data_1FYW # _entry.id 1FYW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1FYW pdb_00001fyw 10.2210/pdb1fyw/pdb RCSB RCSB012029 ? ? WWPDB D_1000012029 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-11-22 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-31 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Experimental preparation' 6 5 'Structure model' Advisory 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Derived calculations' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' exptl_crystal_grow 2 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 3 4 'Structure model' pdbx_unobs_or_zero_occ_residues 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature 9 5 'Structure model' pdbx_unobs_or_zero_occ_atoms 10 5 'Structure model' pdbx_unobs_or_zero_occ_residues 11 5 'Structure model' struct_conn 12 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_exptl_crystal_grow.pdbx_details' 2 4 'Structure model' '_exptl_crystal_grow.temp' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' 5 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 5 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1FYW _pdbx_database_status.recvd_initial_deposition_date 2000-10-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id HC02 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xu, Y.' 1 'Tao, X.' 2 'Shen, B.' 3 'Horng, T.' 4 'Medzhitov, R.' 5 'Manley, J.L.' 6 'Tong, L.' 7 'Northeast Structural Genomics Consortium (NESG)' 8 # _citation.id primary _citation.title 'Structural basis for signal transduction by the Toll/interleukin-1 receptor domains.' _citation.journal_abbrev Nature _citation.journal_volume 408 _citation.page_first 111 _citation.page_last 115 _citation.year 2000 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11081518 _citation.pdbx_database_id_DOI 10.1038/35047056 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, Y.' 1 ? primary 'Tao, X.' 2 ? primary 'Shen, B.' 3 ? primary 'Horng, T.' 4 ? primary 'Medzhitov, R.' 5 ? primary 'Manley, J.L.' 6 ? primary 'Tong, L.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'TOLL-LIKE RECEPTOR 2' _entity.formula_weight 18455.197 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'TIR DOMAIN' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SRNI(CAS)YDAFVSYSERDAYWVENL(MSE)VQELENFNPPFKL(CAS)LHKRDFIPGKWIIDNIIDSIEKSHKTVFVL SENFVKSEW(CAS)KYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRF(CAS)KLRKI(MSE)NTKTYLEWP(MSE)D EAQREGFWVNLRAAIKS ; _entity_poly.pdbx_seq_one_letter_code_can ;SRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKY ELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HC02 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ARG n 1 3 ASN n 1 4 ILE n 1 5 CAS n 1 6 TYR n 1 7 ASP n 1 8 ALA n 1 9 PHE n 1 10 VAL n 1 11 SER n 1 12 TYR n 1 13 SER n 1 14 GLU n 1 15 ARG n 1 16 ASP n 1 17 ALA n 1 18 TYR n 1 19 TRP n 1 20 VAL n 1 21 GLU n 1 22 ASN n 1 23 LEU n 1 24 MSE n 1 25 VAL n 1 26 GLN n 1 27 GLU n 1 28 LEU n 1 29 GLU n 1 30 ASN n 1 31 PHE n 1 32 ASN n 1 33 PRO n 1 34 PRO n 1 35 PHE n 1 36 LYS n 1 37 LEU n 1 38 CAS n 1 39 LEU n 1 40 HIS n 1 41 LYS n 1 42 ARG n 1 43 ASP n 1 44 PHE n 1 45 ILE n 1 46 PRO n 1 47 GLY n 1 48 LYS n 1 49 TRP n 1 50 ILE n 1 51 ILE n 1 52 ASP n 1 53 ASN n 1 54 ILE n 1 55 ILE n 1 56 ASP n 1 57 SER n 1 58 ILE n 1 59 GLU n 1 60 LYS n 1 61 SER n 1 62 HIS n 1 63 LYS n 1 64 THR n 1 65 VAL n 1 66 PHE n 1 67 VAL n 1 68 LEU n 1 69 SER n 1 70 GLU n 1 71 ASN n 1 72 PHE n 1 73 VAL n 1 74 LYS n 1 75 SER n 1 76 GLU n 1 77 TRP n 1 78 CAS n 1 79 LYS n 1 80 TYR n 1 81 GLU n 1 82 LEU n 1 83 ASP n 1 84 PHE n 1 85 SER n 1 86 HIS n 1 87 PHE n 1 88 ARG n 1 89 LEU n 1 90 PHE n 1 91 ASP n 1 92 GLU n 1 93 ASN n 1 94 ASN n 1 95 ASP n 1 96 ALA n 1 97 ALA n 1 98 ILE n 1 99 LEU n 1 100 ILE n 1 101 LEU n 1 102 LEU n 1 103 GLU n 1 104 PRO n 1 105 ILE n 1 106 GLU n 1 107 LYS n 1 108 LYS n 1 109 ALA n 1 110 ILE n 1 111 PRO n 1 112 GLN n 1 113 ARG n 1 114 PHE n 1 115 CAS n 1 116 LYS n 1 117 LEU n 1 118 ARG n 1 119 LYS n 1 120 ILE n 1 121 MSE n 1 122 ASN n 1 123 THR n 1 124 LYS n 1 125 THR n 1 126 TYR n 1 127 LEU n 1 128 GLU n 1 129 TRP n 1 130 PRO n 1 131 MSE n 1 132 ASP n 1 133 GLU n 1 134 ALA n 1 135 GLN n 1 136 ARG n 1 137 GLU n 1 138 GLY n 1 139 PHE n 1 140 TRP n 1 141 VAL n 1 142 ASN n 1 143 LEU n 1 144 ARG n 1 145 ALA n 1 146 ALA n 1 147 ILE n 1 148 LYS n 1 149 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CAS 'L-peptide linking' n 'S-(DIMETHYLARSENIC)CYSTEINE' ? 