbx_description' 4 4 'Structure model' '_pdbx_entity_nonpoly.name' 5 4 'Structure model' '_pdbx_nmr_software.name' 6 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 4 'Structure model' '_struct_conn.pdbx_role' 8 5 'Structure model' '_chem_comp.pdbx_synonyms' 9 5 'Structure model' '_database_2.pdbx_DOI' 10 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FF7 _pdbx_database_status.recvd_initial_deposition_date 1999-02-19 _pdbx_database_status.deposit_site BNL _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kao, Y.-H.' 1 'Lee, G.F.' 2 'Wang, Y.' 3 'Starovasnik, M.A.' 4 'Kelley, R.F.' 5 'Spellman, M.W.' 6 'Lerner, L.' 7 # _citation.id primary _citation.title 'The effect of O-fucosylation on the first EGF-like domain from human blood coagulation factor VII.' _citation.journal_abbrev Biochemistry _citation.journal_volume 38 _citation.page_first 7097 _citation.page_last 7110 _citation.year 1999 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10353820 _citation.pdbx_database_id_DOI 10.1021/bi990234z # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kao, Y.H.' 1 ? primary 'Lee, G.F.' 2 ? primary 'Wang, Y.' 3 ? primary 'Starovasnik, M.A.' 4 ? primary 'Kelley, R.F.' 5 ? primary 'Spellman, M.W.' 6 ? primary 'Lerner, L.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN (Blood Coagulation Factor VII)' 4878.247 1 ? ? 'FIRST EGF-LIKE DOMAIN (FUCOSYLATED AT SER-60)' 'CALCIUM BOUND FORM' 2 non-polymer man alpha-L-fucopyranose 164.156 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDGSA _entity_poly.pdbx_seq_one_letter_code_can SDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDGSA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name alpha-L-fucopyranose _pdbx_entity_nonpoly.comp_id FUC # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASP n 1 3 GLY n 1 4 ASP n 1 5 GLN n 1 6 CYS n 1 7 ALA n 1 8 SER n 1 9 SER n 1 10 PRO n 1 11 CYS n 1 12 GLN n 1 13 ASN n 1 14 GLY n 1 15 GLY n 1 16 SER n 1 17 CYS n 1 18 LYS n 1 19 ASP n 1 20 GLN n 1 21 LEU n 1 22 GLN n 1 23 SER n 1 24 TYR n 1 25 ILE n 1 26 CYS n 1 27 PHE n 1 28 CYS n 1 29 LEU n 1 30 PRO n 1 31 ALA n 1 32 PHE n 1 33 GLU n 1 34 GLY n 1 35 ARG n 1 36 ASN n 1 37 CYS n 1 38 GLU n 1 39 THR n 1 40 HIS n 1 41 LYS n 1 42 ASP n 1 43 ASP n 1 44 GLY n 1 45 SER n 1 46 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose 'alpha-L-fucose; 6-deoxy-alpha-L-galactopyranose; L-fucose; fucose' 'C6 H12 O5' 164.