data_1FY3 # _entry.id 1FY3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1FY3 pdb_00001fy3 10.2210/pdb1fy3/pdb RCSB RCSB012002 ? ? WWPDB D_1000012002 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1A7S 'Atomic resolution structure of human HBP (cryogenic temperature)' unspecified PDB 1AE5 'Structure of HBP at 2.3 A (room temperature)' unspecified PDB 1FY1 '[R23S, F25E] mutant human HBP' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FY3 _pdbx_database_status.recvd_initial_deposition_date 2000-09-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kastrup, J.S.' 1 'Linde, V.' 2 'Pedersen, A.K.' 3 'Stoffer, B.' 4 'Iversen, L.F.' 5 'Larsen, I.K.' 6 'Rasmussen, P.B.' 7 'Flodgaard, H.J.' 8 'Bjorn, S.E.' 9 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Two mutants of human heparin binding protein (CAP37): toward the understanding of the nature of lipid A/LPS and BPTI binding.' Proteins 42 442 451 2001 PSFGEY US 0887-3585 0867 ? 11170199 '10.1002/1097-0134(20010301)42:4<442::AID-PROT30>3.0.CO;2-S' 1 'Atomic resolution structure of human HBP/CAP37/Azurocidin' 'Acta Crystallogr.,Sect.D' 54 598 609 1998 ABCRE6 DK 0907-4449 0766 ? ? 10.1107/S0907444997016193 2 'Structure of HBP, a multifunctional protein with a serine proteinase fold' Nat.Struct.Biol. 4 265 268 1997 NSBIEW US 1072-8368 2024 ? ? ? 3 'Crystallization and Molecular Replacement Solution of Human Heparin Binding Protein' 'Acta Crystallogr.,Sect.D' 52 1222 1223 1996 ABCRE6 DK 0907-4449 0766 ? ? 10.1107/S0907444996010086 4 ;Structure and function of the N-linked glycans of HBP/CAP37/azurocidin: Crystal structure determination and biological characterization of nonglycosylated HBP ; 'Protein Sci.' 8 2019 2026 1999 PRCIEI US 0961-8368 0795 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kastrup, J.S.' 1 ? primary 'Linde, V.' 2 ? primary 'Pedersen, A.K.' 3 ? primary 'Stoffer, B.' 4 ? primary 'Iversen, L.F.' 5 ? primary 'Larsen, I.K.' 6 ? primary 'Rasmussen, P.B.' 7 ? primary 'Flodgaard, H.J.' 8 ? primary 'Bjorn, S.E.' 9 ? 1 'Karlsen, S.' 10 ? 1 'Iversen, L.F.' 11 ? 1 'Larsen, I.K.' 12 ? 1 'Flodgaard, H.J.' 13 ? 1 'Kastrup, J.S.' 14 ? 2 'Iversen, L.F.' 15 ? 2 'Kastrup, J.S.' 16 ? 2 'Bjorn, S.E.' 17 ? 2 'Rasmussen, P.B.' 18 ? 2 'Wiberg, F.C.' 19 ? 2 'Flodgaard, H.J.' 20 ? 2 'Larsen, I.K.' 21 ? 3 'Iversen, L.F.' 22 ? 3 'Kastrup, J.S.' 23 ? 3 'Larsen, I.K.' 24 ? 3 'Bjorn, S.E.' 25 ? 3 'Rasmussen, P.B.' 26 ? 3 'Wiberg, F.C.' 27 ? 3 'Flodgaard, H.J.' 28 ? 4 'Iversen, L.F.' 29 ? 4 'Kastrup, J.S.' 30 ? 4 'Bjorn, S.E.' 31 ? 4 'Wiberg, F.C.' 32 ? 4 'Larsen, I.K.' 33 ? 4 'Flodgaard, H.J.' 34 ? 4 'Rasmussen, P.B.' 35 ? # _cell.entry_id 1FY3 _cell.length_a 38.003 _cell.length_b 65.138 _cell.length_c 100.655 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FY3 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HEPARIN-BINDING PROTEIN' 24373.553 1 ? G175Q ? ? 2 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 1 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 non-polymer syn ETHANOL 46.068 1 ? ? ? ? 