'C5 H12 As N O2 S' 225.141 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 636 636 SER SER A . n A 1 2 ARG 2 637 637 ARG ARG A . n A 1 3 ASN 3 638 638 ASN ASN A . n A 1 4 ILE 4 639 639 ILE ILE A . n A 1 5 CAS 5 640 640 CAS CAS A . n A 1 6 TYR 6 641 641 TYR TYR A . n A 1 7 ASP 7 642 642 ASP ASP A . n A 1 8 ALA 8 643 643 ALA ALA A . n A 1 9 PHE 9 644 644 PHE PHE A . n A 1 10 VAL 10 645 645 VAL VAL A . n A 1 11 SER 11 646 646 SER SER A . n A 1 12 TYR 12 647 647 TYR TYR A . n A 1 13 SER 13 648 648 SER SER A . n A 1 14 GLU 14 649 649 GLU GLU A . n A 1 15 ARG 15 650 650 ARG ARG A . n A 1 16 ASP 16 651 651 ASP ASP A . n A 1 17 ALA 17 652 652 ALA ALA A . n A 1 18 TYR 18 653 653 TYR TYR A . n A 1 19 TRP 19 654 654 TRP TRP A . n A 1 20 VAL 20 655 655 VAL VAL A . n A 1 21 GLU 21 656 656 GLU GLU A . n A 1 22 ASN 22 657 657 ASN ASN A . n A 1 23 LEU 23 658 658 LEU LEU A . n A 1 24 MSE 24 659 659 MSE MSE A . n A 1 25 VAL 25 660 660 VAL VAL A . n A 1 26 GLN 26 661 661 GLN GLN A . n A 1 27 GLU 27 662 662 GLU GLU A . n A 1 28 LEU 28 663 663 LEU LEU A . n A 1 29 GLU 29 664 664 GLU GLU A . n A 1 30 ASN 30 665 665 ASN ASN A . n A 1 31 PHE 31 666 666 PHE PHE A . n A 1 32 ASN 32 667 667 ASN ASN A . n A 1 33 PRO 33 668 668 PRO PRO A . n A 1 34 PRO 34 669 669 PRO PRO A . n A 1 35 PHE 35 670 670 PHE PHE A . n A 1 36 LYS 36 671 671 LYS LYS A . n A 1 37 LEU 37 672 672 LEU LEU A . n A 1 38 CAS 38 673 673 CAS CAS A . n A 1 39 LEU 39 674 674 LEU LEU A . n A 1 40 HIS 40 675 675 HIS HIS A . n A 1 41 LYS 41 676 676 LYS LYS A . n A 1 42 ARG 42 677 677 ARG ARG A . n A 1 43 ASP 43 678 678 ASP ASP A . n A 1 44 PHE 44 679 679 PHE PHE A . n A 1 45 ILE 45 680 680 ILE ILE A . n A 1 46 PRO 46 681 681 PRO PRO A . n A 1 47 GLY 47 682 682 GLY GLY A . n A 1 48 LYS 48 683 683 LYS LYS A . n A 1 49 TRP 49 684 684 TRP TRP A . n A 1 50 ILE 50 685 685 ILE ILE A . n A 1 51 ILE 51 686 686 ILE ILE A . n A 1 52 ASP 52 687 687 ASP ASP A . n A 1 53 ASN 53 688 688 ASN ASN A . n A 1 54 ILE 54 689 689 ILE ILE A . n A 1 55 ILE 55 690 690 ILE ILE A . n A 1 56 ASP 56 691 691 ASP ASP A . n A 1 57 SER 57 692 692 SER SER A . n A 1 58 ILE 58 693 693 ILE ILE A . n A 1 59 GLU 59 694 694 GLU GLU A . n A 1 60 LYS 60 695 695 LYS LYS A . n A 1 61 SER 61 696 696 SER SER A . n A 1 62 HIS 62 697 697 HIS HIS A . n A 1 63 LYS 63 698 698 LYS LYS A . n A 1 64 THR 64 699 699 THR THR A . n A 1 65 VAL 65 700 700 VAL VAL A . n A 1 66 PHE 66 701 701 PHE PHE A . n A 1 67 VAL 67 702 702 VAL VAL A . n A 1 68 LEU 68 703 703 LEU LEU A . n A 1 69 SER 69 704 704 SER SER A . n A 1 70 GLU 70 705 705 GLU GLU A . n A 1 71 ASN 71 706 706 ASN ASN A . n A 1 72 PHE 72 707 707 PHE PHE A . n A 1 73 VAL 73 708 708 VAL VAL A . n A 1 74 LYS 74 709 709 LYS LYS A . n A 1 75 SER 75 710 710 SER SER A . n A 1 76 GLU 76 711 711 GLU GLU A . n A 1 77 TRP 77 712 712 TRP TRP A . n A 1 78 CAS 78 713 713 CAS CAS A . n A 1 79 LYS 79 714 714 LYS LYS A . n A 1 80 TYR 80 715 715 TYR TYR A . n A 1 81 GLU 81 716 716 GLU GLU A . n A 1 82 LEU 82 717 717 LEU LEU A . n A 1 83 ASP 83 718 718 ASP ASP A . n A 1 84 PHE 84 719 719 PHE PHE A . n A 1 85 SER 85 720 720 SER SER A . n A 1 86 HIS 86 721 721 HIS HIS A . n A 1 87 PHE 87 722 722 PHE PHE A . n A 1 88 ARG 88 723 723 ARG ARG A . n A 1 89 LEU 89 724 724 LEU LEU A . n A 1 90 PHE 90 725 725 PHE PHE A . n A 1 91 ASP 91 726 726 ASP ASP A . n A 1 92 GLU 92 727 727 GLU GLU A . n A 1 93 ASN 93 728 728 ASN ASN A . n A 1 94 ASN 94 729 729 ASN ASN A . n A 1 95 ASP 95 730 730 ASP ASP A . n A 1 96 ALA 96 731 731 ALA ALA A . n A 1 97 ALA 97 732 732 ALA ALA A . n A 1 98 ILE 98 733 733 ILE ILE A . n A 1 99 LEU 99 734 734 LEU LEU A . n A 1 100 ILE 100 735 735 ILE ILE A . n A 1 101 LEU 101 736 736 LEU LEU A . n A 1 102 LEU 102 737 737 LEU LEU A . n A 1 103 GLU 103 738 738 GLU GLU A . n A 1 104 PRO 104 739 739 PRO PRO A . n A 1 105 ILE 105 740 740 ILE ILE A . n A 1 106 GLU 106 741 741 GLU GLU A . n A 1 107 LYS 107 742 742 LYS LYS A . n A 1 108 LYS 108 743 743 LYS LYS A . n A 1 109 ALA 109 744 744 ALA ALA A . n A 1 110 ILE 110 745 745 ILE ILE A . n A 1 111 PRO 111 746 746 PRO PRO A . n A 1 112 GLN 112 747 747 GLN GLN A . n A 1 113 ARG 113 748 748 ARG ARG A . n A 1 114 PHE 114 749 749 PHE PHE A . n A 1 115 CAS 115 750 750 CAS CAS A . n A 1 116 LYS 116 751 751 LYS LYS A . n A 1 117 LEU 117 752 752 LEU LEU A . n A 1 118 ARG 118 753 753 ARG ARG A . n A 1 119 LYS 119 754 754 LYS LYS A . n A 1 120 ILE 120 755 755 ILE ILE A . n A 1 121 MSE 121 756 756 MSE MSE A . n A 1 122 ASN 122 757 757 ASN ASN A . n A 1 123 THR 123 758 758 THR THR A . n A 1 124 LYS 124 759 759 LYS LYS A . n A 1 125 THR 125 760 760 THR THR A . n A 1 126 TYR 126 