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 LFucpa FUC 'COMMON NAME' GMML 1.0 a-L-fucopyranose FUC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-L-Fucp FUC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Fuc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 45 45 SER SER A . n A 1 2 ASP 2 46 46 ASP ASP A . n A 1 3 GLY 3 47 47 GLY GLY A . n A 1 4 ASP 4 48 48 ASP ASP A . n A 1 5 GLN 5 49 49 GLN GLN A . n A 1 6 CYS 6 50 50 CYS CYS A . n A 1 7 ALA 7 51 51 ALA ALA A . n A 1 8 SER 8 52 52 SER SER A . n A 1 9 SER 9 53 53 SER SER A . n A 1 10 PRO 10 54 54 PRO PRO A . n A 1 11 CYS 11 55 55 CYS CYS A . n A 1 12 GLN 12 56 56 GLN GLN A . n A 1 13 ASN 13 57 57 ASN ASN A . n A 1 14 GLY 14 58 58 GLY GLY A . n A 1 15 GLY 15 59 59 GLY GLY A . n A 1 16 SER 16 60 60 SER SER A . n A 1 17 CYS 17 61 61 CYS CYS A . n A 1 18 LYS 18 62 62 LYS LYS A . n A 1 19 ASP 19 63 63 ASP ASP A . n A 1 20 GLN 20 64 64 GLN GLN A . n A 1 21 LEU 21 65 65 LEU LEU A . n A 1 22 GLN 22 66 66 GLN GLN A . n A 1 23 SER 23 67 67 SER SER A . n A 1 24 TYR 24 68 68 TYR TYR A . n A 1 25 ILE 25 69 69 ILE ILE A . n A 1 26 CYS 26 70 70 CYS CYS A . n A 1 27 PHE 27 71 71 PHE PHE A . n A 1 28 CYS 28 72 72 CYS CYS A . n A 1 29 LEU 29 73 73 LEU LEU A . n A 1 30 PRO 30 74 74 PRO PRO A . n A 1 31 ALA 31 75 75 ALA ALA A . n A 1 32 PHE 32 76 76 PHE PHE A . n A 1 33 GLU 33 77 77 GLU GLU A . n A 1 34 GLY 34 78 78 GLY GLY A . n A 1 35 ARG 35 79 79 ARG ARG A . n A 1 36 ASN 36 80 80 ASN ASN A . n A 1 37 CYS 37 81 81 CYS CYS A . n A 1 38 GLU 38 82 82 GLU GLU A . n A 1 39 THR 39 83 83 THR THR A . n A 1 40 HIS 40 84 84 HIS HIS A . n A 1 41 LYS 41 85 85 LYS LYS A . n A 1 42 ASP 42 86 86 ASP ASP A . n A 1 43 ASP 43 87 87 ASP ASP A . n A 1 44 GLY 44 88 88 GLY GLY A . n A 1 45 SER 45 89 89 SER SER A . n A 1 46 ALA 46 90 90 ALA ALA A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id FUC _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 91 _pdbx_nonpoly_scheme.auth_seq_num 91 _pdbx_nonpoly_scheme.pdb_mon_id FUC _pdbx_nonpoly_scheme.auth_mon_id FUC _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 1FF7 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FF7 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1FF7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1FF7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1FF7 _struct.title 'THE FIRST EGF-LIKE DOMAIN FROM HUMAN BLOOD COAGULATION FVII (FUCOSYLATED AT SER-60), NMR, 20 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FF7 _struct_keywords.pdbx_keywords 'BLOOD CLOTTING' _struct_keywords.text 'FACTOR VII, BLOOD COAGULATION, EGF-LIKE DOMAIN, GLYCOPROTEIN, FUCOSYLATION, O- LINKED FUCOSE, BLOOD CLOTTING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FA7_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P08709 