6 water nat water 18.015 233 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HBP, AZUROCIDIN, CATIONIC ANTIMICROBIAL PROTEIN CAP37' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENG YDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVC TGVLTRRGGICNGDQGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA ; _entity_poly.pdbx_seq_one_letter_code_can ;IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENG YDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVC TGVLTRRGGICNGDQGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 ARG n 1 6 LYS n 1 7 ALA n 1 8 ARG n 1 9 PRO n 1 10 ARG n 1 11 GLN n 1 12 PHE n 1 13 PRO n 1 14 PHE n 1 15 LEU n 1 16 ALA n 1 17 SER n 1 18 ILE n 1 19 GLN n 1 20 ASN n 1 21 GLN n 1 22 GLY n 1 23 ARG n 1 24 HIS n 1 25 PHE n 1 26 CYS n 1 27 GLY n 1 28 GLY n 1 29 ALA n 1 30 LEU n 1 31 ILE n 1 32 HIS n 1 33 ALA n 1 34 ARG n 1 35 PHE n 1 36 VAL n 1 37 MET n 1 38 THR n 1 39 ALA n 1 40 ALA n 1 41 SER n 1 42 CYS n 1 43 PHE n 1 44 GLN n 1 45 SER n 1 46 GLN n 1 47 ASN n 1 48 PRO n 1 49 GLY n 1 50 VAL n 1 51 SER n 1 52 THR n 1 53 VAL n 1 54 VAL n 1 55 LEU n 1 56 GLY n 1 57 ALA n 1 58 TYR n 1 59 ASP n 1 60 LEU n 1 61 ARG n 1 62 ARG n 1 63 ARG n 1 64 GLU n 1 65 ARG n 1 66 GLN n 1 67 SER n 1 68 ARG n 1 69 GLN n 1 70 THR n 1 71 PHE n 1 72 SER n 1 73 ILE n 1 74 SER n 1 75 SER n 1 76 MET n 1 77 SER n 1 78 GLU n 1 79 ASN n 1 80 GLY n 1 81 TYR n 1 82 ASP n 1 83 PRO n 1 84 GLN n 1 85 GLN n 1 86 ASN n 1 87 LEU n 1 88 ASN n 1 89 ASP n 1 90 LEU n 1 91 MET n 1 92 LEU n 1 93 LEU n 1 94 GLN n 1 95 LEU n 1 96 ASP n 1 97 ARG n 1 98 GLU n 1 99 ALA n 1 100 ASN n 1 101 LEU n 1 102 THR n 1 103 SER n 1 104 SER n 1 105 VAL n 1 106 THR n 1 107 ILE n 1 108 LEU n 1 109 PRO n 1 110 LEU n 1 111 PRO n 1 112 LEU n 1 113 GLN n 1 114 ASN n 1 115 ALA n 1 116 THR n 1 117 VAL n 1 118 GLU n 1 119 ALA n 1 120 GLY n 1 121 THR n 1 122 ARG n 1 123 CYS n 1 124 GLN n 1 125 VAL n 1 126 ALA n 1 127 GLY n 1 128 TRP n 1 129 GLY n 1 130 SER n 1 131 GLN n 1 132 ARG n 1 133 SER n 1 134 GLY n 1 135 GLY n 1 136 ARG n 1 137 LEU n 1 138 SER n 1 139 ARG n 1 140 PHE n 1 141 PRO n 1 142 ARG n 1 143 PHE n 1 144 VAL n 1 145 ASN n 1 146 VAL n 1 147 THR n 1 148 VAL n 1 149 THR n 1 150 PRO n 1 151 GLU n 1 152 ASP n 1 153 GLN n 1 154 CYS n 1 155 ARG n 1 156 PRO n 1 157 ASN n 1 158 ASN n 1 159 VAL n 1 160 CYS n 1 161 THR n 1 162 GLY n 1 163 VAL n 1 164 LEU n 1 165 THR n 1 166 ARG n 1 167 ARG n 1 168 GLY n 1 169 GLY n 1 170 ILE n 1 171 CYS n 1 172 ASN n 1 173 GLY n 1 174 ASP n 1 175 GLN n 1 176 GLY n 1 177 THR n 1 178 PRO n 1 179 LEU n 1 180 VAL n 1 181 CYS n 1 182 GLU n 1 183 GLY n 1 184 LEU n 1 185 ALA n 1 186 HIS n 1 187 GLY n 1 188 VAL n 1 189 ALA n 1 190 SER n 1 191 PHE n 1 192 SER n 1 193 LEU n 1 194 GLY n 1 195 PRO n 1 196 CYS n 1 197 GLY n 1 198 ARG n 1 199 GLY n 1 200 PRO n 1 201 ASP n 1 202 PHE n 1 203 PHE n 1 204 THR n 1 205 ARG n 1 206 VAL n 1 207 ALA n 1 208 LEU n 1 209 PHE n 1 210 ARG n 1 211 ASP n 1 212 TRP n 1 213 ILE n 1 214 ASP n 1 215 GLY n 1 216 VAL n 1 217 LEU n 1 218 ASN n 1 219 ASN n 1 220 PRO n 1 221 GLY n 1 222 PRO n 1 223 GLY n 1 224 PRO n 1 225 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'unidentified baculovirus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10469 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ACMNPV _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line SF-900 _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_code CAP7_HUMAN _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P20160 _struct_ref.pdbx_align_begin 27 _struct_ref.pdbx_seq_one_letter_code ;IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENG YDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVC TGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FY3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 225 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P20160 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 251 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 225 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1FY3 _struct_ref_seq_dif.mon_id GLN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 175 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P20160 _struct_ref_seq_dif.db_mon_id GLY _struct_ref_seq_dif.pdbx_seq_db_seq_num 201 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 175 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EOH non-polymer . ETHANOL ? 