761 761 TYR TYR A . n A 1 127 LEU 127 762 762 LEU LEU A . n A 1 128 GLU 128 763 763 GLU GLU A . n A 1 129 TRP 129 764 764 TRP TRP A . n A 1 130 PRO 130 765 765 PRO PRO A . n A 1 131 MSE 131 766 766 MSE MSE A . n A 1 132 ASP 132 767 767 ASP ASP A . n A 1 133 GLU 133 768 768 GLU GLU A . n A 1 134 ALA 134 769 769 ALA ALA A . n A 1 135 GLN 135 770 770 GLN GLN A . n A 1 136 ARG 136 771 771 ARG ARG A . n A 1 137 GLU 137 772 772 GLU GLU A . n A 1 138 GLY 138 773 773 GLY GLY A . n A 1 139 PHE 139 774 774 PHE PHE A . n A 1 140 TRP 140 775 775 TRP TRP A . n A 1 141 VAL 141 776 776 VAL VAL A . n A 1 142 ASN 142 777 777 ASN ASN A . n A 1 143 LEU 143 778 778 LEU LEU A . n A 1 144 ARG 144 779 779 ARG ARG A . n A 1 145 ALA 145 780 780 ALA ALA A . n A 1 146 ALA 146 781 781 ALA ALA A . n A 1 147 ILE 147 782 782 ILE ILE A . n A 1 148 LYS 148 783 783 LYS LYS A . n A 1 149 SER 149 784 784 SER SER A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A ARG 637 ? NE ? A ARG 2 NE 2 1 Y 0 A ARG 637 ? CZ ? A ARG 2 CZ 3 1 Y 0 A ARG 637 ? NH1 ? A ARG 2 NH1 4 1 Y 0 A ARG 637 ? NH2 ? A ARG 2 NH2 5 1 Y 1 A CAS 640 ? CE1 ? A CAS 5 CE1 6 1 Y 1 A CAS 640 ? CE2 ? A CAS 5 CE2 7 1 Y 0 A GLU 649 ? CG ? A GLU 14 CG 8 1 Y 0 A GLU 649 ? CD ? A GLU 14 CD 9 1 Y 0 A GLU 649 ? OE1 ? A GLU 14 OE1 10 1 Y 0 A GLU 649 ? OE2 ? A GLU 14 OE2 11 1 Y 0 A GLN 661 ? CG ? A GLN 26 CG 12 1 Y 0 A GLN 661 ? CD ? A GLN 26 CD 13 1 Y 0 A GLN 661 ? OE1 ? A GLN 26 OE1 14 1 Y 0 A GLN 661 ? NE2 ? A GLN 26 NE2 15 1 Y 0 A LYS 671 ? CG ? A LYS 36 CG 16 1 Y 0 A LYS 671 ? CD ? A LYS 36 CD 17 1 Y 0 A LYS 671 ? CE ? A LYS 36 CE 18 1 Y 0 A LYS 671 ? NZ ? A LYS 36 NZ 19 1 Y 1 A CAS 673 ? CE1 ? A CAS 38 CE1 20 1 Y 1 A CAS 673 ? CE2 ? A CAS 38 CE2 21 1 Y 0 A LYS 683 ? CG ? A LYS 48 CG 22 1 Y 0 A LYS 683 ? CD ? A LYS 48 CD 23 1 Y 0 A LYS 683 ? CE ? A LYS 48 CE 24 1 Y 0 A LYS 683 ? NZ ? A LYS 48 NZ 25 1 Y 0 A LYS 695 ? CG ? A LYS 60 CG 26 1 Y 0 A LYS 695 ? CD ? A LYS 60 CD 27 1 Y 0 A LYS 695 ? CE ? A LYS 60 CE 28 1 Y 0 A LYS 695 ? NZ ? A LYS 60 NZ 29 1 Y 0 A LYS 709 ? CD ? A LYS 74 CD 30 1 Y 0 A LYS 709 ? CE ? A LYS 74 CE 31 1 Y 0 A LYS 709 ? NZ ? A LYS 74 NZ 32 1 Y 1 A CAS 713 ? CE1 ? A CAS 78 CE1 33 1 Y 1 A CAS 713 ? CE2 ? A CAS 78 CE2 34 1 Y 0 A ASP 726 ? CG ? A ASP 91 CG 35 1 Y 0 A ASP 726 ? OD1 ? A ASP 91 OD1 36 1 Y 0 A ASP 726 ? OD2 ? A ASP 91 OD2 37 1 Y 0 A ASN 728 ? CG ? A ASN 93 CG 38 1 Y 0 A ASN 728 ? OD1 ? A ASN 93 OD1 39 1 Y 0 A ASN 728 ? ND2 ? A ASN 93 ND2 40 1 Y 0 A LYS 743 ? CG ? A LYS 108 CG 41 1 Y 0 A LYS 743 ? CD ? A LYS 108 CD 42 1 Y 0 A LYS 743 ? CE ? A LYS 108 CE 43 1 Y 0 A LYS 743 ? NZ ? A LYS 108 NZ 44 1 Y 0 A ARG 748 ? CG ? A ARG 113 CG 45 1 Y 0 A ARG 748 ? CD ? A ARG 113 CD 46 1 Y 0 A ARG 748 ? NE ? A ARG 113 NE 47 1 Y 0 A ARG 748 ? CZ ? A ARG 113 CZ 48 1 Y 0 A ARG 748 ? NH1 ? A ARG 113 NH1 49 1 Y 0 A ARG 748 ? NH2 ? A ARG 113 NH2 50 1 Y 1 A CAS 750 ? CE1 ? A CAS 115 CE1 51 1 Y 1 A CAS 750 ? CE2 ? A CAS 115 CE2 52 1 Y 0 A LYS 754 ? CD ? A LYS 119 CD 53 1 Y 0 A LYS 754 ? CE ? A LYS 119 CE 54 1 Y 0 A LYS 754 ? NZ ? A LYS 119 NZ 55 1 Y 0 A LYS 783 ? CD ? A LYS 148 CD 56 1 Y 0 A LYS 783 ? CE ? A LYS 148 CE 57 1 Y 0 A LYS 783 ? NZ ? A LYS 148 NZ # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal COMO phasing '+ MADSYS' ? 1 CNS refinement . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 MADSYS phasing . ? 5 # _cell.entry_id 1FYW _cell.length_a 121.2 _cell.length_b 121.2 _cell.length_c 91.6 _cell.angle_alpha 90 _cell.angle_beta 90 _cell.angle_gamma 120 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1FYW _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 # _exptl.entry_id 1FYW _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 76.62 _exptl_crystal.density_Matthews 5.26 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 6.8 _exptl_crystal_grow.temp 277.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details ;100 mM cacodylate, 10 % PEG 8000, 20 % DMSO, 200 mM MgCl2, 5 mM DTT, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 4K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 2000-03-16 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 32-ID' _diffrn_source.pdbx_wavelength 0.98 _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 32-ID _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1FYW _reflns.observed_criterion_sigma_I 1 _reflns.observed_criterion_sigma_F 0.5 _reflns.d_resolution_low 40 _reflns.d_resolution_high 3.0 _reflns.number_obs 7380 _reflns.number_all 7500 _reflns.percent_possible_obs 99 _reflns.pdbx_Rmerge_I_obs 0.0550000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 