data_1FKC # _entry.id 1FKC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.291 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1FKC RCSB RCSB011668 WWPDB D_1000011668 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FKC _pdbx_database_status.recvd_initial_deposition_date 2000-08-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, Y.' 1 'Swietnicki, W.' 2 'Zagorski, M.G.' 3 'Surewicz, W.K.' 4 'Soennichsen, F.D.' 5 # _citation.id primary _citation.title ;Solution structure of the E200K variant of human prion protein. Implications for the mechanism of pathogenesis in familial prion diseases. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 275 _citation.page_first 33650 _citation.page_last 33654 _citation.year 2000 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10954699 _citation.pdbx_database_id_DOI 10.1074/jbc.C000483200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zhang, Y.' 1 primary 'Swietnicki, W.' 2 primary 'Zagorski, M.G.' 3 primary 'Surewicz, W.K.' 4 primary 'Sonnichsen, F.D.' 5 # _cell.entry_id 1FKC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FKC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PRION PROTEIN' _entity.formula_weight 16169.063 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation E200K _entity.pdbx_fragment 'PRP(90-231)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEY SNQNNFVHDCVNITIKQHTVTTTTKGENFTKTDVKMMERVVEQMCITQYERESQAYYQRGSS ; _entity_poly.pdbx_seq_one_letter_code_can ;GQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEY SNQNNFVHDCVNITIKQHTVTTTTKGENFTKTDVKMMERVVEQMCITQYERESQAYYQRGSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLN n 1 3 GLY n 1 4 GLY n 1 5 GLY n 1 6 THR n 1 7 HIS n 1 8 SER n 1 9 GLN n 1 10 TRP n 1 11 ASN n 1 12 LYS n 1 13 PRO n 1 14 SER n 1 15 LYS n 1 16 PRO n 1 17 LYS n 1 18 THR n 1 19 ASN n 1 20 MET n 1 21 LYS n 1 22 HIS n 1 23 MET n 1 24 ALA n 1 25 GLY n 1 26 ALA n 1 27 ALA n 1 28 ALA n 1 29 ALA n 1 30 GLY n 1 31 ALA n 1 32 VAL n 1 33 VAL n 1 34 GLY n 1 35 GLY n 1 36 LEU n 1 37 GLY n 1 38 GLY n 1 39 TYR n 1 40 MET n 1 41 LEU n 1 42 GLY n 1 43 SER n 1 44 ALA n 1 45 MET n 1 46 SER n 1 47 ARG n 1 48 PRO n 1 49 ILE n 1 50 ILE n 1 51 HIS n 1 52 PHE n 1 53 GLY n 1 54 SER n 1 55 ASP n 1 56 TYR n 1 57 GLU n 1 58 ASP n 1 59 ARG n 1 60 TYR n 1 61 TYR n 1 62 ARG n 1 63 GLU n 1 64 ASN n 1 65 MET n 1 66 HIS n 1 67 ARG n 1 68 TYR n 1 69 PRO n 1 70 ASN n 1 71 GLN n 1 72 VAL n 1 73 TYR n 1 74 TYR n 1 75 ARG n 1 76 PRO n 1 77 MET n 1 78 ASP n 1 79 GLU n 1 80 TYR n 1 81 SER n 1 82 ASN n 1 83 GLN n 1 84 ASN n 1 85 ASN n 1 86 PHE n 1 87 VAL n 1 88 HIS n 1 89 ASP n 1 90 CYS n 1 91 VAL n 1 92 ASN n 1 93 ILE n 1 94 THR n 1 95 ILE n 1 96 LYS n 1 97 GLN n 1 98 HIS n 1 99 THR n 1 100 VAL n 1 101 THR n 1 102 THR n 1 103 THR n 1 104 THR n 1 105 LYS n 1 106 GLY n 1 107 GLU n 1 108 ASN n 1 109 PHE n 1 110 THR n 1 111 LYS n 1 112 THR n 1 113 ASP n 1 114 VAL n 1 115 LYS n 1 116 MET n 1 117 MET n 1 118 GLU n 1 119 ARG n 1 120 VAL n 1 121 VAL n 1 122 GLU n 1 123 GLN n 1 124 MET n 1 125 CYS n 1 126 ILE n 1 127 THR n 1 128 GLN n 1 129 TYR n 1 130 GLU n 1 131 ARG n 1 132 GLU n 1 133 SER n 1 134 GLN n 1 135 ALA n 1 136 TYR n 1 137 TYR n 1 138 GLN n 1 139 ARG n 1 140 GLY n 1 141 SER n 1 142 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ BRAIN _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description BRAIN # _struct_ref.id 1 _struct_ref.db_code PRIO_HUMAN _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04156 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FKC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 142 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04156 _struct_ref_seq.db_align_beg 90 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 231 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 90 _struct_ref_seq.pdbx_auth_seq_align_end 231 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1FKC _struct_ref_seq_dif.mon_id LYS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 111 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P04156 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 200 _struct_ref_seq_dif.details 'ENGINEERED MUTATION' _struct_ref_seq_dif.pdbx_auth_seq_num 200 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 2 2 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 299 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.00001 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.8 mM E200K(90-231)PrP U-15N,13C; 10mM acetate buffer' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 800 2 ? Varian INOVA 600 # _pdbx_nmr_refine.entry_id 1FKC _pdbx_nmr_refine.method ;simulated annealing molecular dynamics ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1FKC _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_ensemble.entry_id 1FKC _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1FKC _pdbx_nmr_representative.conformer_id 11 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal CNS 0.9 'structure solution' Brunger 1 ARIA 0.9 'structure solution' Nigles 2 CNS 0.9 refinement Brunger 3 # _exptl.entry_id 1FKC _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1FKC _struct.title 'HUMAN PRION PROTEIN (MUTANT E200K) FRAGMENT 90-231' _struct.pdbx_descriptor 'HUMAN PRION PROTEIN (MUTANT E200K)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FKC _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'three helix, CREUTZFELDT-JAKOB DISEASE, PRION, AGGREGATION, MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 54 ? MET A 65 ? SER A 143 MET A 154 1 ? 12 HELX_P HELX_P2 2 HIS A 66 ? TYR A 68 ? HIS A 155 TYR A 157 5 ? 3 HELX_P HELX_P3 3 ASN A 82 ? GLY A 106 ? ASN A 171 GLY A 195 1 ? 25 HELX_P HELX_P4 4 THR A 110 ? GLY A 140 ? THR A 199 GLY A 229 1 ? 31 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 90 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 125 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 179 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 214 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.030 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 MET A 40 ? GLY A 42 ? MET A 129 GLY A 131 A 2 VAL A 72 ? TYR A 74 ? VAL A 161 TYR A 163 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLY _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 42 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 131 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 72 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 161 # _database_PDB_matrix.entry_id 1FKC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FKC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 