'C2 H6 O' 46.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1FY3 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 51.84 _exptl_crystal.density_Matthews 2.55 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details 'Ethanol, glycerol, TRIS, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1998-08-20 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.996 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'MAX II BEAMLINE I711' _diffrn_source.pdbx_wavelength 0.996 _diffrn_source.pdbx_synchrotron_site 'MAX II' _diffrn_source.pdbx_synchrotron_beamline I711 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1FY3 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 1.89 _reflns.number_obs 18582 _reflns.number_all 18582 _reflns.percent_possible_obs 89.3 _reflns.pdbx_Rmerge_I_obs 0.063 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 14.7 _reflns.B_iso_Wilson_estimate 14.7 _reflns.pdbx_redundancy 5.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.89 _reflns_shell.d_res_low 1.92 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 87.7 _reflns_shell.Rmerge_I_obs 0.269 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 5.5 _reflns_shell.number_unique_all 885 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1FY3 _refine.ls_number_reflns_obs 18582 _refine.ls_number_reflns_all 18582 _refine.pdbx_ls_sigma_I 1 _refine.pdbx_ls_sigma_F 1 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 1.89 _refine.ls_percent_reflns_obs 89.3 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.182 _refine.ls_R_factor_R_free 0.252 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 950 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'TNT PROTGEO' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details Random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1666 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 46 _refine_hist.number_atoms_solvent 233 _refine_hist.number_atoms_total 1945 _refine_hist.d_res_high 1.89 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_angle_deg 1.9 ? ? ? 'X-RAY DIFFRACTION' ? t_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1FY3 _struct.title '[G175Q]HBP, A mutant of human heparin binding protein (CAP37)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FY3 _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'Serine protease homolog, BPTI binding site, ANTIMICROBIAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_biol.id 1 _struct_biol.details 'The biological unit is a monomer' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 39 ? PHE A 43 ? ALA A 39 PHE A 43 5 ? 5 HELX_P HELX_P2 2 PRO A 150 ? CYS A 154 ? PRO A 150 CYS A 154 5 ? 5 HELX_P HELX_P3 3 PHE A 209 ? ASN A 218 ? PHE A 209 ASN A 218 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 26 A CYS 42 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf2 disulf ? ? A CYS 123 SG ? ? ? 1_555 A CYS 181 SG ? ? A CYS 123 A CYS 181 1_555 ? ? ? ? ? ? ? 2.057 ? ? disulf3 disulf ? ? A CYS 154 SG ? ? ? 1_555 A CYS 160 SG ? ? A CYS 154 A CYS 160 1_555 ? ? ? ? ? ? ? 2.067 ? ? disulf4 disulf ? ? A CYS 171 SG ? ? ? 