32 _reflns.B_iso_Wilson_estimate 35 _reflns.pdbx_redundancy 7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3.0 _reflns_shell.d_res_low 3.11 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 97 _reflns_shell.Rmerge_I_obs 0.2390000 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 4 _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1FYW _refine.ls_number_reflns_obs 7451 _refine.ls_number_reflns_all 7500 _refine.pdbx_ls_sigma_I 2 _refine.pdbx_ls_sigma_F 1 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 20 _refine.ls_d_res_high 3.0 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.2440000 _refine.ls_R_factor_all 0.2600000 _refine.ls_R_factor_R_work 0.2440000 _refine.ls_R_factor_R_free 0.2740000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 550 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 7.5% _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1266 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1266 _refine_hist.d_res_high 3.0 _refine_hist.d_res_low 20 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? # _database_PDB_matrix.entry_id 1FYW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1FYW _struct.title 'CRYSTAL STRUCTURE OF THE TIR DOMAIN OF HUMAN TLR2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1FYW _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;beta-alpha-beta fold parallel beta sheet, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_code TLR2_HUMAN _struct_ref.db_name UNP _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession O60603 _struct_ref.pdbx_align_begin 636 _struct_ref.pdbx_seq_one_letter_code ;SRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKY ELDFSHFRLFEENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1FYW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 149 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O60603 _struct_ref_seq.db_align_beg 636 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 784 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 636 _struct_ref_seq.pdbx_auth_seq_align_end 784 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1FYW CAS A 5 ? UNP O60603 CYS 640 'modified residue' 640 1 1 1FYW MSE A 24 ? UNP O60603 MET 659 'modified residue' 659 2 1 1FYW CAS A 38 ? UNP O60603 CYS 673 'modified residue' 673 3 1 1FYW CAS A 78 ? UNP O60603 CYS 713 'modified residue' 713 4 1 1FYW ASP A 91 ? UNP O60603 GLU 726 'modified residue' 726 5 1 1FYW CAS A 115 ? UNP O60603 CYS 750 'modified residue' 750 6 1 1FYW MSE A 121 ? UNP O60603 MET 756 'modified residue' 756 7 1 1FYW MSE A 131 ? UNP O60603 MET 766 'modified residue' 766 8 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 software_defined_assembly PISA,PQS dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 2190 ? 2 MORE -21 ? 2 'SSA (A^2)' 17130 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A 2 1,2 A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_675 -x+1,-y+2,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 209.9245578773 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 16 ? ASN A 22 ? ASP A 651 ASN A 657 1 ? 7 HELX_P HELX_P2 2 ASN A 22 ? GLU A 29 ? ASN A 657 GLU A 664 1 ? 8 HELX_P HELX_P3 3 TRP A 49 ? SER A 61 ? TRP A 684 SER A 696 1 ? 13 HELX_P HELX_P4 4 SER A 69 ? TRP A 77 ? SER A 704 TRP A 712 1 ? 9 HELX_P HELX_P5 5 PHE A 90 ? ASN A 94 ? PHE A 725 ASN A 729 5 ? 5 HELX_P HELX_P6 6 GLU A 106 ? ILE A 110 ? GLU A 741 ILE A 745 5 ? 5 HELX_P HELX_P7 7 LYS A 116 ? LYS A 124 ? LYS A 751 LYS A 759 1 ? 9 HELX_P HELX_P8 8 ASP A 132 ? ALA A 134 ? ASP A 767 ALA A 769 5 ? 3 HELX_P HELX_P9 9 GLN A 135 ? LYS A 148 ? GLN A 770 LYS A 783 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ILE 4 C ? ? ? 1_555 A CAS 5 N ? ? A ILE 639 A CAS 640 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A CAS 5 C ? ? ? 1_555 A TYR 6 N ? ? A CAS 640 A TYR 641 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale3 covale both ? A LEU 23 C ? ? ? 1_555 A MSE 24 N ? ? A LEU 658 A MSE 659 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale4 covale both ? A MSE 24 C ? ? ? 1_555 A VAL 25 N ? ? A MSE 659 A VAL 660 1_555 ? ? ? ? ? ? ? 1.315 ? ? covale5 covale both ? A LEU 37 C ? ? ? 1_555 A CAS 38 N ? ? A LEU 672 A CAS 673 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A CAS 38 C ? ? ? 1_555 A LEU 39 N ? ? A CAS 673 A LEU 674 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale7 covale both ? A TRP 77 C ? ? ? 1_555 A CAS 78 N ? ? A TRP 712 A CAS 713 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale8 covale both ? A CAS 78 C ? ? ? 