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FF7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 43 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P08709 _struct_ref_seq.db_align_beg 83 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 125 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 45 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1FF7 GLY A 44 ? UNP P08709 ? ? 'SEE REMARK 999' 88 1 1 1FF7 SER A 45 ? UNP P08709 ? ? 'SEE REMARK 999' 89 2 1 1FF7 ALA A 46 ? UNP P08709 ? ? 'SEE REMARK 999' 90 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 17 SG ? ? A CYS 50 A CYS 61 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 55 A CYS 70 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf3 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 72 A CYS 81 1_555 ? ? ? ? ? ? ? 2.020 ? ? covale1 covale one ? A SER 16 OG ? ? ? 1_555 B FUC . C1 ? ? A SER 60 A FUC 91 1_555 ? ? ? ? ? ? ? 1.398 ? O-Glycosylation # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 FUC B . ? SER A 16 ? FUC A 91 ? 1_555 SER A 60 ? 1_555 C1 OG SER 1 FUC O-Glycosylation Carbohydrate 2 CYS A 6 ? CYS A 17 ? CYS A 50 ? 1_555 CYS A 61 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 11 ? CYS A 26 ? CYS A 55 ? 1_555 CYS A 70 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 28 ? CYS A 37 ? CYS A 72 ? 1_555 CYS A 81 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details S1 ? 2 ? S2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? anti-parallel S2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 SER A 16 ? ASP A 19 ? SER A 60 ASP A 63 S1 2 TYR A 24 ? PHE A 27 ? TYR A 68 PHE A 71 S2 1 PHE A 32 ? GLU A 33 ? PHE A 76 GLU A 77 S2 2 THR A 39 ? HIS A 40 ? THR A 83 HIS A 84 # _pdbx_entry_details.entry_id 1FF7 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 66 ? ? 56.55 -86.04 2 1 SER A 67 ? ? -103.40 -159.48 3 1 TYR A 68 ? ? -120.52 -169.93 4 1 ASP A 87 ? ? 52.69 78.32 5 2 GLN A 49 ? ? -142.40 29.07 6 2 CYS A 50 ? ? -158.35 57.07 7 2 SER A 52 ? ? -119.07 -76.33 8 2 SER A 53 ? ? -174.65 79.61 9 2 GLN A 66 ? ? 56.67 -85.76 10 2 SER A 67 ? ? -93.23 -157.48 11 2 LYS A 85 ? ? -82.51 -72.05 12 2 SER A 89 ? ? 55.61 -86.75 13 3 GLN A 49 ? ? -121.05 -58.70 14 3 SER A 53 ? ? 51.51 77.72 15 3 CYS A 55 ? ? -62.54 -178.47 16 3 SER A 67 ? ? -118.19 -151.91 17 3 LYS A 85 ? ? -67.38 95.06 18 3 ASP A 87 ? ? 52.91 -174.77 19 4 SER A 53 ? ? 46.18 80.04 20 4 GLN A 56 ? ? -129.89 -166.25 21 4 GLN A 66 ? ? 56.62 -85.94 22 4 SER A 67 ? ? -95.27 -159.06 23 4 CYS A 72 ? ? -103.94 -169.56 24 4 ASP A 87 ? ? -168.32 -165.33 25 5 ASP A 46 ? ? -92.49 48.78 26 5 SER A 53 ? ? 