1_555 A CYS 196 SG ? ? A CYS 171 A CYS 196 1_555 ? ? ? ? ? ? ? 2.097 ? ? covale1 covale one ? A ASN 114 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 114 A NAG 401 1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation covale2 covale one ? A ASN 145 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 145 B NAG 1 1_555 ? ? ? ? ? ? ? 1.426 ? N-Glycosylation covale3 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.451 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 199 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 199 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 200 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 200 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.21 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 9 ? B ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 5 ? LYS A 6 ? ARG A 5 LYS A 6 A 2 ARG A 142 ? VAL A 148 ? ARG A 142 VAL A 148 A 3 ARG A 122 ? GLY A 127 ? ARG A 122 GLY A 127 A 4 PRO A 178 ? CYS A 181 ? PRO A 178 CYS A 181 A 5 LEU A 184 ? SER A 192 ? LEU A 184 SER A 192 A 6 ASP A 201 ? ARG A 205 ? ASP A 201 ARG A 205 A 7 ASN A 158 ? GLY A 162 ? ASN A 158 GLY A 162 A 8 ARG A 142 ? VAL A 148 ? ARG A 142 VAL A 148 A 9 ARG A 122 ? GLY A 127 ? ARG A 122 GLY A 127 B 1 LEU A 15 ? ASN A 20 ? LEU A 15 ASN A 20 B 2 ARG A 23 ? HIS A 32 ? ARG A 23 HIS A 32 B 3 PHE A 35 ? THR A 38 ? PHE A 35 THR A 38 B 4 MET A 91 ? LEU A 95 ? MET A 91 LEU A 95 B 5 GLN A 69 ? GLU A 78 ? GLN A 69 GLU A 78 B 6 THR A 52 ? LEU A 55 ? THR A 52 LEU A 55 B 7 LEU A 15 ? ASN A 20 ? LEU A 15 ASN A 20 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 5 ? N ARG A 5 O PHE A 143 ? O PHE A 143 A 2 3 O VAL A 146 ? O VAL A 146 N CYS A 123 ? N CYS A 123 A 3 4 N ALA A 126 ? N ALA A 126 O PRO A 178 ? O PRO A 178 A 4 5 O CYS A 181 ? O CYS A 181 N LEU A 184 ? N LEU A 184 A 5 6 O PHE A 191 ? O PHE A 191 N PHE A 202 ? N PHE A 202 A 6 7 N PHE A 203 ? N PHE A 203 O VAL A 159 ? O VAL A 159 A 7 8 O GLY A 162 ? O GLY A 162 N THR A 147 ? N THR A 147 A 8 9 O VAL A 146 ? O VAL A 146 N CYS A 123 ? N CYS A 123 B 1 2 N ASN A 20 ? N ASN A 20 O ARG A 23 ? O ARG A 23 B 2 3 N ILE A 31 ? N ILE A 31 O PHE A 35 ? O PHE A 35 B 3 4 N THR A 38 ? N THR A 38 O MET A 91 ? O MET A 91 B 4 5 O GLN A 94 ? O GLN A 94 N SER A 74 ? N SER A 74 B 5 6 O PHE A 71 ? O PHE A 71 N VAL A 53 ? N VAL A 53 B 6 7 N VAL A 54 ? N VAL A 54 O SER A 17 ? O SER A 17 # _database_PDB_matrix.entry_id 1FY3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1FY3 _atom_sites.fract_transf_matrix[1][1] 0.026314 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015352 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009935 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 1 ILE ILE A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLN 44 44 ? ? ? A . n A 1 45 SER 45 45 ? ? ? A . n A 1 46 GLN 46 46 ? ? ? A . n A 1 47 ASN 47 47 ? ? ? A . n A 1 48 PRO 48 48 ? ? ? A . n A 1 49 GLY 49 49 ? ? ? A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 MET 76 76 76 MET MET A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 MET 91 91 91 MET MET A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 CYS 123 123 123 CYS CYS A . n A 1 124 GLN 124 124 124 GLN GLN A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 TRP 128 128 128 TRP TRP A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 GLN 131 131 131 GLN GLN A . n A 1 132 ARG 132 132 132 ARG ARG A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 GLN 153 153 153 GLN GLN A . n A 1 154 CYS 154 154 154 CYS CYS