1_555 A LYS 79 N ? ? A CAS 713 A LYS 714 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale9 covale both ? A PHE 114 C ? ? ? 1_555 A CAS 115 N ? ? A PHE 749 A CAS 750 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale10 covale both ? A CAS 115 C ? ? ? 1_555 A LYS 116 N ? ? A CAS 750 A LYS 751 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale11 covale both ? A ILE 120 C ? ? ? 1_555 A MSE 121 N ? ? A ILE 755 A MSE 756 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale12 covale both ? A MSE 121 C ? ? ? 1_555 A ASN 122 N ? ? A MSE 756 A ASN 757 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale13 covale both ? A PRO 130 C ? ? ? 1_555 A MSE 131 N ? ? A PRO 765 A MSE 766 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale14 covale both ? A MSE 131 C ? ? ? 1_555 A ASP 132 N ? ? A MSE 766 A ASP 767 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 24 ? . . . . MSE A 659 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 121 ? . . . . MSE A 756 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 131 ? . . . . MSE A 766 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 CAS A 5 ? . . . . CAS A 640 ? 1_555 . . . . . . . CYS 1 CAS None 'Non-standard residue' 5 CAS A 38 ? . . . . CAS A 673 ? 1_555 . . . . . . . CYS 1 CAS None 'Non-standard residue' 6 CAS A 78 ? . . . . CAS A 713 ? 1_555 . . . . . . . CYS 1 CAS None 'Non-standard residue' 7 CAS A 115 ? . . . . CAS A 750 ? 1_555 . . . . . . . CYS 1 CAS None 'Non-standard residue' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 32 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 667 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 33 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 668 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.04 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 8 ? SER A 11 ? ALA A 643 SER A 646 A 2 LYS A 63 ? LEU A 68 ? LYS A 698 LEU A 703 A 3 ILE A 98 ? LEU A 101 ? ILE A 733 LEU A 736 A 4 LEU A 127 ? GLU A 128 ? LEU A 762 GLU A 763 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 9 ? N PHE A 644 O LYS A 63 ? O LYS A 698 A 2 3 O THR A 64 ? O THR A 699 N ILE A 98 ? N ILE A 733 A 3 4 N LEU A 101 ? N LEU A 736 O LEU A 127 ? O LEU A 762 # _pdbx_entry_details.entry_id 1FYW _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 638 ? ? -167.46 34.14 2 1 ILE A 639 ? ? -88.18 47.82 3 1 ASN A 657 ? ? -125.67 -76.78 4 1 LEU A 663 ? ? -124.96 -58.13 5 1 LYS A 676 ? ? -105.90 40.18 6 1 ARG A 677 ? ? -151.47 -24.24 7 1 LYS A 683 ? ? -32.41 148.15 8 1 ILE A 685 ? ? -65.88 -79.87 9 1 ILE A 689 ? ? -52.57 -78.25 10 1 GLU A 716 ? ? -71.95 -75.10 11 1 SER A 720 ? ? -2.82 74.57 12 1 PHE A 725 ? ? 67.91 137.92 13 1 ASP A 726 ? ? -50.23 -9.94 14 1 ASP A 730 ? ? 71.36 -28.45 15 1 ALA A 731 ? ? 77.03 171.00 16 1 GLU A 741 ? ? -62.98 99.93 17 1 PRO A 746 ? ? -6.51 -107.08 18 1 GLN A 747 ? ? 162.88 -27.59 19 1 LYS A 759 ? ? 35.37 56.29 20 1 TYR A 761 ? ? 164.32 154.90 21 1 TRP A 764 ? ? -54.55 106.24 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CAS 5 A CAS 640 ? CYS 'S-(DIMETHYLARSENIC)CYSTEINE' 2 A MSE 24 A MSE 659 ? MET SELENOMETHIONINE 3 A CAS 38 A CAS 673 ? CYS 'S-(DIMETHYLARSENIC)CYSTEINE' 4 A CAS 78 A CAS 713 ? CYS 'S-(DIMETHYLARSENIC)CYSTEINE' 5 A CAS 115 A CAS 750 ? CYS 'S-(DIMETHYLARSENIC)CYSTEINE' 6 A MSE 121 A MSE 756 ? MET SELENOMETHIONINE 7 A MSE 131 A MSE 766 ? MET SELENOMETHIONINE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 0 A ARG 723 ? A ARG 88 2 1 Y 0 A LEU 724 ? A LEU 89 3 1 Y 0 A PHE 725 ? A PHE 90 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CAS N N N N 74 CAS CA C N R 75 CAS CB C N N 76 CAS C C N N 77 CAS O O N N 78 CAS OXT O N N 79 CAS SG S N N 80 CAS AS AS N N 81 CAS CE1 C N N 82 CAS CE2 C N N 83 CAS H H N N 84 CAS H2 H N N 85 CAS HA H N N 86 CAS HB2 H N N 87 CAS HB3 H N N 88 CAS HXT H N N 89 CAS HE11 H N N 90 CAS HE12 H N N 91 CAS HE13 H N N 92 CAS HE21 H N N 93 CAS HE22 H N N 94 CAS HE23 H N N 95 CYS N N N N 96 CYS CA C N R 97 CYS C C N N 98 CYS O O N N 99 CYS CB C N N 100 CYS SG S N N 101 CYS OXT O N N 102 CYS H H N N 103 CYS H2 H N N 104 CYS HA H N N 105 CYS HB2 H N N 106 CYS HB3 H N N 107 CYS HG H N N 108 CYS HXT H N N 109 GLN N N N N 110 GLN CA C N S 111 GLN C C N N 112 GLN O O N N 113 GLN CB C N N 114 GLN CG C N N 115 GLN CD C N N 116 GLN OE1 O N N 117 GLN NE2 N N N 118 GLN OXT O N N 119 GLN H H N N 120 GLN H2 H N N 121 GLN HA H N N 122 GLN HB2 H N N 123 GLN HB3 H N N 124 GLN HG2 H N N 125 GLN HG3 H N N 126 GLN HE21 H N N 127 GLN HE22 H N N 128 GLN HXT H N N 129 GLU N N N N 130 