51.41 71.28 27 5 GLN A 56 ? ? -146.50 -155.64 28 5 GLN A 66 ? ? 56.49 -85.99 29 5 SER A 89 ? ? 52.85 94.56 30 6 SER A 53 ? ? 51.11 84.85 31 6 GLN A 66 ? ? 56.53 -85.90 32 6 SER A 67 ? ? -91.15 -158.12 33 6 TYR A 68 ? ? -129.46 -168.64 34 6 SER A 89 ? ? 52.85 87.81 35 7 ASP A 48 ? ? -150.01 -41.15 36 7 SER A 53 ? ? 51.07 72.99 37 7 GLN A 56 ? ? -157.33 -159.16 38 7 GLN A 64 ? ? -109.68 -167.72 39 7 LEU A 65 ? ? -57.12 -75.19 40 7 GLN A 66 ? ? -90.12 -77.12 41 7 LYS A 85 ? ? -61.43 95.08 42 8 SER A 53 ? ? 50.71 83.05 43 8 GLN A 66 ? ? 56.35 -86.13 44 8 SER A 67 ? ? -95.26 -157.87 45 8 CYS A 72 ? ? -123.14 -169.10 46 8 SER A 89 ? ? -138.95 -49.24 47 9 SER A 53 ? ? 51.04 71.93 48 9 GLN A 56 ? ? -147.78 -154.19 49 9 GLN A 64 ? ? -111.28 -168.20 50 9 LEU A 65 ? ? -58.21 -77.35 51 9 GLN A 66 ? ? -81.70 -76.97 52 9 SER A 67 ? ? -87.70 -158.27 53 9 LYS A 85 ? ? -60.67 -80.55 54 9 ASP A 86 ? ? -178.64 -38.00 55 9 ASP A 87 ? ? -168.72 -164.93 56 9 SER A 89 ? ? -83.66 -71.33 57 10 ASP A 46 ? ? -163.09 116.75 58 10 SER A 53 ? ? 50.91 79.69 59 10 GLN A 64 ? ? -112.87 -169.16 60 10 GLN A 66 ? ? 56.96 -85.80 61 10 SER A 67 ? ? -98.49 -159.43 62 10 TYR A 68 ? ? -124.47 -168.03 63 10 LYS A 85 ? ? -83.65 -72.12 64 10 ASP A 86 ? ? 57.02 -84.97 65 10 ASP A 87 ? ? 55.87 -87.63 66 11 GLN A 49 ? ? -134.73 -56.24 67 11 GLN A 66 ? ? 56.89 -85.55 68 11 SER A 67 ? ? -112.00 -157.58 69 11 ASP A 87 ? ? 53.27 179.55 70 12 ASP A 46 ? ? -165.65 48.59 71 12 SER A 52 ? ? -111.05 -77.34 72 12 SER A 53 ? ? 178.00 68.58 73 12 GLN A 66 ? ? 56.54 -85.76 74 12 SER A 67 ? ? -62.33 -157.50 75 12 ASP A 87 ? ? -150.61 48.96 76 12 SER A 89 ? ? 52.84 -177.52 77 13 ASP A 46 ? ? 52.84 -178.57 78 13 GLN A 49 ? ? -159.67 27.92 79 13 GLN A 56 ? ? -156.28 -158.76 80 13 GLN A 64 ? ? -126.37 -169.29 81 13 GLN A 66 ? ? 56.38 -86.18 82 13 SER A 67 ? ? -94.61 -159.09 83 13 TYR A 68 ? ? -124.97 -169.94 84 13 SER A 89 ? ? -96.90 36.52 85 14 ASP A 46 ? ? -145.16 -71.59 86 14 CYS A 50 ? ? -142.95 48.81 87 14 SER A 53 ? ? 52.30 94.55 88 14 GLN A 56 ? ? -146.81 -159.10 89 14 GLN A 64 ? ? -122.37 -169.32 90 14 GLN A 66 ? ? 56.31 -86.38 91 14 SER A 67 ? ? -84.12 -158.00 92 14 SER A 89 ? ? -166.77 -43.96 93 15 SER A 53 ? ? 51.10 80.76 94 15 GLN A 66 ? ? 56.63 -85.92 95 15 SER A 67 ? ? -104.95 -160.45 96 15 TYR A 68 ? ? -119.30 -168.97 97 15 CYS A 72 ? ? -109.59 -169.03 98 15 LYS A 85 ? ? -61.53 -70.62 99 15 ASP A 87 ? ? 56.58 -86.08 100 16 GLN A 66 ? ? 56.78 -85.47 101 16 SER A 67 ? ? -83.57 -156.71 102 16 CYS A 72 ? ? -71.96 -169.24 103 16 LYS A 85 ? ? -61.09 -73.38 104 16 SER A 89 ? ? -167.73 -71.57 105 17 ASP A 46 ? ? 