A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 ASN 158 158 158 ASN ASN A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 CYS 160 160 160 CYS CYS A . n A 1 161 THR 161 161 161 THR THR A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 VAL 163 163 163 VAL VAL A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 CYS 171 171 171 CYS CYS A . n A 1 172 ASN 172 172 172 ASN ASN A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 PRO 178 178 178 PRO PRO A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 CYS 181 181 181 CYS CYS A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 ALA 185 185 185 ALA ALA A . n A 1 186 HIS 186 186 186 HIS HIS A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 LEU 193 193 193 LEU LEU A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 CYS 196 196 196 CYS CYS A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 ARG 198 198 198 ARG ARG A . n A 1 199 GLY 199 199 199 GLY GLY A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 PHE 202 202 202 PHE PHE A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 ARG 205 205 205 ARG ARG A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 PHE 209 209 209 PHE PHE A . n A 1 210 ARG 210 210 210 ARG ARG A . n A 1 211 ASP 211 211 211 ASP ASP A . n A 1 212 TRP 212 212 212 TRP TRP A . n A 1 213 ILE 213 213 213 ILE ILE A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 VAL 216 216 216 VAL VAL A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 ASN 218 218 218 ASN ASN A . n A 1 219 ASN 219 219 219 ASN ASN A . n A 1 220 PRO 220 220 220 PRO PRO A . n A 1 221 GLY 221 221 221 GLY GLY A . n A 1 222 PRO 222 222 222 PRO PRO A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 PRO 224 224 224 PRO PRO A . n A 1 225 ALA 225 225 225 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 NAG 1 401 401 NAG NAG A . D 4 CL 1 601 601 CL CL A . E 5 EOH 1 501 501 EOH EOH A . F 6 HOH 1 1001 1001 HOH HOH A . F 6 HOH 2 1002 1002 HOH HOH A . F 6 HOH 3 1003 1003 HOH HOH A . F 6 HOH 4 1004 1004 HOH HOH A . F 6 HOH 5 1005 1005 HOH HOH A . F 6 HOH 6 1006 1006 HOH HOH A . F 6 HOH 7 1007 1007 HOH HOH A . F 6 HOH 8 1008 1008 HOH HOH A . F 6 HOH 9 1009 1009 HOH HOH A . F 6 HOH 10 1010 1010 HOH HOH A . F 6 HOH 11 1011 1011 HOH HOH A . F 6 HOH 12 1012 1012 HOH HOH A . F 6 HOH 13 1013 1013 HOH HOH A . F 6 HOH 14 1014 1014 HOH HOH A . F 6 HOH 15 1015 1015 HOH HOH A . F 6 HOH 16 1016 1016 HOH HOH A . F 6 HOH 17 1017 1017 HOH HOH A . F 6 HOH 18 1018 1018 HOH HOH A . F 6 HOH 19 1019 1019 HOH HOH A . F 6 HOH 20 1020 1020 HOH HOH A . F 6 HOH 21 1021 1021 HOH HOH A . F 6 HOH 22 1022 1022 HOH HOH A . F 6 HOH 23 1023 1023 HOH HOH A . F 6 HOH 24 1024 1024 HOH HOH A . F 6 HOH 25 1025 1025 HOH HOH A . F 6 HOH 26 1026 1026 HOH HOH A . F 6 HOH 27 1027 1027 HOH HOH A . F 6 HOH 28 1028 1028 HOH HOH A . F 6 HOH 29 1029 1029 HOH HOH A . F 6 HOH 30 1030 1030 HOH HOH A . F 6 HOH 31 1031 1031 HOH HOH A . F 6 HOH 32 1032 1032 HOH HOH A . F 6 HOH 33 1033 1033 HOH HOH A . F 6 HOH 34 1034 1034 HOH HOH A . F 6 HOH 35 1035 1035 HOH HOH A . F 6 HOH 36 1036 1036 HOH HOH A . F 6 HOH 37 1037 1037 HOH HOH A . F 6 HOH 38 1038 1038 HOH HOH A . F 6 HOH 39 1039 1039 HOH HOH A . F 6 HOH 40 1040 1040 HOH HOH A . F 6 HOH 41 1041 1041 HOH HOH A . F 6 HOH 42 1042 1042 HOH HOH A . F 6 HOH 43 1043 1043 HOH HOH A . F 6 HOH 44 1044 1044 HOH HOH A . F 6 HOH 45 1045 1045 HOH HOH A . F 6 HOH 46 1046 1046 HOH HOH A . F 6 HOH 47 1047 1047 HOH HOH A . F 6 HOH 48 1048 1048 HOH HOH A . F 6 HOH 49 1049 1049 HOH HOH A . F 6 HOH 50 1050 1050 HOH HOH A . F 