GLU CA C N S 131 GLU C C N N 132 GLU O O N N 133 GLU CB C N N 134 GLU CG C N N 135 GLU CD C N N 136 GLU OE1 O N N 137 GLU OE2 O N N 138 GLU OXT O N N 139 GLU H H N N 140 GLU H2 H N N 141 GLU HA H N N 142 GLU HB2 H N N 143 GLU HB3 H N N 144 GLU HG2 H N N 145 GLU HG3 H N N 146 GLU HE2 H N N 147 GLU HXT H N N 148 GLY N N N N 149 GLY CA C N N 150 GLY C C N N 151 GLY O O N N 152 GLY OXT O N N 153 GLY H H N N 154 GLY H2 H N N 155 GLY HA2 H N N 156 GLY HA3 H N N 157 GLY HXT H N N 158 HIS N N N N 159 HIS CA C N S 160 HIS C C N N 161 HIS O O N N 162 HIS CB C N N 163 HIS CG C Y N 164 HIS ND1 N Y N 165 HIS CD2 C Y N 166 HIS CE1 C Y N 167 HIS NE2 N Y N 168 HIS OXT O N N 169 HIS H H N N 170 HIS H2 H N N 171 HIS HA H N N 172 HIS HB2 H N N 173 HIS HB3 H N N 174 HIS HD1 H N N 175 HIS HD2 H N N 176 HIS HE1 H N N 177 HIS HE2 H N N 178 HIS HXT H N N 179 ILE N N N N 180 ILE CA C N S 181 ILE C C N N 182 ILE O O N N 183 ILE CB C N S 184 ILE CG1 C N N 185 ILE CG2 C N N 186 ILE CD1 C N N 187 ILE OXT O N N 188 ILE H H N N 189 ILE H2 H N N 190 ILE HA H N N 191 ILE HB H N N 192 ILE HG12 H N N 193 ILE HG13 H N N 194 ILE HG21 H N N 195 ILE HG22 H N N 196 ILE HG23 H N N 197 ILE HD11 H N N 198 ILE HD12 H N N 199 ILE HD13 H N N 200 ILE HXT H N N 201 LEU N N N N 202 LEU CA C N S 203 LEU C C N N 204 LEU O O N N 205 LEU CB C N N 206 LEU CG C N N 207 LEU CD1 C N N 208 LEU CD2 C N N 209 LEU OXT O N N 210 LEU H H N N 211 LEU H2 H N N 212 LEU HA H N N 213 LEU HB2 H N N 214 LEU HB3 H N N 215 LEU HG H N N 216 LEU HD11 H N N 217 LEU HD12 H N N 218 LEU HD13 H N N 219 LEU HD21 H N N 220 LEU HD22 H N N 221 LEU HD23 H N N 222 LEU HXT H N N 223 LYS N N N N 224 LYS CA C N S 225 LYS C C N N 226 LYS O O N N 227 LYS CB C N N 228 LYS CG C N N 229 LYS CD C N N 230 LYS CE C N N 231 LYS NZ N N N 232 LYS OXT O N N 233 LYS H H N N 234 LYS H2 H N N 235 LYS HA H N N 236 LYS HB2 H N N 237 LYS HB3 H N N 238 LYS HG2 H N N 239 LYS HG3 H N N 240 LYS HD2 H N N 241 LYS HD3 H N N 242 LYS HE2 H N N 243 LYS HE3 H N N 244 LYS HZ1 H N N 245 LYS HZ2 H N N 246 LYS HZ3 H N N 247 LYS HXT H N N 248 MET N N N N 249 MET CA C N S 250 MET C C N N 251 MET O O N N 252 MET CB C N N 253 MET CG C N N 254 MET SD S N N 255 MET CE C N N 256 MET OXT O N N 257 MET H H N N 258 MET H2 H N N 259 MET HA H N N 260 MET HB2 H N N 261 MET HB3 H N N 262 MET HG2 H N N 263 MET HG3 H N N 264 MET HE1 H N N 265 MET HE2 H N N 266 MET HE3 H N N 267 MET HXT H N N 268 MSE N N N N 269 MSE CA C N S 270 MSE C C N N 271 MSE O O N N 272 MSE OXT O N N 273 MSE CB C N N 274 MSE CG C N N 275 MSE SE SE N N 276 MSE CE C N N 277 MSE H H N N 278 MSE H2 H N N 279 MSE HA H N N 280 MSE HXT H N N 281 MSE HB2 H N N 282 MSE HB3 H N N 283 MSE HG2 H N N 284 MSE HG3 H N N 285 MSE HE1 H N N 286 MSE HE2 H N N 287 MSE HE3 H N N 288 PHE N N N N 289 PHE CA C N S 290 PHE C C N N 291 PHE O O N N 292 PHE CB C N N 293 PHE CG C Y N 294 PHE CD1 C Y N 295 PHE CD2 C Y N 296 PHE CE1 C Y N 297 PHE CE2 C Y N 298 PHE CZ C Y N 299 PHE OXT O N N 300 PHE H H N N 301 PHE H2 H N N 302 PHE HA H N N 303 PHE HB2 H N N 304 PHE HB3 H N N 305 PHE HD1 H N N 306 PHE HD2 H N N 307 PHE HE1 H N N 308 PHE HE2 H N N 309 PHE HZ H N N 310 PHE HXT H N N 311 PRO N N N N 312 PRO CA C N S 313 PRO C C N N 314 PRO O O N N 315 PRO CB C N N 316 PRO CG C N N 317 PRO CD C N N 318 PRO OXT O N N 319 PRO H H N N 320 PRO HA H N N 321 PRO HB2 H N N 322 PRO HB3 H N N 323 PRO HG2 H N N 324 PRO HG3 H N N 325 PRO HD2 H N N 326 PRO HD3 H N N 327 PRO HXT H N N 328 SER N N N N 329 SER CA C N S 330 SER C C N N 331 SER O O N N 332 SER CB C N N 333 SER OG O N N 334 SER OXT O N N 335 SER H H N N 336 SER H2 H N N 337 SER HA H N N 338 SER HB2 H N N 339 SER HB3 H N N 340 SER HG H N N 341 SER HXT H N N 342 THR N N N N 343 THR CA C N S 344 THR C C N N 345 THR O O N N 346 THR CB C N R 347 THR OG1 O N N 348 THR CG2 C N N 349 THR OXT O N N 350 THR H H N N 351 THR H2 H N N 352 THR HA H N N 353 THR HB H N N 354 THR HG1 H N N 355 THR HG21 H N N 356 THR HG22 H N N 357 THR HG23 H N N 358 THR HXT H N N 359 TRP N N N N 360 TRP CA C N S 361 TRP C C N N 362 TRP O O N N 363 TRP CB C N N 364 TRP CG C Y N 365 TRP CD1 C Y N 366 TRP CD2 C Y N 367 TRP NE1 N Y N 368 TRP CE2 C Y N 369 TRP CE3 C Y N 370 TRP CZ2 C Y N 371 TRP CZ3 C Y N 372 TRP CH2 C Y N 373 TRP OXT O N N 374 TRP H H N N 375 TRP H2 H N N 376 TRP HA H N N 377 TRP HB2 H N N 378 TRP HB3 H N N 379 TRP HD1 H N N 380 TRP HE1 H N N 381 TRP HE3 H N N 382 TRP HZ2 H N N 383 TRP HZ3 H N N 384 TRP HH2 H N N 385 TRP HXT H N N 386 TYR N N N N 387 TYR CA C N S 388 TYR C C N N 389 TYR O O N N 390 TYR CB C N N 391 TYR