55.54 -86.53 106 17 ALA A 51 ? ? -88.94 49.66 107 17 SER A 52 ? ? -150.27 21.37 108 17 GLN A 64 ? ? -126.59 -166.05 109 17 GLN A 66 ? ? 56.51 -85.82 110 17 SER A 67 ? ? -106.03 -157.72 111 18 ASP A 46 ? ? 56.47 -85.99 112 18 GLN A 66 ? ? 56.45 -85.99 113 18 SER A 67 ? ? -107.65 -160.80 114 18 TYR A 68 ? ? -114.50 -169.89 115 18 ASP A 87 ? ? -109.47 -67.11 116 19 ASP A 46 ? ? -103.45 51.76 117 19 GLN A 66 ? ? 55.88 -86.16 118 19 SER A 67 ? ? -107.46 -158.64 119 19 TYR A 68 ? ? -118.80 -169.86 120 19 ASP A 86 ? ? -152.16 65.62 121 19 ASP A 87 ? ? 52.91 -179.68 122 19 SER A 89 ? ? 52.80 78.68 123 20 ASP A 48 ? ? -123.68 -70.60 124 20 GLN A 64 ? ? -129.31 -168.89 125 20 GLN A 66 ? ? 57.08 -85.07 126 20 SER A 67 ? ? -75.78 -157.67 127 20 CYS A 72 ? ? -110.20 -168.98 128 20 SER A 89 ? ? 50.31 -160.05 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SER _pdbx_struct_mod_residue.label_seq_id 16 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SER _pdbx_struct_mod_residue.auth_seq_id 60 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details 'GLYCOSYLATION SITE' # _pdbx_nmr_ensemble.entry_id 1FF7 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION AND LOWEST XPLOR ENERGY' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 400mM _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 DQF-COSY 1 2 1 2Q 1 3 1 TOCSY 1 4 1 NOESY 1 5 1 '1H-15N HSQC' 1 6 1 '3D 1H-15N NOESY-HSQC' 1 7 1 '3D 1H-15N TOCSY-HSQC' 1 # _pdbx_nmr_details.entry_id 1FF7 _pdbx_nmr_details.text 'DETAILS ARE INCLUDED IN THE PUBLICATION.' # _pdbx_nmr_refine.entry_id 1FF7 _pdbx_nmr_refine.method 'HYBRID DISTANCE GEOMETRY - SIMULATED ANNEALING' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.851 BRUNGER 1 'structure solution' Felix ? ? 2 'structure solution' X-PLOR ? ? 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FUC C1 C N R 88 FUC C2 C N S 89 FUC C3 C N R 90 FUC C4 C N S 91 FUC C5 C N S 92 FUC C6 C N N 93 FUC O1 O N N 94 FUC O2 O N N 95 FUC O3 O N N 96 FUC O4 O N N 97 FUC O5 O N N 98 FUC H1 H N N 99 FUC H2 H N N 100 FUC H3 H N N 101 FUC H4 H N N 102 FUC H5 H N N 103 FUC H61 H N N 104 FUC H62 H N N 105 FUC H63 H N N 106 FUC HO1 H N N 107 FUC HO2 H N N 108 FUC HO3 H N N 109 FUC HO4 H N N 110 GLN N N N N 111 GLN CA C N S 112 GLN C C N N 113 GLN O O N N 114 GLN CB C N N 115 GLN CG C N N 116 GLN CD C N N 117 GLN OE1 O N N 118 GLN NE2 N N N 119 GLN OXT O N N 120 GLN H H N N 121 GLN H2 H N N 122 GLN HA H N N 123 GLN HB2 H N N 124 GLN HB3 H N N 125 GLN HG2 H N N 126 GLN HG3 H N N 127 GLN HE21 H N N 128 GLN HE22 H N N 129 GLN HXT H N N 130 GLU N N N N 131 GLU CA C N