90 ? ? ? A . n A 1 2 GLN 2 91 ? ? ? A . n A 1 3 GLY 3 92 ? ? ? A . n A 1 4 GLY 4 93 ? ? ? A . n A 1 5 GLY 5 94 ? ? ? A . n A 1 6 THR 6 95 ? ? ? A . n A 1 7 HIS 7 96 ? ? ? A . n A 1 8 SER 8 97 ? ? ? A . n A 1 9 GLN 9 98 ? ? ? A . n A 1 10 TRP 10 99 ? ? ? A . n A 1 11 ASN 11 100 ? ? ? A . n A 1 12 LYS 12 101 ? ? ? A . n A 1 13 PRO 13 102 ? ? ? A . n A 1 14 SER 14 103 ? ? ? A . n A 1 15 LYS 15 104 ? ? ? A . n A 1 16 PRO 16 105 ? ? ? A . n A 1 17 LYS 17 106 ? ? ? A . n A 1 18 THR 18 107 ? ? ? A . n A 1 19 ASN 19 108 ? ? ? A . n A 1 20 MET 20 109 ? ? ? A . n A 1 21 LYS 21 110 ? ? ? A . n A 1 22 HIS 22 111 ? ? ? A . n A 1 23 MET 23 112 ? ? ? A . n A 1 24 ALA 24 113 ? ? ? A . n A 1 25 GLY 25 114 ? ? ? A . n A 1 26 ALA 26 115 ? ? ? A . n A 1 27 ALA 27 116 ? ? ? A . n A 1 28 ALA 28 117 ? ? ? A . n A 1 29 ALA 29 118 ? ? ? A . n A 1 30 GLY 30 119 ? ? ? A . n A 1 31 ALA 31 120 ? ? ? A . n A 1 32 VAL 32 121 ? ? ? A . n A 1 33 VAL 33 122 ? ? ? A . n A 1 34 GLY 34 123 ? ? ? A . n A 1 35 GLY 35 124 ? ? ? A . n A 1 36 LEU 36 125 125 LEU LEU A . n A 1 37 GLY 37 126 126 GLY GLY A . n A 1 38 GLY 38 127 127 GLY GLY A . n A 1 39 TYR 39 128 128 TYR TYR A . n A 1 40 MET 40 129 129 MET MET A . n A 1 41 LEU 41 130 130 LEU LEU A . n A 1 42 GLY 42 131 131 GLY GLY A . n A 1 43 SER 43 132 132 SER SER A . n A 1 44 ALA 44 133 133 ALA ALA A . n A 1 45 MET 45 134 134 MET MET A . n A 1 46 SER 46 135 135 SER SER A . n A 1 47 ARG 47 136 136 ARG ARG A . n A 1 48 PRO 48 137 137 PRO PRO A . n A 1 49 ILE 49 138 138 ILE ILE A . n A 1 50 ILE 50 139 139 ILE ILE A . n A 1 51 HIS 51 140 140 HIS HIS A . n A 1 52 PHE 52 141 141 PHE PHE A . n A 1 53 GLY 53 142 142 GLY GLY A . n A 1 54 SER 54 143 143 SER SER A . n A 1 55 ASP 55 144 144 ASP ASP A . n A 1 56 TYR 56 145 145 TYR TYR A . n A 1 57 GLU 57 146 146 GLU GLU A . n A 1 58 ASP 58 147 147 ASP ASP A . n A 1 59 ARG 59 148 148 ARG ARG A . n A 1 60 TYR 60 149 149 TYR TYR A . n A 1 61 TYR 61 150 150 TYR TYR A . n A 1 62 ARG 62 151 151 ARG ARG A . n A 1 63 GLU 63 152 152 GLU GLU A . n A 1 64 ASN 64 153 153 ASN ASN A . n A 1 65 MET 65 154 154 MET MET A . n A 1 66 HIS 66 155 155 HIS HIS A . n A 1 67 ARG 67 156 156 ARG ARG A . n A 1 68 TYR 68 157 157 TYR TYR A . n A 1 69 PRO 69 158 158 PRO PRO A . n A 1 70 ASN 70 159 159 ASN ASN A . n A 1 71 GLN 71 160 160 GLN GLN A . n A 1 72 VAL 72 161 161 VAL VAL A . n A 1 73 TYR 73 162 162 TYR TYR A . n A 1 74 TYR 74 163 163 TYR TYR A . n A 1 75 ARG 75 164 164 ARG ARG A . n A 1 76 PRO 76 165 165 PRO PRO A . n A 1 77 MET 77 166 166 MET MET A . n A 1 78 ASP 78 167 167 ASP ASP A . n A 1 79 GLU 79 168 168 GLU GLU A . n A 1 80 TYR 80 169 169 TYR TYR A . n A 1 81 SER 81 170 170 SER SER A . n A 1 82 ASN 82 171 171 ASN ASN A . n A 1 83 GLN 83 172 172 GLN GLN A . n A 1 84 ASN 84 173 173 ASN ASN A . n A 1 85 ASN 85 174 174 ASN ASN A . n A 1 86 PHE 86 175 175 PHE PHE A . n A 1 87 VAL 87 176 176 VAL VAL A . n A 1 88 HIS 88 177 177 HIS HIS A . n A 1 89 ASP 89 178 178 ASP ASP A . n A 1 90 CYS 90 179 179 CYS CYS A . n A 1 91 VAL 91 180 180 VAL VAL A . n A 1 92 ASN 92 181 181 ASN ASN A . n A 1 93 ILE 93 182 182 ILE ILE A . n A 1 94 THR 94 183 183 THR THR A . n A 1 95 ILE 95 184 184 ILE ILE A . n A 1 96 LYS 96 185 185 LYS LYS A . n A 1 97 GLN 97 186 186 GLN GLN A . n A 1 98 HIS 98 187 