CG C Y N 392 TYR CD1 C Y N 393 TYR CD2 C Y N 394 TYR CE1 C Y N 395 TYR CE2 C Y N 396 TYR CZ C Y N 397 TYR OH O N N 398 TYR OXT O N N 399 TYR H H N N 400 TYR H2 H N N 401 TYR HA H N N 402 TYR HB2 H N N 403 TYR HB3 H N N 404 TYR HD1 H N N 405 TYR HD2 H N N 406 TYR HE1 H N N 407 TYR HE2 H N N 408 TYR HH H N N 409 TYR HXT H N N 410 VAL N N N N 411 VAL CA C N S 412 VAL C C N N 413 VAL O O N N 414 VAL CB C N N 415 VAL CG1 C N N 416 VAL CG2 C N N 417 VAL OXT O N N 418 VAL H H N N 419 VAL H2 H N N 420 VAL HA H N N 421 VAL HB H N N 422 VAL HG11 H N N 423 VAL HG12 H N N 424 VAL HG13 H N N 425 VAL HG21 H N N 426 VAL HG22 H N N 427 VAL HG23 H N N 428 VAL HXT H N N 429 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CAS N CA sing N N 70 CAS N H sing N N 71 CAS N H2 sing N N 72 CAS CA CB sing N N 73 CAS CA C sing N N 74 CAS CA HA sing N N 75 CAS CB SG sing N N 76 CAS CB HB2 sing N N 77 CAS CB HB3 sing N N 78 CAS C O doub N N 79 CAS C OXT sing N N 80 CAS OXT HXT sing N N 81 CAS SG AS sing N N 82 CAS AS CE1 sing N N 83 CAS AS CE2 sing N N 84 CAS CE1 HE11 sing N N 85 CAS CE1 HE12 sing N N 86 CAS CE1 HE13 sing N N 87 CAS CE2 HE21 sing N N 88 CAS CE2 HE22 sing N N 89 CAS CE2 HE23 sing N N 90 CYS N CA sing N N 91 CYS N H sing N N 92 CYS N H2 sing N N 93 CYS CA C sing N N 94 CYS CA CB sing N N 95 CYS CA HA sing N N 96 CYS C O doub N N 97 CYS C OXT sing N N 98 CYS CB SG sing N N 99 CYS CB HB2 sing N N 100 CYS CB HB3 sing N N 101 CYS SG HG sing N N 102 CYS OXT HXT sing N N 103 GLN N CA sing N N 104 GLN N H sing N N 105 GLN N H2 sing N N 106 GLN CA C sing N N 107 GLN CA CB sing N N 108 GLN CA HA sing N N 109 GLN C O doub N N 110 GLN C OXT sing N N 111 GLN CB CG sing N N 112 GLN CB HB2 sing N N 113 GLN CB HB3 sing N N 114 GLN CG CD sing N N 115 GLN CG HG2 sing N N 116 GLN CG HG3 sing N N 117 GLN CD OE1 doub N N 118 GLN CD NE2 sing N N 119 GLN NE2 HE21 sing N N 120 GLN NE2 HE22 sing N N 121 GLN OXT HXT sing N N 122 GLU N CA sing N N 123 GLU N H sing N N 124 GLU N H2 sing N N 125 GLU CA C sing N N 126 GLU CA CB sing N N 127 GLU CA HA sing N N 128 GLU C O doub N N 129 GLU C OXT sing N N 130 GLU CB CG sing N N 131 GLU CB HB2 sing N N 132 GLU CB HB3 sing N N 133 GLU CG CD sing N N 134 GLU CG HG2 sing N N 135 GLU CG HG3 sing N N 136 GLU CD OE1 doub N N 137 GLU CD OE2 sing N N 138 GLU OE2 HE2 sing N N 139 GLU OXT HXT sing N N 140 GLY N CA sing N N 141 GLY N H sing N N 142 GLY N H2 sing N N 143 GLY CA C sing N N 144 GLY CA HA2 sing N N 145 GLY CA HA3 sing N N 146 GLY C O doub N N 147 GLY C OXT sing N N 148 GLY OXT HXT sing N N 149 HIS N CA sing N N 150 HIS N H sing N N 151 HIS N H2 sing N N 152 HIS CA C sing N N 153 HIS CA CB sing N N 154 HIS CA HA sing N N 155 HIS C O doub N N 156 HIS C OXT sing N N 157 HIS CB CG sing N N 158 HIS CB HB2 sing N N 159 HIS CB HB3 sing N N 160 HIS CG ND1 sing Y N 161 HIS CG CD2 doub Y N 162 HIS ND1 CE1 doub Y N 163 HIS ND1 HD1 sing N N 164 HIS CD2 NE2 sing Y N 165 HIS CD2 HD2 sing N N 166 HIS CE1 NE2 sing Y N 167 HIS CE1 HE1 sing N N 168 HIS NE2 HE2 sing N N 169 HIS OXT HXT sing N N 170 ILE N CA sing N N 171 ILE N H sing N N 172 ILE N H2 sing N N 173 ILE CA C sing N N 174 ILE CA CB sing N N 175 ILE CA HA sing N N 176 ILE C O doub N N 177 ILE C OXT sing N N 178 ILE CB CG1 sing N N 179 ILE CB CG2 sing N N 180 ILE CB HB sing N N 181 ILE CG1 CD1 sing N N 182 ILE CG1 HG12 sing N N 183 ILE CG1 HG13 sing N N 184 ILE CG2 HG21 sing N N 185 ILE CG2 HG22 sing N N 186 ILE CG2 HG23 sing N N 187 ILE CD1 HD11 sing N N 188 ILE CD1 HD12 sing N N 189 ILE CD1 HD13 sing N N 190 ILE OXT HXT sing N N 191 LEU N CA sing N N 192 LEU N H sing N N 193 LEU N H2 sing N N 194 LEU CA C sing N N 195 LEU CA CB sing N N 196 LEU CA HA sing N N 197 LEU C O doub N N 198 LEU C OXT sing N N 199 LEU CB CG sing N N 200 LEU CB HB2 sing N N 201 LEU CB HB3 sing N N 202 LEU CG CD1 sing N N 203 LEU CG CD2 sing N N 204 LEU CG HG sing N N 205 LEU CD1 HD11 sing N N 206 LEU CD1 HD12 sing N N 207 LEU CD1 HD13 sing N N 208 LEU CD2 HD21 sing N N 209 LEU CD2 HD22 sing N N 210 LEU CD2 HD23 sing N N 211 LEU OXT HXT sing N N 212 LYS N CA sing N N 213 LYS N H sing N N 214 LYS N H2 sing N N 215 LYS CA C sing N N 216 LYS CA CB sing N N 217 LYS CA HA sing N N 218 LYS C O doub N N 219 LYS C OXT sing N N 220 LYS CB CG sing N N 221 LYS CB HB2 sing N N 222 LYS CB HB3 sing N N 223 LYS CG CD sing N N 224 LYS CG HG2 sing N N 225 LYS CG HG3 sing N N 226 LYS CD CE sing N N 227 LYS CD HD2 sing N N 228 LYS CD HD3 sing N N 229 LYS CE NZ sing N N 230 LYS CE HE2 sing N N 231 LYS CE HE3 sing N N 232 LYS NZ HZ1 sing N N 233 LYS