S 132 GLU C C N N 133 GLU O O N N 134 GLU CB C N N 135 GLU CG C N N 136 GLU CD C N N 137 GLU OE1 O N N 138 GLU OE2 O N N 139 GLU OXT O N N 140 GLU H H N N 141 GLU H2 H N N 142 GLU HA H N N 143 GLU HB2 H N N 144 GLU HB3 H N N 145 GLU HG2 H N N 146 GLU HG3 H N N 147 GLU HE2 H N N 148 GLU HXT H N N 149 GLY N N N N 150 GLY CA C N N 151 GLY C C N N 152 GLY O O N N 153 GLY OXT O N N 154 GLY H H N N 155 GLY H2 H N N 156 GLY HA2 H N N 157 GLY HA3 H N N 158 GLY HXT H N N 159 HIS N N N N 160 HIS CA C N S 161 HIS C C N N 162 HIS O O N N 163 HIS CB C N N 164 HIS CG C Y N 165 HIS ND1 N Y N 166 HIS CD2 C Y N 167 HIS CE1 C Y N 168 HIS NE2 N Y N 169 HIS OXT O N N 170 HIS H H N N 171 HIS H2 H N N 172 HIS HA H N N 173 HIS HB2 H N N 174 HIS HB3 H N N 175 HIS HD1 H N N 176 HIS HD2 H N N 177 HIS HE1 H N N 178 HIS HE2 H N N 179 HIS HXT H N N 180 ILE N N N N 181 ILE CA C N S 182 ILE C C N N 183 ILE O O N N 184 ILE CB C N S 185 ILE CG1 C N N 186 ILE CG2 C N N 187 ILE CD1 C N N 188 ILE OXT O N N 189 ILE H H N N 190 ILE H2 H N N 191 ILE HA H N N 192 ILE HB H N N 193 ILE HG12 H N N 194 ILE HG13 H N N 195 ILE HG21 H N N 196 ILE HG22 H N N 197 ILE HG23 H N N 198 ILE HD11 H N N 199 ILE HD12 H N N 200 ILE HD13 H N N 201 ILE HXT H N N 202 LEU N N N N 203 LEU CA C N S 204 LEU C C N N 205 LEU O O N N 206 LEU CB C N N 207 LEU CG C N N 208 LEU CD1 C N N 209 LEU CD2 C N N 210 LEU OXT O N N 211 LEU H H N N 212 LEU H2 H N N 213 LEU HA H N N 214 LEU HB2 H N N 215 LEU HB3 H N N 216 LEU HG H N N 217 LEU HD11 H N N 218 LEU HD12 H N N 219 LEU HD13 H N N 220 LEU HD21 H N N 221 LEU HD22 H N N 222 LEU HD23 H N N 223 LEU HXT H N N 224 LYS N N N N 225 LYS CA C N S 226 LYS C C N N 227 LYS O O N N 228 LYS CB C N N 229 LYS CG C N N 230 LYS CD C N N 231 LYS CE C N N 232 LYS NZ N N N 233 LYS OXT O N N 234 LYS H H N N 235 LYS H2 H N N 236 LYS HA H N N 237 LYS HB2 H N N 238 LYS HB3 H N N 239 LYS HG2 H N N 240 LYS HG3 H N N 241 LYS HD2 H N N 242 LYS HD3 H N N 243 LYS HE2 H N N 244 LYS HE3 H N N 245 LYS HZ1 H N N 246 LYS HZ2 H N N 247 LYS HZ3 H N N 248 LYS HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FUC C1 C2 sing N N 83 FUC C1 O1 sing N N 84 FUC C1 O5 sing N N 85 FUC C1 H1 sing N N 86 FUC C2 C3 sing N N 87 FUC C2 O2 sing N N 88 FUC C2 H2 sing N N 89 FUC C3 C4 sing N N 90 FUC C3 O3 sing N N 91 FUC C3 H3 sing N N 92 FUC C4 C5 sing N N 93 FUC C4 O4 sing N N 94 FUC C4 H4 sing N N 95 FUC C5 C6 sing N N 96 FUC C5 O5 sing N N 97 FUC C5 H5 sing N N 98 FUC C6 H61 sing N N 99 FUC C6 H62 sing N N 100 FUC C6 H63 sing N N 101 FUC O1 HO1 sing N N 102 FUC O2 HO2 sing N N 103 FUC O3 HO3 sing N N 104 FUC O4 HO4 sing N