187 HIS HIS A . n A 1 99 THR 99 188 188 THR THR A . n A 1 100 VAL 100 189 189 VAL VAL A . n A 1 101 THR 101 190 190 THR THR A . n A 1 102 THR 102 191 191 THR THR A . n A 1 103 THR 103 192 192 THR THR A . n A 1 104 THR 104 193 193 THR THR A . n A 1 105 LYS 105 194 194 LYS LYS A . n A 1 106 GLY 106 195 195 GLY GLY A . n A 1 107 GLU 107 196 196 GLU GLU A . n A 1 108 ASN 108 197 197 ASN ASN A . n A 1 109 PHE 109 198 198 PHE PHE A . n A 1 110 THR 110 199 199 THR THR A . n A 1 111 LYS 111 200 200 LYS LYS A . n A 1 112 THR 112 201 201 THR THR A . n A 1 113 ASP 113 202 202 ASP ASP A . n A 1 114 VAL 114 203 203 VAL VAL A . n A 1 115 LYS 115 204 204 LYS LYS A . n A 1 116 MET 116 205 205 MET MET A . n A 1 117 MET 117 206 206 MET MET A . n A 1 118 GLU 118 207 207 GLU GLU A . n A 1 119 ARG 119 208 208 ARG ARG A . n A 1 120 VAL 120 209 209 VAL VAL A . n A 1 121 VAL 121 210 210 VAL VAL A . n A 1 122 GLU 122 211 211 GLU GLU A . n A 1 123 GLN 123 212 212 GLN GLN A . n A 1 124 MET 124 213 213 MET MET A . n A 1 125 CYS 125 214 214 CYS CYS A . n A 1 126 ILE 126 215 215 ILE ILE A . n A 1 127 THR 127 216 216 THR THR A . n A 1 128 GLN 128 217 217 GLN GLN A . n A 1 129 TYR 129 218 218 TYR TYR A . n A 1 130 GLU 130 219 219 GLU GLU A . n A 1 131 ARG 131 220 220 ARG ARG A . n A 1 132 GLU 132 221 221 GLU GLU A . n A 1 133 SER 133 222 222 SER SER A . n A 1 134 GLN 134 223 223 GLN GLN A . n A 1 135 ALA 135 224 224 ALA ALA A . n A 1 136 TYR 136 225 225 TYR TYR A . n A 1 137 TYR 137 226 226 TYR TYR A . n A 1 138 GLN 138 227 227 GLN GLN A . n A 1 139 ARG 139 228 228 ARG ARG A . n A 1 140 GLY 140 229 229 GLY GLY A . n A 1 141 SER 141 230 230 SER SER A . n A 1 142 SER 142 231 231 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-09-21 2 'Structure model' 1 1 2007-10-21 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-03-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_struct_assembly 2 4 'Structure model' pdbx_struct_oper_list 3 4 'Structure model' struct_ref_seq_dif # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 132 ? ? -52.92 172.00 2 1 MET A 134 ? ? -130.63 -71.03 3 1 PHE A 141 ? ? -99.71 -93.00 4 1 SER A 143 ? ? -148.65 -154.30 5 1 ASP A 167 ? ? -105.55 -157.65 6 1 TYR A 169 ? ? 55.24 74.06 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 90 ? A GLY 1 2 1 Y 1 A GLN 91 ? A GLN 2 3 1 Y 1 A GLY 92 ? A GLY 3 4 1 Y 1 A GLY 93 ? A GLY 4 5 1 Y 1 A GLY 94 ? A GLY 5 6 1 Y 1 A THR 95 ? A THR 6 7 1 Y 1 A HIS 96 ? A HIS 7 8 1 Y 1 A SER 97 ? A SER 8 9 1 Y 1 A GLN 98 ? A GLN 9 10 1 Y 1 A TRP 99 ? A TRP 10 11 1 Y 1 A ASN 100 ? A ASN 11 12 1 Y 1 A LYS 101 ? A LYS 12 13 1 Y 1 A PRO 102 ? A PRO 13 14 1 Y 1 A SER 103 ? A SER 14 15 1 Y 1 A LYS 104 ? A LYS 15 16 1 Y 1 A PRO 105 ? A PRO 16 17 1 Y 1 A LYS 106 ? A LYS 17 18 1 Y 1 A THR 107 ? A THR 18 19 1 Y 1 A ASN 108 ? A ASN 19 20 1 Y 1 A MET 109 ? A MET 20 21 1 Y 1 A LYS 110 ? A LYS 21 22 1 Y 1 A HIS 111 ? A HIS 22 23 1 Y 1 A MET 112 ? A MET 23 24 1 Y 1 A ALA 113 ? A ALA 24 25 1 Y 1 A GLY 114 ? A GLY 25 26 1 Y 1 A ALA 115 ? A ALA 26 27 1 Y 1 A ALA 116 ? A ALA 27 28 1 Y 1 A ALA 117 ? A ALA 28 29 1 Y 1 A ALA 118 ? A ALA 29 30 1 Y 1 A GLY 119 ? A GLY 30 31 1 Y 1 A ALA 120 ? A ALA 31 32 1 Y 1 A VAL 121 ? A VAL 32 33 1 Y 1 A VAL 122 ? A VAL 33 34 1 Y 1 A GLY 123 ? A GLY 34 35 1 Y 1 A GLY 124 ? A GLY 35 #