NZ HZ2 sing N N 234 LYS NZ HZ3 sing N N 235 LYS OXT HXT sing N N 236 MET N CA sing N N 237 MET N H sing N N 238 MET N H2 sing N N 239 MET CA C sing N N 240 MET CA CB sing N N 241 MET CA HA sing N N 242 MET C O doub N N 243 MET C OXT sing N N 244 MET CB CG sing N N 245 MET CB HB2 sing N N 246 MET CB HB3 sing N N 247 MET CG SD sing N N 248 MET CG HG2 sing N N 249 MET CG HG3 sing N N 250 MET SD CE sing N N 251 MET CE HE1 sing N N 252 MET CE HE2 sing N N 253 MET CE HE3 sing N N 254 MET OXT HXT sing N N 255 MSE N CA sing N N 256 MSE N H sing N N 257 MSE N H2 sing N N 258 MSE CA C sing N N 259 MSE CA CB sing N N 260 MSE CA HA sing N N 261 MSE C O doub N N 262 MSE C OXT sing N N 263 MSE OXT HXT sing N N 264 MSE CB CG sing N N 265 MSE CB HB2 sing N N 266 MSE CB HB3 sing N N 267 MSE CG SE sing N N 268 MSE CG HG2 sing N N 269 MSE CG HG3 sing N N 270 MSE SE CE sing N N 271 MSE CE HE1 sing N N 272 MSE CE HE2 sing N N 273 MSE CE HE3 sing N N 274 PHE N CA sing N N 275 PHE N H sing N N 276 PHE N H2 sing N N 277 PHE CA C sing N N 278 PHE CA CB sing N N 279 PHE CA HA sing N N 280 PHE C O doub N N 281 PHE C OXT sing N N 282 PHE CB CG sing N N 283 PHE CB HB2 sing N N 284 PHE CB HB3 sing N N 285 PHE CG CD1 doub Y N 286 PHE CG CD2 sing Y N 287 PHE CD1 CE1 sing Y N 288 PHE CD1 HD1 sing N N 289 PHE CD2 CE2 doub Y N 290 PHE CD2 HD2 sing N N 291 PHE CE1 CZ doub Y N 292 PHE CE1 HE1 sing N N 293 PHE CE2 CZ sing Y N 294 PHE CE2 HE2 sing N N 295 PHE CZ HZ sing N N 296 PHE OXT HXT sing N N 297 PRO N CA sing N N 298 PRO N CD sing N N 299 PRO N H sing N N 300 PRO CA C sing N N 301 PRO CA CB sing N N 302 PRO CA HA sing N N 303 PRO C O doub N N 304 PRO C OXT sing N N 305 PRO CB CG sing N N 306 PRO CB HB2 sing N N 307 PRO CB HB3 sing N N 308 PRO CG CD sing N N 309 PRO CG HG2 sing N N 310 PRO CG HG3 sing N N 311 PRO CD HD2 sing N N 312 PRO CD HD3 sing N N 313 PRO OXT HXT sing N N 314 SER N CA sing N N 315 SER N H sing N N 316 SER N H2 sing N N 317 SER CA C sing N N 318 SER CA CB sing N N 319 SER CA HA sing N N 320 SER C O doub N N 321 SER C OXT sing N N 322 SER CB OG sing N N 323 SER CB HB2 sing N N 324 SER CB HB3 sing N N 325 SER OG HG sing N N 326 SER OXT HXT sing N N 327 THR N CA sing N N 328 THR N H sing N N 329 THR N H2 sing N N 330 THR CA C sing N N 331 THR CA CB sing N N 332 THR CA HA sing N N 333 THR C O doub N N 334 THR C OXT sing N N 335 THR CB OG1 sing N N 336 THR CB CG2 sing N N 337 THR CB HB sing N N 338 THR OG1 HG1 sing N N 339 THR CG2 HG21 sing N N 340 THR CG2 HG22 sing N N 341 THR CG2 HG23 sing N N 342 THR OXT HXT sing N N 343 TRP N CA sing N N 344 TRP N H sing N N 345 TRP N H2 sing N N 346 TRP CA C sing N N 347 TRP CA CB sing N N 348 TRP CA HA sing N N 349 TRP C O doub N N 350 TRP C OXT sing N N 351 TRP CB CG sing N N 352 TRP CB HB2 sing N N 353 TRP CB HB3 sing N N 354 TRP CG CD1 doub Y N 355 TRP CG CD2 sing Y N 356 TRP CD1 NE1 sing Y N 357 TRP CD1 HD1 sing N N 358 TRP CD2 CE2 doub Y N 359 TRP CD2 CE3 sing Y N 360 TRP NE1 CE2 sing Y N 361 TRP NE1 HE1 sing N N 362 TRP CE2 CZ2 sing Y N 363 TRP CE3 CZ3 doub Y N 364 TRP CE3 HE3 sing N N 365 TRP CZ2 CH2 doub Y N 366 TRP CZ2 HZ2 sing N N 367 TRP CZ3 CH2 sing Y N 368 TRP CZ3 HZ3 sing N N 369 TRP CH2 HH2 sing N N 370 TRP OXT HXT sing N N 371 TYR N CA sing N N 372 TYR N H sing N N 373 TYR N H2 sing N N 374 TYR CA C sing N N 375 TYR CA CB sing N N 376 TYR CA HA sing N N 377 TYR C O doub N N 378 TYR C OXT sing N N 379 TYR CB CG sing N N 380 TYR CB HB2 sing N N 381 TYR CB HB3 sing N N 382 TYR CG CD1 doub Y N 383 TYR CG CD2 sing Y N 384 TYR CD1 CE1 sing Y N 385 TYR CD1 HD1 sing N N 386 TYR CD2 CE2 doub Y N 387 TYR CD2 HD2 sing N N 388 TYR CE1 CZ doub Y N 389 TYR CE1 HE1 sing N N 390 TYR CE2 CZ sing Y N 391 TYR CE2 HE2 sing N N 392 TYR CZ OH sing N N 393 TYR OH HH sing N N 394 TYR OXT HXT sing N N 395 VAL N CA sing N N 396 VAL N H sing N N 397 VAL N H2 sing N N 398 VAL CA C sing N N 399 VAL CA CB sing N N 400 VAL CA HA sing N N 401 VAL C O doub N N 402 VAL C OXT sing N N 403 VAL CB CG1 sing N N 404 VAL CB CG2 sing N N 405 VAL CB HB sing N N 406 VAL CG1 HG11 sing N N 407 VAL CG1 HG12 sing N N 408 VAL CG1 HG13 sing N N 409 VAL CG2 HG21 sing N N 410 VAL CG2 HG22 sing N N 411 VAL CG2 HG23 sing N N 412 VAL OXT HXT sing N N 413 # _atom_sites.entry_id 1FYW _atom_sites.fract_transf_matrix[1][1] 0.008251 _atom_sites.fract_transf_matrix[1][2] 0.004764 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009527 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010917 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol AS C N O S SE # loop_