N 105 GLN N CA sing N N 106 GLN N H sing N N 107 GLN N H2 sing N N 108 GLN CA C sing N N 109 GLN CA CB sing N N 110 GLN CA HA sing N N 111 GLN C O doub N N 112 GLN C OXT sing N N 113 GLN CB CG sing N N 114 GLN CB HB2 sing N N 115 GLN CB HB3 sing N N 116 GLN CG CD sing N N 117 GLN CG HG2 sing N N 118 GLN CG HG3 sing N N 119 GLN CD OE1 doub N N 120 GLN CD NE2 sing N N 121 GLN NE2 HE21 sing N N 122 GLN NE2 HE22 sing N N 123 GLN OXT HXT sing N N 124 GLU N CA sing N N 125 GLU N H sing N N 126 GLU N H2 sing N N 127 GLU CA C sing N N 128 GLU CA CB sing N N 129 GLU CA HA sing N N 130 GLU C O doub N N 131 GLU C OXT sing N N 132 GLU CB CG sing N N 133 GLU CB HB2 sing N N 134 GLU CB HB3 sing N N 135 GLU CG CD sing N N 136 GLU CG HG2 sing N N 137 GLU CG HG3 sing N N 138 GLU CD OE1 doub N N 139 GLU CD OE2 sing N N 140 GLU OE2 HE2 sing N N 141 GLU OXT HXT sing N N 142 GLY N CA sing N N 143 GLY N H sing N N 144 GLY N H2 sing N N 145 GLY CA C sing N N 146 GLY CA HA2 sing N N 147 GLY CA HA3 sing N N 148 GLY C O doub N N 149 GLY C OXT sing N N 150 GLY OXT HXT sing N N 151 HIS N CA sing N N 152 HIS N H sing N N 153 HIS N H2 sing N N 154 HIS CA C sing N N 155 HIS CA CB sing N N 156 HIS CA HA sing N N 157 HIS C O doub N N 158 HIS C OXT sing N N 159 HIS CB CG sing N N 160 HIS CB HB2 sing N N 161 HIS CB HB3 sing N N 162 HIS CG ND1 sing Y N 163 HIS CG CD2 doub Y N 164 HIS ND1 CE1 doub Y N 165 HIS ND1 HD1 sing N N 166 HIS CD2 NE2 sing Y N 167 HIS CD2 HD2 sing N N 168 HIS CE1 NE2 sing Y N 169 HIS CE1 HE1 sing N N 170 HIS NE2 HE2 sing N N 171 HIS OXT HXT sing N N 172 ILE N CA sing N N 173 ILE N H sing N N 174 ILE N H2 sing N N 175 ILE CA C sing N N 176 ILE CA CB sing N N 177 ILE CA HA sing N N 178 ILE C O doub N N 179 ILE C OXT sing N N 180 ILE CB CG1 sing N N 181 ILE CB CG2 sing N N 182 ILE CB HB sing N N 183 ILE CG1 CD1 sing N N 184 ILE CG1 HG12 sing N N 185 ILE CG1 HG13 sing N N 186 ILE CG2 HG21 sing N N 187 ILE CG2 HG22 sing N N 188 ILE CG2 HG23 sing N N 189 ILE CD1 HD11 sing N N 190 ILE CD1 HD12 sing N N 191 ILE CD1 HD13 sing N N 192 ILE OXT HXT sing N N 193 LEU N CA sing N N 194 LEU N H sing N N 195 LEU N H2 sing N N 196 LEU CA C sing N N 197 LEU CA CB sing N N 198 LEU CA HA sing N N 199 LEU C O doub N N 200 LEU C OXT sing N N 201 LEU CB CG sing N N 202 LEU CB HB2 sing N N 203 LEU CB HB3 sing N N 204 LEU CG CD1 sing N N 205 LEU CG CD2 sing N N 206 LEU CG HG sing N N 207 LEU CD1 HD11 sing N N 208 LEU CD1 HD12 sing N N 209 LEU CD1 HD13 sing N N 210 LEU CD2 HD21 sing N N 211 LEU CD2 HD22 sing N N 212 LEU CD2 HD23 sing N N 213 LEU OXT HXT sing N N 214 LYS N CA sing N N 215 LYS N