6 HOH 51 1051 1051 HOH HOH A . F 6 HOH 52 1052 1052 HOH HOH A . F 6 HOH 53 1053 1053 HOH HOH A . F 6 HOH 54 1054 1054 HOH HOH A . F 6 HOH 55 1055 1055 HOH HOH A . F 6 HOH 56 1056 1056 HOH HOH A . F 6 HOH 57 1057 1057 HOH HOH A . F 6 HOH 58 1058 1058 HOH HOH A . F 6 HOH 59 1059 1059 HOH HOH A . F 6 HOH 60 1060 1060 HOH HOH A . F 6 HOH 61 1061 1061 HOH HOH A . F 6 HOH 62 1062 1062 HOH HOH A . F 6 HOH 63 1063 1063 HOH HOH A . F 6 HOH 64 1064 1064 HOH HOH A . F 6 HOH 65 1065 1065 HOH HOH A . F 6 HOH 66 1066 1066 HOH HOH A . F 6 HOH 67 1067 1067 HOH HOH A . F 6 HOH 68 1068 1068 HOH HOH A . F 6 HOH 69 1069 1069 HOH HOH A . F 6 HOH 70 1070 1070 HOH HOH A . F 6 HOH 71 1071 1071 HOH HOH A . F 6 HOH 72 1072 1072 HOH HOH A . F 6 HOH 73 1073 1073 HOH HOH A . F 6 HOH 74 1074 1074 HOH HOH A . F 6 HOH 75 1075 1075 HOH HOH A . F 6 HOH 76 1076 1076 HOH HOH A . F 6 HOH 77 1077 1077 HOH HOH A . F 6 HOH 78 1078 1078 HOH HOH A . F 6 HOH 79 1079 1079 HOH HOH A . F 6 HOH 80 1080 1080 HOH HOH A . F 6 HOH 81 1081 1081 HOH HOH A . F 6 HOH 82 1082 1082 HOH HOH A . F 6 HOH 83 1083 1083 HOH HOH A . F 6 HOH 84 1084 1084 HOH HOH A . F 6 HOH 85 1085 1085 HOH HOH A . F 6 HOH 86 1086 1086 HOH HOH A . F 6 HOH 87 1087 1087 HOH HOH A . F 6 HOH 88 1088 1088 HOH HOH A . F 6 HOH 89 1089 1089 HOH HOH A . F 6 HOH 90 1090 1090 HOH HOH A . F 6 HOH 91 1091 1091 HOH HOH A . F 6 HOH 92 1092 1092 HOH HOH A . F 6 HOH 93 1093 1093 HOH HOH A . F 6 HOH 94 1094 1094 HOH HOH A . F 6 HOH 95 1095 1095 HOH HOH A . F 6 HOH 96 1096 1096 HOH HOH A . F 6 HOH 97 1097 1097 HOH HOH A . F 6 HOH 98 1098 1098 HOH HOH A . F 6 HOH 99 1099 1099 HOH HOH A . F 6 HOH 100 1100 1100 HOH HOH A . F 6 HOH 101 1101 1101 HOH HOH A . F 6 HOH 102 1102 1102 HOH HOH A . F 6 HOH 103 1103 1103 HOH HOH A . F 6 HOH 104 1104 1104 HOH HOH A . F 6 HOH 105 1105 1105 HOH HOH A . F 6 HOH 106 1106 1106 HOH HOH A . F 6 HOH 107 1107 1107 HOH HOH A . F 6 HOH 108 1108 1108 HOH HOH A . F 6 HOH 109 1109 1109 HOH HOH A . F 6 HOH 110 1110 1110 HOH HOH A . F 6 HOH 111 1111 1111 HOH HOH A . F 6 HOH 112 1112 1112 HOH HOH A . F 6 HOH 113 1113 1113 HOH HOH A . F 6 HOH 114 1114 1114 HOH HOH A . F 6 HOH 115 1115 1115 HOH HOH A . F 6 HOH 116 1116 1116 HOH HOH A . F 6 HOH 117 1117 1117 HOH HOH A . F 6 HOH 118 1118 1118 HOH HOH A . F 6 HOH 119 1119 1119 HOH HOH A . F 6 HOH 120 1120 1120 HOH HOH A . F 6 HOH 121 1121 1121 HOH HOH A . F 6 HOH 122 1122 1122 HOH HOH A . F 6 HOH 123 1123 1123 HOH HOH A . F 6 HOH 124 1124 1124 HOH HOH A . F 6 HOH 125 1125 1125 HOH HOH A . F 6 HOH 126 1126 1126 HOH HOH A . F 6 HOH 127 1127 1127 HOH HOH A . F 6 HOH 128 1128 1128 HOH HOH A . F 6 HOH 129 1129 1129 HOH HOH A . F 6 HOH 130 1130 1130 HOH HOH A . F 6 HOH 131 1131 1131 HOH HOH A . F 6 HOH 132 1132 1132 HOH HOH A . F 6 HOH 133 1133 1133 HOH HOH A . F 6 HOH 134 1134 1134 HOH HOH A . F 6 HOH 135 1135 1135 HOH HOH A . F 6 HOH 136 1136 1136 HOH HOH A . F 6 HOH 137 1137 1137 HOH HOH A . F 6 HOH 138 1138 1138 HOH HOH A . F 6 HOH 139 1139 1139 HOH HOH A . F 6 HOH 140 1140 1140 HOH HOH A . F 6 HOH 141 1141 1141 HOH HOH A . F 6 HOH 142 1142 1142 HOH HOH A . F 6 HOH 143 1143 1143 HOH HOH A . F 6 HOH 144 1144 1144 HOH HOH A . F 6 HOH 145 1145 1145 HOH HOH A . F 6 HOH 146 1146 1146 HOH HOH A . F 6 HOH 147 1147 1147 HOH HOH A . F 6 HOH 148 1148 1148 HOH HOH A . F 6 HOH 149 1149 1149 HOH HOH A . F 6 HOH 150 1150 1150 HOH HOH A . F 6 HOH 151 1151 1151 HOH HOH A . F 6 HOH 152 1152 1152 HOH HOH A . F 6 HOH 153 1153 1153 HOH HOH A . F 6 HOH 154 1154 1154 HOH HOH A . F 6 HOH 155 1155 1155 HOH HOH A . F 6 HOH 156 1156 1156 HOH HOH A . F 6 HOH 157 1157 1157 HOH HOH A . F 6 HOH 158 1158 1158 HOH HOH A . F 6 HOH 159 1159 1159 HOH HOH A . F 6 HOH 160 1160 1160 HOH HOH A . F 6 HOH 161 1161 1161 HOH HOH A . F 6 HOH 162 1162 1162 HOH HOH A . F 6 HOH 163 1163 1163 HOH HOH A . F 6 HOH 164 1164 1164 HOH HOH A . F 6 HOH 165 1165 1165 HOH HOH A . F 6 HOH 166 1166 1166 HOH HOH A . F 6 HOH 167 1167 1167 HOH HOH A . F 6 HOH 168 1168 1168 HOH HOH A . F 6 HOH 169 1169 1169 HOH HOH A . F 6 HOH 170 1170 1170 HOH HOH A . F 6 HOH 171 1171 1171 HOH HOH A . F 6 HOH 172 1172 1172 HOH HOH A . F 6 HOH 173 1173 1173 HOH HOH A . F 6 HOH 174 1174 1174 HOH HOH A . F 6 HOH 175 1175 1175 HOH HOH A . F 6 HOH 176 1176 1176 HOH HOH A . F 6 HOH 177 1177 1177 HOH HOH A . F 6 HOH 178 1178 1178 HOH HOH A . F 6 HOH 179 1179 1179 HOH HOH A . F 6 HOH 180 1180 1180 HOH HOH A . F 6 HOH 181 1181 1181 HOH HOH A . F 6 HOH 182 1182 1182 HOH HOH A . F 6 HOH 183 1183 1183 HOH HOH A . F 6 HOH 184 1184 1184 HOH HOH A . F 6 HOH 185 1185 1185 HOH HOH A . F 6 HOH 186 1186 1186 HOH HOH A . F 6 HOH 187 1187 1187 HOH HOH A . F 6 HOH 188 1188 1188 HOH HOH A . F 6 HOH 189 1189 1189 HOH HOH A . F 6 HOH 190 1190 1190 HOH HOH A . F 6 HOH 191 1191 1191 HOH HOH A . F 6 HOH 192 1192 1192 HOH HOH A . F 6 HOH 193 1193 1193 HOH HOH A . F 6 HOH 194 1194 1194 HOH HOH A . F 6 HOH 195 1195 1195 HOH HOH A . F 6 HOH 196 1196 1196 HOH HOH A . F 6 HOH 197 1197 1197 HOH HOH A . F 6 HOH 198 1198 1198 HOH HOH A . F 6 HOH 199 1199 1199 HOH HOH A . F 6 HOH 200 1200 1200 HOH HOH A . F 6 HOH 201 1201 1201 HOH HOH A . F 6 HOH 202 1202 1202 HOH HOH A . F 6 HOH 203 1203 1203 HOH HOH A . F 6 HOH 204 1204 1204 HOH HOH A . F 6 HOH 205 1205 1205 HOH HOH A . F 6 HOH 206 1206 1206 HOH HOH A . F 6 HOH 207 1207 1207 HOH HOH A . F 6 HOH 208 1208 1208 HOH HOH A . F 6 HOH 209 1209 1209 HOH HOH A . F 6 HOH 210 1210 1210 HOH HOH A . F 6 HOH 211 1211 1211 HOH HOH A . F 6 HOH 212 1212 1212 HOH HOH A . F 6 HOH 213 1213 1213 HOH HOH A . F 6 HOH 214 1214 1214 HOH HOH A . F 6 HOH 215 1215 1215 HOH HOH A . F 6 HOH 216 1216 1216 HOH HOH A . F 6 HOH 217 1217 1217 HOH HOH A . F 6 HOH 218 1218 1218 HOH HOH A . F 6 HOH 219 1219 1219 HOH HOH A . F 6 HOH 220 1220 1220 HOH HOH A . F 6 HOH 221 1221 1221 HOH HOH A . F 6 HOH 222 1222 1222 HOH HOH A . F 6 HOH 223 1223 1223 HOH HOH A . F 6 HOH 224 1224 1224 HOH HOH A . F 6 HOH 225 1225 1225 HOH HOH A . F 6 HOH 226 1226 1226 HOH HOH A . F 6 HOH 227 1227 1227 HOH HOH A . F 6 HOH 228 1228 1228 HOH HOH A . F 6 HOH 229 1229 1229 HOH HOH A . F 6 HOH 230 1230 1230 HOH HOH A . F 6 HOH 231 1231 1231 HOH HOH A . F 6 HOH 232 1232 1232 HOH HOH A . F 6 HOH 233 1233 1233 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A ASN 145 A ASN 145 ? ASN 'GLYCOSYLATION SITE' 2 A ASN 114 A ASN 114 ? ASN 'GLYCOSYLATION SITE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-09-28 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-03-07 5 'Structure model' 2 0 2020-07-29 6 'Structure model' 2 1 2021-11-03 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 5 'Structure model' Advisory 6 5 'Structure model' 'Atomic model' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' 'Structure summary' 10 6 'Structure model' 'Database references' 11 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_source 2 5 'Structure model' atom_site 3 5 'Structure model' chem_comp 4 5 'Structure model' entity 5 5 'Structure model' pdbx_branch_scheme 6 5 'Structure model' pdbx_chem_comp_identifier 7 5 'Structure model' pdbx_entity_branch 