H sing N N 216 LYS N H2 sing N N 217 LYS CA C sing N N 218 LYS CA CB sing N N 219 LYS CA HA sing N N 220 LYS C O doub N N 221 LYS C OXT sing N N 222 LYS CB CG sing N N 223 LYS CB HB2 sing N N 224 LYS CB HB3 sing N N 225 LYS CG CD sing N N 226 LYS CG HG2 sing N N 227 LYS CG HG3 sing N N 228 LYS CD CE sing N N 229 LYS CD HD2 sing N N 230 LYS CD HD3 sing N N 231 LYS CE NZ sing N N 232 LYS CE HE2 sing N N 233 LYS CE HE3 sing N N 234 LYS NZ HZ1 sing N N 235 LYS NZ HZ2 sing N N 236 LYS NZ HZ3 sing N N 237 LYS OXT HXT sing N N 238 PHE N CA sing N N 239 PHE N H sing N N 240 PHE N H2 sing N N 241 PHE CA C sing N N 242 PHE CA CB sing N N 243 PHE CA HA sing N N 244 PHE C O doub N N 245 PHE C OXT sing N N 246 PHE CB CG sing N N 247 PHE CB HB2 sing N N 248 PHE CB HB3 sing N N 249 PHE CG CD1 doub Y N 250 PHE CG CD2 sing Y N 251 PHE CD1 CE1 sing Y N 252 PHE CD1 HD1 sing N N 253 PHE CD2 CE2 doub Y N 254 PHE CD2 HD2 sing N N 255 PHE CE1 CZ doub Y N 256 PHE CE1 HE1 sing N N 257 PHE CE2 CZ sing Y N 258 PHE CE2 HE2 sing N N 259 PHE CZ HZ sing N N 260 PHE OXT HXT sing N N 261 PRO N CA sing N N 262 PRO N CD sing N N 263 PRO N H sing N N 264 PRO CA C sing N N 265 PRO CA CB sing N N 266 PRO CA HA sing N N 267 PRO C O doub N N 268 PRO C OXT sing N N 269 PRO CB CG sing N N 270 PRO CB HB2 sing N N 271 PRO CB HB3 sing N N 272 PRO CG CD sing N N 273 PRO CG HG2 sing N N 274 PRO CG HG3 sing N N 275 PRO CD HD2 sing N N 276 PRO CD HD3 sing N N 277 PRO OXT HXT sing N N 278 SER N CA sing N N 279 SER N H sing N N 280 SER N H2 sing N N 281 SER CA C sing N N 282 SER CA CB sing N N 283 SER CA HA sing N N 284 SER C O doub N N 285 SER C OXT sing N N 286 SER CB OG sing N N 287 SER CB HB2 sing N N 288 SER CB HB3 sing N N 289 SER OG HG sing N N 290 SER OXT HXT sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TYR N CA sing N N 308 TYR N H sing N N 309 TYR N H2 sing N N 310 TYR CA C sing N N 311 TYR CA CB sing N N 312 TYR CA HA sing N N 313 TYR C O doub N N 314 TYR C OXT sing N N 315 TYR CB CG sing N N 316 TYR CB HB2 sing N N 317 TYR CB HB3 sing N N 318 TYR CG CD1 doub Y N 319 TYR CG CD2 sing Y N 320 TYR CD1 CE1 sing Y N 321 TYR CD1 HD1 sing N N 322 TYR CD2 CE2 doub Y N 323 TYR CD2 HD2 sing N N 324 TYR CE1 CZ doub Y N 325 TYR CE1 HE1 sing N N 326 TYR CE2 CZ sing Y N 327 TYR CE2 HE2 sing N N 328 TYR CZ OH sing N N 329 TYR OH HH sing N N 330 TYR OXT HXT sing N N 331 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'INOVA 500' _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 500 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 1FF7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_