8 5 'Structure model' pdbx_entity_branch_descriptor 9 5 'Structure model' pdbx_entity_branch_link 10 5 'Structure model' pdbx_entity_branch_list 11 5 'Structure model' pdbx_entity_nonpoly 12 5 'Structure model' pdbx_nonpoly_scheme 13 5 'Structure model' pdbx_struct_assembly_gen 14 5 'Structure model' pdbx_validate_close_contact 15 5 'Structure model' struct_asym 16 5 'Structure model' struct_conn 17 5 'Structure model' struct_site 18 5 'Structure model' struct_site_gen 19 6 'Structure model' chem_comp 20 6 'Structure model' database_2 21 6 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 5 'Structure model' '_atom_site.B_iso_or_equiv' 3 5 'Structure model' '_atom_site.Cartn_x' 4 5 'Structure model' '_atom_site.Cartn_y' 5 5 'Structure model' '_atom_site.Cartn_z' 6 5 'Structure model' '_atom_site.auth_asym_id' 7 5 'Structure model' '_atom_site.auth_seq_id' 8 5 'Structure model' '_atom_site.label_asym_id' 9 5 'Structure model' '_atom_site.label_entity_id' 10 5 'Structure model' '_chem_comp.name' 11 5 'Structure model' '_chem_comp.type' 12 5 'Structure model' '_pdbx_entity_nonpoly.entity_id' 13 5 'Structure model' '_pdbx_entity_nonpoly.name' 14 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 15 5 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 16 5 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2' 17 5 'Structure model' '_struct_conn.pdbx_dist_value' 18 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 19 5 'Structure model' '_struct_conn.pdbx_role' 20 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 21 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 28 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 32 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 33 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 34 6 'Structure model' '_chem_comp.pdbx_synonyms' 35 6 'Structure model' '_database_2.pdbx_DOI' 36 6 'Structure model' '_database_2.pdbx_database_accession' 37 6 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 TNT refinement . ? 3 TNT phasing . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 ND2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 145 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O5 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 NAG _pdbx_validate_close_contact.auth_seq_id_2 1 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.14 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 59 ? ? CG A ASP 59 ? ? OD1 A ASP 59 ? ? 123.72 118.30 5.42 0.90 N 2 1 CB A ASP 59 ? ? CG A ASP 59 ? ? OD2 A ASP 59 ? ? 111.95 118.30 -6.35 0.90 N 3 1 CB A ASP 82 ? ? CG A ASP 82 ? ? OD1 A ASP 82 ? ? 124.89 118.30 6.59 0.90 N 4 1 CB A ASP 82 ? ? CG A ASP 82 ? ? OD2 A ASP 82 ? ? 112.08 118.30 -6.22 0.90 N 5 1 CB A ASP 201 ? ? CG A ASP 201 ? ? OD1 A ASP 201 ? ? 111.76 118.30 -6.54 0.90 N 6 1 CB A ASP 214 ? ? CG A ASP 214 ? ? OD2 A ASP 214 ? ? 112.49 118.30 -5.81 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 58 ? ? -125.19 -75.51 2 1 CYS A 154 ? ? -123.54 -156.46 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 44 ? A GLN 44 2 1 Y 1 A SER 45 ? A SER 45 3 1 Y 1 A GLN 46 ? A GLN 46 4 1 Y 1 A ASN 47 ? A ASN 47 5 1 Y 1 A PRO 48 ? A PRO 48 6 1 Y 1 A GLY 49 ? A GLY 49 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 B NAG 411 n B 2 NAG 2 B NAG 2 B NAG 412 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 NAG _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NAG _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 4 'CHLORIDE ION' CL 5 ETHANOL EOH 6 water HOH #